F459136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 230 | 524 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10321442|Ga0157376_103214423 |
| Length | 188 |
| Sequence | MPYRADDSQFQMLTLWGDCRMKMRVMLLMVAIVAAGAALPAQEPVIGVKDPESLFKDPDAKLNKNKQAALHIMRELLQCNQWDRAGEWLTKAYHQHNPNAASGLDGVVTYFTKVRNAKRVDKCDKLTTEVVAVMADDDYVTVLTPRKFPDPRTPGKEYFTSWFDTWRFVDGKADEHWDPATITAPAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 171 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 172 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 173 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 174 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 175 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.72 |
| Rhizosphere | 97.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10046709 | 3300002459 | Bacteria | 894 |
| 2 | Ga0032354_1160538 | 3300003693 | Unclassified | 529 |
| 3 | Ga0065714_10171130 | 3300005288 | Bacteria | 1004 |
| 4 | Ga0065704_10431499 | 3300005289 | Bacteria | 722 |
| 5 | Ga0065712_10076915 | 3300005290 | Bacteria | 3580 |
| 6 | Ga0065712_10112287 | 3300005290 | Bacteria | 1802 |
| 7 | Ga0065712_10362784 | 3300005290 | Bacteria | 773 |
| 8 | Ga0065715_10409456 | 3300005293 | Bacteria | 871 |
| 9 | Ga0065715_10637425 | 3300005293 | Bacteria | 686 |
| 10 | Ga0065707_10177611 | 3300005295 | Bacteria | 1437 |
| 11 | Ga0065707_10347754 | 3300005295 | Bacteria | 923 |
| 12 | Ga0070658_10228520 | 3300005327 | Bacteria | 1575 |
| 13 | Ga0070676_10025553 | 3300005328 | Bacteria | 3339 |
| 14 | Ga0070676_10103655 | 3300005328 | Bacteria | 1761 |
| 15 | Ga0070676_10130483 | 3300005328 | Bacteria | 1589 |
| 16 | Ga0070683_100020814 | 3300005329 | Bacteria | 5843 |
| 17 | Ga0070683_100274055 | 3300005329 | Bacteria | 1605 |
| 18 | Ga0070690_100016542 | 3300005330 | Bacteria | 4421 |
| 19 | Ga0070690_100070728 | 3300005330 | Bacteria | 2266 |
| 20 | Ga0070690_100100435 | 3300005330 | Bacteria | 1918 |
| 21 | Ga0070690_100463406 | 3300005330 | Bacteria | 942 |
| 22 | Ga0070670_100004657 | 3300005331 | Bacteria | 11510 |
| 23 | Ga0070670_100017026 | 3300005331 | Bacteria | 6238 |
| 24 | Ga0070670_100117322 | 3300005331 | Bacteria | 2295 |
| 25 | Ga0070670_100360632 | 3300005331 | Unclassified | 1278 |
| 26 | Ga0070670_100444154 | 3300005331 | Bacteria | 1149 |
| 27 | Ga0070677_10008361 | 3300005333 | Bacteria | 3479 |
| 28 | Ga0070677_10082849 | 3300005333 | Bacteria | 1377 |
| 29 | Ga0068869_100002654 | 3300005334 | Bacteria | 10804 |
| 30 | Ga0068869_100011901 | 3300005334 | Bacteria | 5723 |
| 31 | Ga0068869_100101367 | 3300005334 | Bacteria | 2178 |
| 32 | Ga0068869_100147857 | 3300005334 | Bacteria | 1820 |
| 33 | Ga0068869_100400613 | 3300005334 | Unclassified | 1129 |
| 34 | Ga0070666_10061623 | 3300005335 | Bacteria | 2540 |
| 35 | Ga0070666_10132949 | 3300005335 | Bacteria | 1730 |
| 36 | Ga0070680_100613725 | 3300005336 | Bacteria | 934 |
| 37 | Ga0070682_100085165 | 3300005337 | Bacteria | 2056 |
| 38 | Ga0068868_100135468 | 3300005338 | Bacteria | 2018 |
| 39 | Ga0068868_100422332 | 3300005338 | Bacteria | 1155 |
| 40 | Ga0070689_100051402 | 3300005340 | Bacteria | 3186 |
| 41 | Ga0070689_100080201 | 3300005340 | Bacteria | 2561 |
| 42 | Ga0070689_100263952 | 3300005340 | Bacteria | 1424 |
| 43 | Ga0070687_100159786 | 3300005343 | Bacteria | 1331 |
| 44 | Ga0070687_100243311 | 3300005343 | Bacteria | 1114 |
| 45 | Ga0070661_100039282 | 3300005344 | Bacteria | 3449 |
| 46 | Ga0070661_100078609 | 3300005344 | Bacteria | 2433 |
| 47 | Ga0070668_100070680 | 3300005347 | Bacteria | 2718 |
| 48 | Ga0070669_100038877 | 3300005353 | Bacteria | 3455 |
| 49 | Ga0070669_100074475 | 3300005353 | Bacteria | 2517 |
| 50 | Ga0070669_100127525 | 3300005353 | Bacteria | 1949 |
| 51 | Ga0070669_100431996 | 3300005353 | Bacteria | 1082 |
| 52 | Ga0070675_100040295 | 3300005354 | Bacteria | 3813 |
| 53 | Ga0070675_100050279 | 3300005354 | Bacteria | 3422 |
| 54 | Ga0070675_100079298 | 3300005354 | Bacteria | 2736 |
| 55 | Ga0070675_100126282 | 3300005354 | Bacteria | 2176 |
| 56 | Ga0070675_100148550 | 3300005354 | Bacteria | 2008 |
| 57 | Ga0070675_100402861 | 3300005354 | Bacteria | 1221 |
| 58 | Ga0070675_100597646 | 3300005354 | Bacteria | 1000 |
| 59 | Ga0070675_100672591 | 3300005354 | Bacteria | 942 |
| 60 | Ga0070675_100717048 | 3300005354 | Bacteria | 911 |
| 61 | Ga0070671_100088163 | 3300005355 | Bacteria | 2597 |
| 62 | Ga0070671_100475622 | 3300005355 | Bacteria | 1073 |
| 63 | Ga0070674_100005871 | 3300005356 | Bacteria | 7139 |
| 64 | Ga0070674_100056705 | 3300005356 | Bacteria | 2717 |
| 65 | Ga0070674_100058122 | 3300005356 | Unclassified | 2687 |
| 66 | Ga0070674_100078479 | 3300005356 | Bacteria | 2353 |
| 67 | Ga0070674_100085491 | 3300005356 | Bacteria | 2264 |
| 68 | Ga0070674_100242211 | 3300005356 | Bacteria | 1412 |
| 69 | Ga0070674_100870565 | 3300005356 | Bacteria | 783 |
| 70 | Ga0070674_101412161 | 3300005356 | Bacteria | 623 |
| 71 | Ga0070673_100072044 | 3300005364 | Bacteria | 2778 |
| 72 | Ga0070673_100125429 | 3300005364 | Bacteria | 2147 |
| 73 | Ga0070673_100154972 | 3300005364 | Bacteria | 1943 |
| 74 | Ga0070673_100182036 | 3300005364 | Bacteria | 1799 |
| 75 | Ga0070673_100204499 | 3300005364 | Bacteria | 1702 |
| 76 | Ga0070673_100347021 | 3300005364 | Bacteria | 1316 |
| 77 | Ga0070673_100377444 | 3300005364 | Bacteria | 1263 |
| 78 | Ga0070688_100002480 | 3300005365 | Bacteria | 9334 |
| 79 | Ga0070688_100059811 | 3300005365 | Bacteria | 2404 |
| 80 | Ga0070659_100167048 | 3300005366 | Bacteria | 1801 |
| 81 | Ga0070667_100180671 | 3300005367 | Bacteria | 1866 |
| 82 | Ga0070667_100400287 | 3300005367 | Bacteria | 1250 |
| 83 | Ga0070667_100583883 | 3300005367 | Bacteria | 1029 |
| 84 | Ga0070667_100598209 | 3300005367 | Bacteria | 1016 |
| 85 | Ga0070709_10003100 | 3300005434 | Bacteria | 8927 |
| 86 | Ga0070710_10654775 | 3300005437 | Bacteria | 737 |
| 87 | Ga0070701_10049972 | 3300005438 | Bacteria | 2164 |
| 88 | Ga0070700_100005699 | 3300005441 | Bacteria | 6609 |
| 89 | Ga0070694_100080568 | 3300005444 | Bacteria | 2263 |
| 90 | Ga0070694_100275093 | 3300005444 | Bacteria | 1282 |
| 91 | Ga0070663_100184710 | 3300005455 | Bacteria | 1620 |
| 92 | Ga0070678_100395795 | 3300005456 | Bacteria | 1199 |
| 93 | Ga0070678_100452672 | 3300005456 | Bacteria | 1124 |
| 94 | Ga0070678_101436306 | 3300005456 | Bacteria | 645 |
| 95 | Ga0070662_100041220 | 3300005457 | Bacteria | 3292 |
| 96 | Ga0070681_11293904 | 3300005458 | Bacteria | 652 |
| 97 | Ga0068867_100011607 | 3300005459 | Bacteria | 6220 |
| 98 | Ga0068867_100088701 | 3300005459 | Bacteria | 2344 |
| 99 | Ga0068867_100184069 | 3300005459 | Bacteria | 1663 |
| 100 | Ga0068867_100250255 | 3300005459 | Bacteria | 1441 |
| 101 | Ga0068867_100869622 | 3300005459 | Bacteria | 809 |
| 102 | Ga0070685_10080674 | 3300005466 | Bacteria | 1950 |
| 103 | Ga0070698_101257434 | 3300005471 | Bacteria | 690 |
| 104 | Ga0070699_100862359 | 3300005518 | Bacteria | 829 |
| 105 | Ga0070679_100551059 | 3300005530 | Bacteria | 1097 |
| 106 | Ga0070684_100223479 | 3300005535 | Bacteria | 1718 |
| 107 | Ga0070672_100040491 | 3300005543 | Bacteria | 3575 |
| 108 | Ga0070672_100047993 | 3300005543 | Bacteria | 3316 |
| 109 | Ga0070672_100120818 | 3300005543 | Unclassified | 2144 |
| 110 | Ga0070672_100248880 | 3300005543 | Bacteria | 1496 |
| 111 | Ga0070672_100513638 | 3300005543 | Bacteria | 1037 |
| 112 | Ga0070686_100029149 | 3300005544 | Bacteria | 3354 |
| 113 | Ga0070686_100034606 | 3300005544 | Bacteria | 3114 |
| 114 | Ga0070686_100037356 | 3300005544 | Bacteria | 3012 |
| 115 | Ga0070665_100254009 | 3300005548 | Bacteria | 1759 |
| 116 | Ga0070665_101446636 | 3300005548 | Bacteria | 696 |
| 117 | Ga0070664_100040531 | 3300005564 | Bacteria | 3926 |
| 118 | Ga0070664_100125371 | 3300005564 | Bacteria | 2252 |
| 119 | Ga0070664_100353655 | 3300005564 | Bacteria | 1337 |
| 120 | Ga0070664_100866762 | 3300005564 | Bacteria | 846 |
| 121 | Ga0068857_100153666 | 3300005577 | Bacteria | 2086 |
| 122 | Ga0068854_100070505 | 3300005578 | Bacteria | 2555 |
| 123 | Ga0070702_100213936 | 3300005615 | Bacteria | 1285 |
| 124 | Ga0068859_100129807 | 3300005617 | Bacteria | 2591 |
| 125 | Ga0068859_100270316 | 3300005617 | Bacteria | 1792 |
| 126 | Ga0068859_100506800 | 3300005617 | Bacteria | 1302 |
| 127 | Ga0068864_100219225 | 3300005618 | Bacteria | 1755 |
| 128 | Ga0068864_100684233 | 3300005618 | Bacteria | 1001 |
| 129 | Ga0068864_100989502 | 3300005618 | Bacteria | 834 |
| 130 | Ga0068861_100033380 | 3300005719 | Bacteria | 3795 |
| 131 | Ga0068861_100909754 | 3300005719 | Bacteria | 834 |
| 132 | Ga0068870_10000249 | 3300005840 | Bacteria | 19958 |
| 133 | Ga0068870_10005245 | 3300005840 | Bacteria | 5642 |
| 134 | Ga0068870_10065360 | 3300005840 | Bacteria | 1967 |
| 135 | Ga0068870_10280160 | 3300005840 | Bacteria | 1045 |
| 136 | Ga0068863_100050412 | 3300005841 | Bacteria | 3945 |
| 137 | Ga0068863_100690952 | 3300005841 | Bacteria | 1014 |
| 138 | Ga0068863_100708525 | 3300005841 | Unclassified | 1001 |
| 139 | Ga0068858_100023389 | 3300005842 | Bacteria | 5756 |
| 140 | Ga0068858_100280117 | 3300005842 | Bacteria | 1588 |
| 141 | Ga0068858_100298383 | 3300005842 | Bacteria | 1537 |
| 142 | Ga0068858_100319433 | 3300005842 | Bacteria | 1484 |
| 143 | Ga0068860_100432741 | 3300005843 | Bacteria | 1306 |
| 144 | Ga0068860_100684724 | 3300005843 | Bacteria | 1034 |
| 145 | Ga0068860_101234585 | 3300005843 | Bacteria | 768 |
| 146 | Ga0068862_100155394 | 3300005844 | Bacteria | 2039 |
| 147 | Ga0068862_101058705 | 3300005844 | Bacteria | 804 |
| 148 | Ga0081539_10159941 | 3300005985 | Bacteria | 1074 |
| 149 | Ga0070712_100065995 | 3300006175 | Bacteria | 2571 |
| 150 | Ga0097621_100096387 | 3300006237 | Bacteria | 2482 |
| 151 | Ga0097621_100114746 | 3300006237 | Bacteria | 2279 |
| 152 | Ga0097621_100116794 | 3300006237 | Bacteria | 2260 |
| 153 | Ga0097621_100652024 | 3300006237 | Bacteria | 966 |
| 154 | Ga0068871_100009325 | 3300006358 | Bacteria | 7104 |
| 155 | Ga0068871_100023640 | 3300006358 | Bacteria | 4758 |
| 156 | Ga0068871_100089891 | 3300006358 | Bacteria | 2557 |
| 157 | Ga0068871_100211492 | 3300006358 | Bacteria | 1678 |
| 158 | Ga0075428_100006280 | 3300006844 | Bacteria | 13210 |
| 159 | Ga0075428_100165734 | 3300006844 | Bacteria | 2397 |
| 160 | Ga0075428_100461214 | 3300006844 | Bacteria | 1360 |
| 161 | Ga0075428_100659159 | 3300006844 | Bacteria | 1116 |
| 162 | Ga0075430_100033279 | 3300006846 | Bacteria | 4375 |
| 163 | Ga0075430_100046284 | 3300006846 | Bacteria | 3674 |
| 164 | Ga0075430_100109062 | 3300006846 | Bacteria | 2309 |
| 165 | Ga0075430_100149126 | 3300006846 | Bacteria | 1947 |
| 166 | Ga0075430_100317421 | 3300006846 | Bacteria | 1288 |
| 167 | Ga0075430_100407542 | 3300006846 | Bacteria | 1122 |
| 168 | Ga0075431_100007236 | 3300006847 | Bacteria | 11043 |
| 169 | Ga0075431_100182982 | 3300006847 | Bacteria | 2150 |
| 170 | Ga0075431_100700663 | 3300006847 | Bacteria | 990 |
| 171 | Ga0075433_10002930 | 3300006852 | Bacteria | 13096 |
| 172 | Ga0075433_10003186 | 3300006852 | Bacteria | 12645 |
| 173 | Ga0075433_10063472 | 3300006852 | Bacteria | 3236 |
| 174 | Ga0075433_10589679 | 3300006852 | Bacteria | 976 |
| 175 | Ga0075434_100000852 | 3300006871 | Bacteria | 24305 |
| 176 | Ga0075434_100003273 | 3300006871 | Bacteria | 14491 |
| 177 | Ga0075434_100198948 | 3300006871 | Bacteria | 2023 |
| 178 | Ga0075434_100262828 | 3300006871 | Bacteria | 1745 |
| 179 | Ga0075434_100569555 | 3300006871 | Bacteria | 1152 |
| 180 | Ga0075429_100013532 | 3300006880 | Bacteria | 7079 |
| 181 | Ga0075429_100103729 | 3300006880 | Bacteria | 2483 |
| 182 | Ga0075429_100108355 | 3300006880 | Bacteria | 2428 |
| 183 | Ga0068865_100024156 | 3300006881 | Bacteria | 3985 |
| 184 | Ga0068865_100127083 | 3300006881 | Bacteria | 1904 |
| 185 | Ga0097620_100129813 | 3300006931 | Bacteria | 2591 |
| 186 | Ga0097620_100270331 | 3300006931 | Bacteria | 1792 |
| 187 | Ga0097620_100319830 | 3300006931 | Bacteria | 1646 |
| 188 | Ga0097620_100506788 | 3300006931 | Bacteria | 1302 |
| 189 | Ga0075435_100007756 | 3300007076 | Bacteria | 7672 |
| 190 | Ga0111539_10004119 | 3300009094 | Bacteria | 19078 |
| 191 | Ga0111539_10019888 | 3300009094 | Bacteria | 8272 |
| 192 | Ga0111539_10076600 | 3300009094 | Bacteria | 3938 |
| 193 | Ga0111539_10205600 | 3300009094 | Bacteria | 2295 |
| 194 | Ga0111539_10619580 | 3300009094 | Bacteria | 1260 |
| 195 | Ga0111539_11081049 | 3300009094 | Bacteria | 932 |
| 196 | Ga0111539_11293813 | 3300009094 | Bacteria | 846 |
| 197 | Ga0105245_10089924 | 3300009098 | Bacteria | 2823 |
| 198 | Ga0105245_11995562 | 3300009098 | Bacteria | 634 |
| 199 | Ga0105247_10019728 | 3300009101 | Bacteria | 4049 |
| 200 | Ga0105247_10131311 | 3300009101 | Bacteria | 1633 |
| 201 | Ga0114129_10019563 | 3300009147 | Bacteria | 9639 |
| 202 | Ga0114129_10261922 | 3300009147 | Bacteria | 2317 |
| 203 | Ga0114129_11524196 | 3300009147 | Bacteria | 821 |
| 204 | Ga0105243_10877193 | 3300009148 | Bacteria | 891 |
| 205 | Ga0105243_11115303 | 3300009148 | Bacteria | 798 |
| 206 | Ga0105242_10003977 | 3300009176 | Bacteria | 11492 |
| 207 | Ga0105242_10261111 | 3300009176 | Bacteria | 1564 |
| 208 | Ga0105242_10362698 | 3300009176 | Bacteria | 1341 |
| 209 | Ga0105248_10284303 | 3300009177 | Bacteria | 1862 |
| 210 | Ga0105248_10415461 | 3300009177 | Bacteria | 1515 |
| 211 | Ga0105248_10700682 | 3300009177 | Bacteria | 1143 |
| 212 | Ga0105249_10103716 | 3300009553 | Bacteria | 2679 |
| 213 | Ga0105249_10318556 | 3300009553 | Bacteria | 1566 |
| 214 | Ga0105249_10388544 | 3300009553 | Bacteria | 1423 |
| 215 | Ga0105249_10539476 | 3300009553 | Bacteria | 1216 |
| 216 | Ga0105246_10460497 | 3300011119 | Bacteria | 1071 |
| 217 | Ga0105246_10514072 | 3300011119 | Bacteria | 1019 |
| 218 | Ga0105246_11044526 | 3300011119 | Bacteria | 742 |
| 219 | Ga0157325_1001121 | 3300012485 | Bacteria | 1167 |
| 220 | Ga0157370_10506971 | 3300013104 | Bacteria | 1108 |
| 221 | Ga0157374_10047279 | 3300013296 | Bacteria | 3989 |
| 222 | Ga0157374_10142197 | 3300013296 | Unclassified | 2330 |
| 223 | Ga0157378_10015960 | 3300013297 | Bacteria | 6578 |
| 224 | Ga0163162_10036676 | 3300013306 | Bacteria | 4888 |
| 225 | Ga0163162_10287143 | 3300013306 | Bacteria | 1777 |
| 226 | Ga0163162_11277892 | 3300013306 | Bacteria | 834 |
| 227 | Ga0163162_12022121 | 3300013306 | Bacteria | 660 |
| 228 | Ga0157375_10022547 | 3300013308 | Bacteria | 5796 |
| 229 | Ga0157375_10838355 | 3300013308 | Unclassified | 1066 |
| 230 | Ga0157375_12472354 | 3300013308 | Bacteria | 620 |
| 231 | Ga0163163_10007402 | 3300014325 | Bacteria | 9693 |
| 232 | Ga0163163_10084383 | 3300014325 | Bacteria | 3182 |
| 233 | Ga0157380_10012560 | 3300014326 | Bacteria | 6146 |
| 234 | Ga0157380_10056754 | 3300014326 | Bacteria | 3116 |
| 235 | Ga0157380_10179800 | 3300014326 | Bacteria | 1857 |
| 236 | Ga0157380_10224100 | 3300014326 | Bacteria | 1684 |
| 237 | Ga0157380_10304910 | 3300014326 | Bacteria | 1469 |
| 238 | Ga0157380_10633440 | 3300014326 | Bacteria | 1064 |
| 239 | Ga0157377_10014587 | 3300014745 | Bacteria | 4001 |
| 240 | Ga0157377_10057497 | 3300014745 | Bacteria | 2212 |
| 241 | Ga0157379_10167390 | 3300014968 | Bacteria | 1984 |
| 242 | Ga0157376_10178881 | 3300014969 | Bacteria | 1937 |
| 243 | Ga0157376_10321442 | 3300014969 | Bacteria | 1471 |
| 244 | Ga0157376_10492502 | 3300014969 | Bacteria | 1203 |
| 245 | Ga0163161_10042416 | 3300017792 | Bacteria | 3272 |
| 246 | Ga0163161_10310195 | 3300017792 | Bacteria | 1245 |
| 247 | Ga0207697_10020719 | 3300025315 | Bacteria | 2691 |
| 248 | Ga0207697_10181949 | 3300025315 | Bacteria | 921 |
| 249 | Ga0207682_10004445 | 3300025893 | Bacteria | 5866 |
| 250 | Ga0207682_10010733 | 3300025893 | Bacteria | 3585 |
| 251 | Ga0207682_10136135 | 3300025893 | Bacteria | 1099 |
| 252 | Ga0207642_10003899 | 3300025899 | Bacteria | 4756 |
| 253 | Ga0207710_10142543 | 3300025900 | Bacteria | 1158 |
| 254 | Ga0207688_10022695 | 3300025901 | Bacteria | 3436 |
| 255 | Ga0207688_10245469 | 3300025901 | Bacteria | 1083 |
| 256 | Ga0207680_10019297 | 3300025903 | Bacteria | 3643 |
| 257 | Ga0207680_10527041 | 3300025903 | Bacteria | 842 |
| 258 | Ga0207685_10099623 | 3300025905 | Bacteria | 1240 |
| 259 | Ga0207699_10015884 | 3300025906 | Bacteria | 3924 |
| 260 | Ga0207645_10005120 | 3300025907 | Bacteria | 9591 |
| 261 | Ga0207645_10011662 | 3300025907 | Bacteria | 5992 |
| 262 | Ga0207645_10084768 | 3300025907 | Bacteria | 2034 |
| 263 | Ga0207643_10013928 | 3300025908 | Bacteria | 4363 |
| 264 | Ga0207643_10015662 | 3300025908 | Bacteria | 4129 |
| 265 | Ga0207643_10091464 | 3300025908 | Bacteria | 1774 |
| 266 | Ga0207643_10328224 | 3300025908 | Bacteria | 957 |
| 267 | Ga0207643_10335672 | 3300025908 | Bacteria | 946 |
| 268 | Ga0207707_10454562 | 3300025912 | Bacteria | 1096 |
| 269 | Ga0207693_10077455 | 3300025915 | Bacteria | 2604 |
| 270 | Ga0207663_10706010 | 3300025916 | Bacteria | 799 |
| 271 | Ga0207662_10047524 | 3300025918 | Bacteria | 2542 |
| 272 | Ga0207662_10093548 | 3300025918 | Bacteria | 1852 |
| 273 | Ga0207662_10164625 | 3300025918 | Bacteria | 1419 |
| 274 | Ga0207662_10254521 | 3300025918 | Bacteria | 1154 |
| 275 | Ga0207649_10076890 | 3300025920 | Bacteria | 2149 |
| 276 | Ga0207649_10141043 | 3300025920 | Bacteria | 1649 |
| 277 | Ga0207649_10867919 | 3300025920 | Bacteria | 706 |
| 278 | Ga0207646_10437071 | 3300025922 | Bacteria | 1181 |
| 279 | Ga0207681_10024808 | 3300025923 | Bacteria | 3850 |
| 280 | Ga0207681_10039323 | 3300025923 | Unclassified | 3140 |
| 281 | Ga0207681_10186071 | 3300025923 | Bacteria | 1585 |
| 282 | Ga0207681_10215323 | 3300025923 | Bacteria | 1483 |
| 283 | Ga0207681_10598263 | 3300025923 | Bacteria | 911 |
| 284 | Ga0207681_10778878 | 3300025923 | Bacteria | 798 |
| 285 | Ga0207681_10987669 | 3300025923 | Bacteria | 706 |
| 286 | Ga0207650_10008303 | 3300025925 | Bacteria | 7090 |
| 287 | Ga0207650_10013568 | 3300025925 | Bacteria | 5643 |
| 288 | Ga0207659_10006225 | 3300025926 | Bacteria | 7300 |
| 289 | Ga0207659_10018444 | 3300025926 | Bacteria | 4575 |
| 290 | Ga0207659_10033487 | 3300025926 | Bacteria | 3536 |
| 291 | Ga0207659_10063706 | 3300025926 | Bacteria | 2666 |
| 292 | Ga0207659_10080639 | 3300025926 | Bacteria | 2404 |
| 293 | Ga0207659_10188994 | 3300025926 | Bacteria | 1638 |
| 294 | Ga0207659_10305560 | 3300025926 | Bacteria | 1308 |
| 295 | Ga0207659_10731991 | 3300025926 | Bacteria | 848 |
| 296 | Ga0207644_10004157 | 3300025931 | Bacteria | 9388 |
| 297 | Ga0207644_11406544 | 3300025931 | Bacteria | 586 |
| 298 | Ga0207690_10115505 | 3300025932 | Bacteria | 1940 |
| 299 | Ga0207706_10088339 | 3300025933 | Bacteria | 2725 |
| 300 | Ga0207706_10367007 | 3300025933 | Bacteria | 1250 |
| 301 | Ga0207706_10911017 | 3300025933 | Bacteria | 742 |
| 302 | Ga0207686_10046729 | 3300025934 | Bacteria | 2672 |
| 303 | Ga0207686_10087750 | 3300025934 | Bacteria | 2047 |
| 304 | Ga0207709_10116381 | 3300025935 | Bacteria | 1797 |
| 305 | Ga0207709_10413188 | 3300025935 | Bacteria | 1034 |
| 306 | Ga0207670_10086705 | 3300025936 | Bacteria | 2204 |
| 307 | Ga0207670_10158599 | 3300025936 | Bacteria | 1686 |
| 308 | Ga0207670_10206116 | 3300025936 | Bacteria | 1496 |
| 309 | Ga0207670_10268042 | 3300025936 | Bacteria | 1326 |
| 310 | Ga0207670_10378750 | 3300025936 | Bacteria | 1126 |
| 311 | Ga0207670_10737854 | 3300025936 | Bacteria | 817 |
| 312 | Ga0207669_10003643 | 3300025937 | Bacteria | 6685 |
| 313 | Ga0207669_10108875 | 3300025937 | Bacteria | 1851 |
| 314 | Ga0207669_10253429 | 3300025937 | Bacteria | 1312 |
| 315 | Ga0207669_10324175 | 3300025937 | Unclassified | 1180 |
| 316 | Ga0207704_10543792 | 3300025938 | Unclassified | 943 |
| 317 | Ga0207691_10026751 | 3300025940 | Bacteria | 5413 |
| 318 | Ga0207691_10086995 | 3300025940 | Bacteria | 2804 |
| 319 | Ga0207691_10112553 | 3300025940 | Bacteria | 2419 |
| 320 | Ga0207691_10129135 | 3300025940 | Bacteria | 2234 |
| 321 | Ga0207691_10154117 | 3300025940 | Unclassified | 2019 |
| 322 | Ga0207691_10329726 | 3300025940 | Bacteria | 1308 |
| 323 | Ga0207711_10163033 | 3300025941 | Bacteria | 2019 |
| 324 | Ga0207711_10510725 | 3300025941 | Bacteria | 1120 |
| 325 | Ga0207689_10004330 | 3300025942 | Bacteria | 12928 |
| 326 | Ga0207689_10016858 | 3300025942 | Bacteria | 6182 |
| 327 | Ga0207689_10231942 | 3300025942 | Bacteria | 1525 |
| 328 | Ga0207689_10360359 | 3300025942 | Unclassified | 1209 |
| 329 | Ga0207679_10004309 | 3300025945 | Bacteria | 8852 |
| 330 | Ga0207679_10235028 | 3300025945 | Bacteria | 1550 |
| 331 | Ga0207679_10481815 | 3300025945 | Bacteria | 1104 |
| 332 | Ga0207651_10013216 | 3300025960 | Bacteria | 4713 |
| 333 | Ga0207651_10026016 | 3300025960 | Bacteria | 3647 |
| 334 | Ga0207651_10264174 | 3300025960 | Bacteria | 1414 |
| 335 | Ga0207651_10420207 | 3300025960 | Bacteria | 1141 |
| 336 | Ga0207712_10170279 | 3300025961 | Bacteria | 1702 |
| 337 | Ga0207668_10035146 | 3300025972 | Bacteria | 3334 |
| 338 | Ga0207668_10101498 | 3300025972 | Bacteria | 2139 |
| 339 | Ga0207668_10595863 | 3300025972 | Bacteria | 962 |
| 340 | Ga0207668_10947617 | 3300025972 | Bacteria | 768 |
| 341 | Ga0207640_11048437 | 3300025981 | Bacteria | 719 |
| 342 | Ga0207658_10040198 | 3300025986 | Bacteria | 3379 |
| 343 | Ga0207658_10985333 | 3300025986 | Bacteria | 769 |
| 344 | Ga0207658_11356407 | 3300025986 | Bacteria | 650 |
| 345 | Ga0207677_10060546 | 3300026023 | Bacteria | 2617 |
| 346 | Ga0207703_10095736 | 3300026035 | Bacteria | 2505 |
| 347 | Ga0207703_10218371 | 3300026035 | Bacteria | 1703 |
| 348 | Ga0207703_10503021 | 3300026035 | Bacteria | 1138 |
| 349 | Ga0207703_10934015 | 3300026035 | Bacteria | 831 |
| 350 | Ga0207678_10172884 | 3300026067 | Bacteria | 1844 |
| 351 | Ga0207708_10003780 | 3300026075 | Bacteria | 11157 |
| 352 | Ga0207708_10049416 | 3300026075 | Bacteria | 3202 |
| 353 | Ga0207641_10048112 | 3300026088 | Bacteria | 3598 |
| 354 | Ga0207641_10400358 | 3300026088 | Bacteria | 1318 |
| 355 | Ga0207648_10004440 | 3300026089 | Bacteria | 14396 |
| 356 | Ga0207648_10084034 | 3300026089 | Bacteria | 2776 |
| 357 | Ga0207648_10093227 | 3300026089 | Bacteria | 2634 |
| 358 | Ga0207648_10190889 | 3300026089 | Bacteria | 1815 |
| 359 | Ga0207648_10283806 | 3300026089 | Bacteria | 1481 |
| 360 | Ga0207648_10538969 | 3300026089 | Bacteria | 1071 |
| 361 | Ga0207676_10137579 | 3300026095 | Bacteria | 2086 |
| 362 | Ga0207676_10290312 | 3300026095 | Bacteria | 1489 |
| 363 | Ga0207676_10346171 | 3300026095 | Bacteria | 1373 |
| 364 | Ga0207674_10336889 | 3300026116 | Bacteria | 1458 |
| 365 | Ga0207674_10357838 | 3300026116 | Bacteria | 1411 |
| 366 | Ga0207674_10647704 | 3300026116 | Bacteria | 1020 |
| 367 | Ga0207675_100028731 | 3300026118 | Bacteria | 5180 |
| 368 | Ga0207675_100165904 | 3300026118 | Bacteria | 2109 |
| 369 | Ga0207675_100340353 | 3300026118 | Bacteria | 1468 |
| 370 | Ga0207675_100589610 | 3300026118 | Bacteria | 1114 |
| 371 | Ga0207675_101767133 | 3300026118 | Bacteria | 638 |
| 372 | Ga0207683_10061989 | 3300026121 | Bacteria | 3293 |
| 373 | Ga0207683_10068505 | 3300026121 | Bacteria | 3133 |
| 374 | Ga0207683_10344671 | 3300026121 | Bacteria | 1367 |
| 375 | Ga0207683_10822012 | 3300026121 | Bacteria | 862 |
| 376 | Ga0207683_10873474 | 3300026121 | Bacteria | 835 |
| 377 | Ga0209967_1033901 | 3300027364 | Bacteria | 768 |
| 378 | Ga0209971_1142949 | 3300027682 | Bacteria | 590 |
| 379 | Ga0209974_10096461 | 3300027876 | Bacteria | 1030 |
| 380 | Ga0207428_10003132 | 3300027907 | Bacteria | 16221 |
| 381 | Ga0207428_10007180 | 3300027907 | Bacteria | 10186 |
| 382 | Ga0207428_10266016 | 3300027907 | Bacteria | 1276 |
| 383 | Ga0268266_11228805 | 3300028379 | Bacteria | 724 |
| 384 | Ga0268266_11711544 | 3300028379 | Bacteria | 604 |
| 385 | Ga0268266_11943180 | 3300028379 | Bacteria | 562 |
| 386 | Ga0268265_10094017 | 3300028380 | Bacteria | 2403 |
| 387 | Ga0268265_10281684 | 3300028380 | Bacteria | 1488 |
| 388 | Ga0268265_10331123 | 3300028380 | Bacteria | 1383 |
| 389 | Ga0268265_10861288 | 3300028380 | Bacteria | 887 |
| 390 | Ga0268265_11432363 | 3300028380 | Bacteria | 693 |
| 391 | Ga0268265_11530201 | 3300028380 | Bacteria | 671 |
| 392 | Ga0268264_10305485 | 3300028381 | Bacteria | 1499 |
| 393 | Ga0268264_10539757 | 3300028381 | Bacteria | 1142 |
| 394 | Ga0268264_10722997 | 3300028381 | Bacteria | 990 |
| 395 | Ga0268264_11041616 | 3300028381 | Bacteria | 826 |
| 396 | Ga0307408_100571971 | 3300031548 | Bacteria | 1000 |
| 397 | Ga0307408_101212501 | 3300031548 | Bacteria | 704 |
| 398 | Ga0307412_10244115 | 3300031911 | Bacteria | 1391 |
| 399 | Ga0307416_100195506 | 3300032002 | Bacteria | 1913 |
| 400 | Ga0307416_100979985 | 3300032002 | Unclassified | 948 |
| 401 | Ga0307416_102321715 | 3300032002 | Bacteria | 637 |
| 402 | Ga0307414_10098941 | 3300032004 | Unclassified | 2190 |
| 403 | Ga0373934_0338459 | 3300035086 | Bacteria | 626 |
| 404 | Ga0373944_0119666 | 3300035089 | Bacteria | 906 |
| 405 | Ga0373923_0071212 | 3300035111 | Bacteria | 1493 |
| 406 | Ga0373932_0008500 | 3300035112 | Bacteria | 2456 |
| 407 | Ga0373936_0195869 | 3300035113 | Bacteria | 890 |
| 408 | Ga0373936_0239746 | 3300035113 | Bacteria | 808 |
| 409 | Ga0373956_0159430 | 3300035119 | Bacteria | 1063 |
| 410 | Ga0373957_0076732 | 3300035120 | Bacteria | 1314 |
| 411 | Ga0373946_0122461 | 3300035171 | Bacteria | 1189 |
| 412 | Ga0373955_0080303 | 3300035172 | Bacteria | 1842 |
| 413 | Ga0373962_0181723 | 3300035242 | Bacteria | 703 |
| 414 | Ga0373924_0010264 | 3300035410 | Bacteria | 3447 |
| 415 | Ga0373935_0077317 | 3300035692 | Bacteria | 2157 |
| 416 | Ga0373927_0046317 | 3300035695 | Bacteria | 2814 |
| 417 | Ga0373933_0034019 | 3300035724 | Bacteria | 2968 |
| 418 | Ga0373947_0479446 | 3300035725 | Bacteria | 844 |
| 419 | Ga0373947_0528679 | 3300035725 | Bacteria | 802 |
| 420 | Ga0373947_0568487 | 3300035725 | Bacteria | 772 |
| 421 | Ga0373937_0222939 | 3300036401 | Unclassified | 1775 |
| 422 | Ga0373925_0160875 | 3300037068 | Bacteria | 1768 |
| 423 | Ga0373925_0407438 | 3300037068 | Bacteria | 1110 |
| 424 | Ga0436365_1567992 | 3300039437 | Bacteria | 1247 |
| 425 | Ga0439453_0000854 | 3300041408 | Bacteria | 3626 |
| 426 | Ga0451853_2385990 | 3300041512 | Bacteria | 1816 |
| 427 | Ga0439450_000889 | 3300042008 | Bacteria | 4143 |
| 428 | Ga0439435_0045205 | 3300042436 | Bacteria | 1244 |
| 429 | Ga0450901_015139 | 3300042533 | Bacteria | 810 |
| 430 | Ga0439440_0047066 | 3300042993 | Bacteria | 1067 |
| 431 | Ga0451576_0161262 | 3300045051 | Bacteria | 2340 |
| 432 | Ga0451576_0374127 | 3300045051 | Bacteria | 1493 |
| 433 | Ga0495629_0227805 | 3300046459 | Bacteria | 1285 |
| 434 | Ga0495629_0536806 | 3300046459 | Unclassified | 786 |
| 435 | Ga0495585_0474076 | 3300046492 | Bacteria | 597 |
| 436 | Ga0495618_0469160 | 3300046514 | Unclassified | 762 |
| 437 | Ga0495630_0013012 | 3300046517 | Bacteria | 6045 |
| 438 | Ga0495643_0005221 | 3300046522 | Bacteria | 8844 |
| 439 | Ga0495640_0055542 | 3300046533 | Bacteria | 2709 |
| 440 | Ga0495587_0125866 | 3300046536 | Bacteria | 1466 |
| 441 | Ga0495645_0083112 | 3300046543 | Unclassified | 2296 |
| 442 | Ga0495656_0169954 | 3300046615 | Bacteria | 1065 |
| 443 | Ga0495635_0615813 | 3300046663 | Unclassified | 708 |
| 444 | Ga0495613_0001316 | 3300046689 | Bacteria | 18966 |
| 445 | Ga0495602_0417327 | 3300048088 | Unclassified | 954 |
| 446 | Ga0496100_0001360 | 3300048903 | Bacteria | 11981 |
| 447 | Ga0496101_0000846 | 3300048904 | Bacteria | 18019 |
| 448 | Ga0496102_0187575 | 3300048905 | Bacteria | 1949 |
| 449 | Ga0496104_0015664 | 3300048907 | Bacteria | 6876 |
| 450 | Ga0496107_0123883 | 3300048910 | Bacteria | 1905 |
| 451 | Ga0496109_0506834 | 3300048912 | Bacteria | 1139 |
| 452 | Ga0496112_1072729 | 3300048915 | Bacteria | 724 |
| 453 | Ga0496114_0001483 | 3300048917 | Bacteria | 17820 |
| 454 | Ga0496114_0211714 | 3300048917 | Bacteria | 1700 |
| 455 | Ga0501309_025150 | 3300049129 | Bacteria | 854 |
| 456 | Ga0501031_0280537 | 3300049568 | Bacteria | 1081 |
| 457 | Ga0501032_0492573 | 3300049569 | Bacteria | 784 |
| 458 | Ga0501036_0025356 | 3300049572 | Bacteria | 5002 |
| 459 | Ga0501039_0051689 | 3300049575 | Bacteria | 3180 |
| 460 | Ga0501040_0278360 | 3300049576 | Bacteria | 1195 |
| 461 | Ga0501040_0543941 | 3300049576 | Bacteria | 838 |
| 462 | Ga0501041_0113650 | 3300049577 | Bacteria | 1681 |
| 463 | Ga0501042_0096911 | 3300049578 | Bacteria | 2120 |
| 464 | Ga0501042_0455038 | 3300049578 | Bacteria | 928 |
| 465 | Ga0501046_0086970 | 3300049580 | Bacteria | 2409 |
| 466 | Ga0501071_1107896 | 3300049587 | Bacteria | 612 |
| 467 | Ga0501072_0378358 | 3300049588 | Bacteria | 1123 |
| 468 | Ga0501074_0052846 | 3300049590 | Bacteria | 2932 |
| 469 | Ga0501075_0002170 | 3300049591 | Bacteria | 12998 |
| 470 | Ga0501075_0335127 | 3300049591 | Bacteria | 1153 |
| 471 | Ga0501076_0194456 | 3300049592 | Bacteria | 1656 |
| 472 | Ga0501076_0319875 | 3300049592 | Bacteria | 1273 |
| 473 | Ga0501249_004712 | 3300049679 | Bacteria | 2778 |
| 474 | Ga0501225_0080192 | 3300049705 | Bacteria | 937 |
| 475 | Ga0501079_0023872 | 3300049741 | Bacteria | 4691 |
| 476 | Ga0501080_0356052 | 3300049742 | Bacteria | 1321 |
| 477 | Ga0501081_0033307 | 3300049743 | Bacteria | 3500 |
| 478 | Ga0501083_0922848 | 3300049744 | Bacteria | 568 |
| 479 | Ga0501045_0560585 | 3300049824 | Bacteria | 847 |
| 480 | Ga0501045_0565055 | 3300049824 | Bacteria | 843 |
| 481 | nmdc:mga05p37_106831_c1 | 3300050507 | Bacteria | 3444 |
| 482 | nmdc:mga05p37_26749_c1 | 3300050507 | Bacteria | 7015 |
| 483 | nmdc:mga09592_23720_c1 | 3300050508 | Bacteria | 5068 |
| 484 | nmdc:mga09592_498579_c1 | 3300050508 | Bacteria | 1048 |
| 485 | nmdc:mga09592_535017_c1 | 3300050508 | Bacteria | 1007 |
| 486 | nmdc:mga09592_65965_c1 | 3300050508 | Bacteria | 3067 |
| 487 | nmdc:mga0qj67_1929_c1 | 3300050509 | Bacteria | 14733 |
| 488 | nmdc:mga0qj67_196838_c1 | 3300050509 | Bacteria | 1638 |
| 489 | nmdc:mga0qj67_272867_c1 | 3300050509 | Bacteria | 1371 |
| 490 | nmdc:mga0qj67_391437_c1 | 3300050509 | Bacteria | 1122 |
| 491 | nmdc:mga0qj67_529411_c1 | 3300050509 | Bacteria | 946 |
| 492 | nmdc:mga0qj67_633138_c1 | 3300050509 | Bacteria | 854 |
| 493 | nmdc:mga0qj67_98047_c1 | 3300050509 | Bacteria | 2361 |
| 494 | nmdc:mga0qj67_99176_c1 | 3300050509 | Bacteria | 2347 |
| 495 | nmdc:mga06r32_115284_c1 | 3300050510 | Bacteria | 2646 |
| 496 | nmdc:mga06r32_1374241_c1 | 3300050510 | Bacteria | 649 |
| 497 | nmdc:mga06r32_1971_c2 | 3300050510 | Bacteria | 13750 |
| 498 | nmdc:mga06r32_334279_c1 | 3300050510 | Bacteria | 1500 |
| 499 | nmdc:mga06r32_622581_c1 | 3300050510 | Bacteria | 1049 |
| 500 | nmdc:mga06r32_706084_c1 | 3300050510 | Bacteria | 974 |
| 501 | nmdc:mga08y16_127440_c1 | 3300050511 | Bacteria | 2648 |
| 502 | nmdc:mga08y16_22537_c1 | 3300050511 | Bacteria | 6649 |
| 503 | nmdc:mga08y16_38144_c1 | 3300050511 | Bacteria | 5046 |
| 504 | nmdc:mga08y16_501584_c1 | 3300050511 | Bacteria | 1233 |
| 505 | nmdc:mga08y16_559956_c1 | 3300050511 | Bacteria | 1156 |
| 506 | nmdc:mga08y16_637677_c1 | 3300050511 | Bacteria | 1071 |
| 507 | nmdc:mga08y16_7050_c1 | 3300050511 | Bacteria | 11796 |
| 508 | nmdc:mga08y16_79613_c1 | 3300050511 | Bacteria | 3415 |
| 509 | nmdc:mga0n895_1486_c1 | 3300050512 | Bacteria | 17585 |
| 510 | nmdc:mga0n895_168822_c1 | 3300050512 | Bacteria | 2220 |
| 511 | nmdc:mga0n895_24554_c1 | 3300050512 | Bacteria | 5682 |
| 512 | nmdc:mga0n895_818270_c1 | 3300050512 | Bacteria | 921 |
| 513 | nmdc:mga0rr50_19004_c1 | 3300050513 | Bacteria | 4628 |
| 514 | nmdc:mga0rr50_360128_c1 | 3300050513 | Bacteria | 1224 |
| 515 | nmdc:mga0rr50_5456_c1 | 3300050513 | Bacteria | 7588 |
| 516 | nmdc:mga0a205_16818_c1 | 3300050515 | Bacteria | 6851 |
| 517 | nmdc:mga0a205_2367_c1 | 3300050515 | Bacteria | 16616 |
| 518 | nmdc:mga0a205_550167_c1 | 3300050515 | Bacteria | 1009 |
| 519 | Ga0495601_0053665 | 3300053077 | Bacteria | 2548 |
| 520 | Ga0495595_0178438 | 3300053084 | Bacteria | 1053 |
| 521 | Ga0495619_0002013 | 3300053085 | Bacteria | 13507 |
| 522 | Ga0501084_0730626 | 3300054114 | Bacteria | 834 |
| 523 | Ga0530510_0158022 | 3300061734 | Bacteria | 1676 |
| 524 | Ga0530510_0890975 | 3300061734 | Bacteria | 680 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005518 | Ga0070699_100862359 | Ga0070699_1008623591 | 131 |
| 2 | 3300035113 | Ga0373936_0239746 | Ga0373936_0239746_292_792 | 135 |
| 3 | 3300006852 | Ga0075433_10003186 | Ga0075433_100031869 | 136 |
| 4 | 3300006871 | Ga0075434_100000852 | Ga0075434_10000085221 | 136 |
| 5 | 3300007076 | Ga0075435_100007756 | Ga0075435_1000077561 | 136 |
| 6 | 3300050512 | nmdc:mga0n895_1486_c1 | nmdc:mga0n895_1486_c1_10512_11024 | 136 |
| 7 | 3300050513 | nmdc:mga0rr50_5456_c1 | nmdc:mga0rr50_5456_c1_18_530 | 136 |
| 8 | 3300006852 | Ga0075433_10002930 | Ga0075433_100029308 | 141 |
| 9 | 3300006871 | Ga0075434_100003273 | Ga0075434_1000032739 | 141 |
| 10 | 3300050512 | nmdc:mga0n895_24554_c1 | nmdc:mga0n895_24554_c1_2079_2591 | 141 |
| 11 | 3300050513 | nmdc:mga0rr50_19004_c1 | nmdc:mga0rr50_19004_c1_118_630 | 141 |
| 12 | 3300050515 | nmdc:mga0a205_16818_c1 | nmdc:mga0a205_16818_c1_1309_1821 | 141 |
| 13 | 3300005329 | Ga0070683_100020814 | Ga0070683_1000208147 | 148 |
| 14 | 3300013296 | Ga0157374_10047279 | Ga0157374_100472794 | 148 |
| 15 | 3300013308 | Ga0157375_12472354 | Ga0157375_124723542 | 148 |
| 16 | 3300026118 | Ga0207675_100589610 | Ga0207675_1005896101 | 150 |
| 17 | 3300049679 | Ga0501249_004712 | Ga0501249_004712_850_1335 | 150 |
| 18 | 3300049705 | Ga0501225_0080192 | Ga0501225_0080192_382_867 | 150 |
| 19 | 3300009098 | Ga0105245_11995562 | Ga0105245_119955621 | 152 |
| 20 | 3300026089 | Ga0207648_10093227 | Ga0207648_100932273 | 152 |
| 21 | 3300046459 | Ga0495629_0227805 | Ga0495629_0227805_764_1258 | 152 |
| 22 | 3300049569 | Ga0501032_0492573 | Ga0501032_0492573_14_481 | 152 |
| 23 | 3300049587 | Ga0501071_1107896 | Ga0501071_1107896_122_583 | 152 |
| 24 | 3300006846 | Ga0075430_100033279 | Ga0075430_1000332793 | 153 |
| 25 | 3300006847 | Ga0075431_100700663 | Ga0075431_1007006631 | 153 |
| 26 | 3300035725 | Ga0373947_0568487 | Ga0373947_0568487_248_760 | 153 |
| 27 | 3300006844 | Ga0075428_100165734 | Ga0075428_1001657343 | 154 |
| 28 | 3300006846 | Ga0075430_100317421 | Ga0075430_1003174212 | 154 |
| 29 | 3300009147 | Ga0114129_10019563 | Ga0114129_100195635 | 154 |
| 30 | 3300027364 | Ga0209967_1033901 | Ga0209967_10339012 | 154 |
| 31 | 3300050507 | nmdc:mga05p37_26749_c1 | nmdc:mga05p37_26749_c1_1022_1552 | 154 |
| 32 | 3300006846 | Ga0075430_100046284 | Ga0075430_1000462842 | 155 |
| 33 | 3300006847 | Ga0075431_100182982 | Ga0075431_1001829821 | 155 |
| 34 | 3300006852 | Ga0075433_10589679 | Ga0075433_105896792 | 155 |
| 35 | 3300006880 | Ga0075429_100013532 | Ga0075429_1000135328 | 155 |
| 36 | 3300009094 | Ga0111539_11293813 | Ga0111539_112938132 | 155 |
| 37 | 3300027907 | Ga0207428_10007180 | Ga0207428_100071802 | 155 |
| 38 | 3300028380 | Ga0268265_10281684 | Ga0268265_102816842 | 155 |
| 39 | 3300031548 | Ga0307408_101212501 | Ga0307408_1012125011 | 155 |
| 40 | 3300049578 | Ga0501042_0455038 | Ga0501042_0455038_415_915 | 155 |
| 41 | 3300050509 | nmdc:mga0qj67_196838_c1 | nmdc:mga0qj67_196838_c1_473_979 | 155 |
| 42 | 3300050510 | nmdc:mga06r32_1374241_c1 | nmdc:mga06r32_1374241_c1_124_630 | 155 |
| 43 | 3300050511 | nmdc:mga08y16_7050_c1 | nmdc:mga08y16_7050_c1_451_954 | 155 |
| 44 | 3300050515 | nmdc:mga0a205_550167_c1 | nmdc:mga0a205_550167_c1_357_929 | 155 |
| 45 | 3300005328 | Ga0070676_10103655 | Ga0070676_101036552 | 156 |
| 46 | 3300025900 | Ga0207710_10142543 | Ga0207710_101425432 | 156 |
| 47 | 3300050509 | nmdc:mga0qj67_272867_c1 | nmdc:mga0qj67_272867_c1_690_1211 | 156 |
| 48 | 3300009101 | Ga0105247_10019728 | Ga0105247_100197284 | 157 |
| 49 | 3300014968 | Ga0157379_10167390 | Ga0157379_101673902 | 157 |
| 50 | 3300025899 | Ga0207642_10003899 | Ga0207642_100038994 | 157 |
| 51 | 3300026035 | Ga0207703_10934015 | Ga0207703_109340152 | 157 |
| 52 | 3300032002 | Ga0307416_100195506 | Ga0307416_1001955061 | 157 |
| 53 | 3300049576 | Ga0501040_0278360 | Ga0501040_0278360_449_955 | 157 |
| 54 | 3300049824 | Ga0501045_0560585 | Ga0501045_0560585_236_772 | 157 |
| 55 | 3300050508 | nmdc:mga09592_23720_c1 | nmdc:mga09592_23720_c1_1347_1853 | 157 |
| 56 | 3300050509 | nmdc:mga0qj67_99176_c1 | nmdc:mga0qj67_99176_c1_1732_2238 | 157 |
| 57 | 3300050510 | nmdc:mga06r32_115284_c1 | nmdc:mga06r32_115284_c1_2052_2561 | 157 |
| 58 | 3300005355 | Ga0070671_100475622 | Ga0070671_1004756221 | 158 |
| 59 | 3300005842 | Ga0068858_100298383 | Ga0068858_1002983832 | 158 |
| 60 | 3300006844 | Ga0075428_100659159 | Ga0075428_1006591592 | 158 |
| 61 | 3300025936 | Ga0207670_10206116 | Ga0207670_102061163 | 158 |
| 62 | 3300036401 | Ga0373937_0222939 | Ga0373937_0222939_30_542 | 158 |
| 63 | 3300041512 | Ga0451853_2385990 | Ga0451853_2385990_598_1110 | 158 |
| 64 | 3300042436 | Ga0439435_0045205 | Ga0439435_0045205_218_724 | 158 |
| 65 | 3300048915 | Ga0496112_1072729 | Ga0496112_1072729_22_531 | 158 |
| 66 | 3300050509 | nmdc:mga0qj67_1929_c1 | nmdc:mga0qj67_1929_c1_3250_3729 | 158 |
| 67 | 3300050509 | nmdc:mga0qj67_529411_c1 | nmdc:mga0qj67_529411_c1_240_746 | 158 |
| 68 | 3300050510 | nmdc:mga06r32_1971_c2 | nmdc:mga06r32_1971_c2_1946_2425 | 158 |
| 69 | 3300050510 | nmdc:mga06r32_622581_c1 | nmdc:mga06r32_622581_c1_21_527 | 158 |
| 70 | 3300053084 | Ga0495595_0178438 | Ga0495595_0178438_27_539 | 158 |
| 71 | 3300005290 | Ga0065712_10112287 | Ga0065712_101122872 | 159 |
| 72 | 3300005330 | Ga0070690_100070728 | Ga0070690_1000707284 | 159 |
| 73 | 3300005334 | Ga0068869_100011901 | Ga0068869_1000119015 | 159 |
| 74 | 3300005335 | Ga0070666_10061623 | Ga0070666_100616233 | 159 |
| 75 | 3300005338 | Ga0068868_100135468 | Ga0068868_1001354682 | 159 |
| 76 | 3300005340 | Ga0070689_100051402 | Ga0070689_1000514022 | 159 |
| 77 | 3300005344 | Ga0070661_100078609 | Ga0070661_1000786092 | 159 |
| 78 | 3300005347 | Ga0070668_100070680 | Ga0070668_1000706804 | 159 |
| 79 | 3300005353 | Ga0070669_100038877 | Ga0070669_1000388773 | 159 |
| 80 | 3300005356 | Ga0070674_100005871 | Ga0070674_1000058714 | 159 |
| 81 | 3300005364 | Ga0070673_100182036 | Ga0070673_1001820361 | 159 |
| 82 | 3300005365 | Ga0070688_100002480 | Ga0070688_1000024806 | 159 |
| 83 | 3300005366 | Ga0070659_100167048 | Ga0070659_1001670482 | 159 |
| 84 | 3300005367 | Ga0070667_100180671 | Ga0070667_1001806712 | 159 |
| 85 | 3300005444 | Ga0070694_100080568 | Ga0070694_1000805683 | 159 |
| 86 | 3300005455 | Ga0070663_100184710 | Ga0070663_1001847102 | 159 |
| 87 | 3300005459 | Ga0068867_100184069 | Ga0068867_1001840692 | 159 |
| 88 | 3300005459 | Ga0068867_100869622 | Ga0068867_1008696221 | 159 |
| 89 | 3300005466 | Ga0070685_10080674 | Ga0070685_100806742 | 159 |
| 90 | 3300005544 | Ga0070686_100034606 | Ga0070686_1000346065 | 159 |
| 91 | 3300005548 | Ga0070665_100254009 | Ga0070665_1002540091 | 159 |
| 92 | 3300005564 | Ga0070664_100040531 | Ga0070664_1000405314 | 159 |
| 93 | 3300005617 | Ga0068859_100129807 | Ga0068859_1001298073 | 159 |
| 94 | 3300005840 | Ga0068870_10000249 | Ga0068870_1000024910 | 159 |
| 95 | 3300006846 | Ga0075430_100109062 | Ga0075430_1001090622 | 159 |
| 96 | 3300006847 | Ga0075431_100007236 | Ga0075431_1000072365 | 159 |
| 97 | 3300006852 | Ga0075433_10063472 | Ga0075433_100634722 | 159 |
| 98 | 3300006871 | Ga0075434_100198948 | Ga0075434_1001989483 | 159 |
| 99 | 3300006931 | Ga0097620_100129813 | Ga0097620_1001298132 | 159 |
| 100 | 3300014326 | Ga0157380_10012560 | Ga0157380_100125604 | 159 |
| 101 | 3300017792 | Ga0163161_10042416 | Ga0163161_100424162 | 159 |
| 102 | 3300025315 | Ga0207697_10020719 | Ga0207697_100207193 | 159 |
| 103 | 3300025893 | Ga0207682_10004445 | Ga0207682_100044452 | 159 |
| 104 | 3300025901 | Ga0207688_10245469 | Ga0207688_102454692 | 159 |
| 105 | 3300025903 | Ga0207680_10019297 | Ga0207680_100192973 | 159 |
| 106 | 3300025907 | Ga0207645_10084768 | Ga0207645_100847683 | 159 |
| 107 | 3300025908 | Ga0207643_10091464 | Ga0207643_100914644 | 159 |
| 108 | 3300025918 | Ga0207662_10047524 | Ga0207662_100475243 | 159 |
| 109 | 3300025920 | Ga0207649_10076890 | Ga0207649_100768902 | 159 |
| 110 | 3300025923 | Ga0207681_10186071 | Ga0207681_101860711 | 159 |
| 111 | 3300025932 | Ga0207690_10115505 | Ga0207690_101155052 | 159 |
| 112 | 3300025933 | Ga0207706_10088339 | Ga0207706_100883394 | 159 |
| 113 | 3300025936 | Ga0207670_10158599 | Ga0207670_101585992 | 159 |
| 114 | 3300025937 | Ga0207669_10003643 | Ga0207669_100036435 | 159 |
| 115 | 3300025940 | Ga0207691_10112553 | Ga0207691_101125532 | 159 |
| 116 | 3300025942 | Ga0207689_10004330 | Ga0207689_100043308 | 159 |
| 117 | 3300025945 | Ga0207679_10004309 | Ga0207679_100043094 | 159 |
| 118 | 3300025961 | Ga0207712_10170279 | Ga0207712_101702791 | 159 |
| 119 | 3300025972 | Ga0207668_10035146 | Ga0207668_100351464 | 159 |
| 120 | 3300025986 | Ga0207658_10040198 | Ga0207658_100401987 | 159 |
| 121 | 3300026023 | Ga0207677_10060546 | Ga0207677_100605464 | 159 |
| 122 | 3300026035 | Ga0207703_10218371 | Ga0207703_102183712 | 159 |
| 123 | 3300026067 | Ga0207678_10172884 | Ga0207678_101728844 | 159 |
| 124 | 3300026088 | Ga0207641_10048112 | Ga0207641_100481121 | 159 |
| 125 | 3300026089 | Ga0207648_10084034 | Ga0207648_100840343 | 159 |
| 126 | 3300026116 | Ga0207674_10336889 | Ga0207674_103368891 | 159 |
| 127 | 3300027682 | Ga0209971_1142949 | Ga0209971_11429491 | 159 |
| 128 | 3300027907 | Ga0207428_10003132 | Ga0207428_100031324 | 159 |
| 129 | 3300028380 | Ga0268265_10094017 | Ga0268265_100940174 | 159 |
| 130 | 3300028381 | Ga0268264_10305485 | Ga0268264_103054851 | 159 |
| 131 | 3300041408 | Ga0439453_0000854 | Ga0439453_0000854_1027_1509 | 159 |
| 132 | 3300049129 | Ga0501309_025150 | Ga0501309_025150_140_658 | 159 |
| 133 | 3300050509 | nmdc:mga0qj67_98047_c1 | nmdc:mga0qj67_98047_c1_789_1334 | 159 |
| 134 | 3300050510 | nmdc:mga06r32_334279_c1 | nmdc:mga06r32_334279_c1_306_851 | 159 |
| 135 | 3300005330 | Ga0070690_100100435 | Ga0070690_1001004353 | 160 |
| 136 | 3300005364 | Ga0070673_100125429 | Ga0070673_1001254291 | 160 |
| 137 | 3300005367 | Ga0070667_100583883 | Ga0070667_1005838832 | 160 |
| 138 | 3300005456 | Ga0070678_100395795 | Ga0070678_1003957953 | 160 |
| 139 | 3300009094 | Ga0111539_10019888 | Ga0111539_100198886 | 160 |
| 140 | 3300009147 | Ga0114129_10261922 | Ga0114129_102619222 | 160 |
| 141 | 3300026035 | Ga0207703_10503021 | Ga0207703_105030212 | 160 |
| 142 | 3300046615 | Ga0495656_0169954 | Ga0495656_0169954_22_507 | 160 |
| 143 | 3300050507 | nmdc:mga05p37_106831_c1 | nmdc:mga05p37_106831_c1_68_553 | 160 |
| 144 | 3300050509 | nmdc:mga0qj67_633138_c1 | nmdc:mga0qj67_633138_c1_271_756 | 160 |
| 145 | 3300050511 | nmdc:mga08y16_127440_c1 | nmdc:mga08y16_127440_c1_594_1079 | 160 |
| 146 | 3300005354 | Ga0070675_100717048 | Ga0070675_1007170481 | 161 |
| 147 | 3300005615 | Ga0070702_100213936 | Ga0070702_1002139361 | 161 |
| 148 | 3300005841 | Ga0068863_100050412 | Ga0068863_1000504124 | 161 |
| 149 | 3300005842 | Ga0068858_100023389 | Ga0068858_1000233892 | 161 |
| 150 | 3300006880 | Ga0075429_100103729 | Ga0075429_1001037291 | 161 |
| 151 | 3300009094 | Ga0111539_10076600 | Ga0111539_100766004 | 161 |
| 152 | 3300009176 | Ga0105242_10003977 | Ga0105242_100039772 | 161 |
| 153 | 3300009177 | Ga0105248_10415461 | Ga0105248_104154612 | 161 |
| 154 | 3300009553 | Ga0105249_10103716 | Ga0105249_101037163 | 161 |
| 155 | 3300011119 | Ga0105246_10460497 | Ga0105246_104604972 | 161 |
| 156 | 3300012485 | Ga0157325_1001121 | Ga0157325_10011212 | 161 |
| 157 | 3300013306 | Ga0163162_10036676 | Ga0163162_100366762 | 161 |
| 158 | 3300013306 | Ga0163162_12022121 | Ga0163162_120221211 | 161 |
| 159 | 3300014326 | Ga0157380_10179800 | Ga0157380_101798003 | 161 |
| 160 | 3300014326 | Ga0157380_10224100 | Ga0157380_102241002 | 161 |
| 161 | 3300014745 | Ga0157377_10057497 | Ga0157377_100574972 | 161 |
| 162 | 3300014969 | Ga0157376_10492502 | Ga0157376_104925022 | 161 |
| 163 | 3300025926 | Ga0207659_10018444 | Ga0207659_100184445 | 161 |
| 164 | 3300028379 | Ga0268266_11228805 | Ga0268266_112288052 | 161 |
| 165 | 3300035112 | Ga0373932_0008500 | Ga0373932_0008500_526_1047 | 161 |
| 166 | 3300035242 | Ga0373962_0181723 | Ga0373962_0181723_86_607 | 161 |
| 167 | 3300042533 | Ga0450901_015139 | Ga0450901_015139_29_574 | 161 |
| 168 | 3300042993 | Ga0439440_0047066 | Ga0439440_0047066_269_814 | 161 |
| 169 | 3300045051 | Ga0451576_0161262 | Ga0451576_0161262_1807_2328 | 161 |
| 170 | 3300050508 | nmdc:mga09592_498579_c1 | nmdc:mga09592_498579_c1_385_915 | 161 |
| 171 | 3300050508 | nmdc:mga09592_65965_c1 | nmdc:mga09592_65965_c1_918_1439 | 161 |
| 172 | 3300050511 | nmdc:mga08y16_38144_c1 | nmdc:mga08y16_38144_c1_929_1450 | 161 |
| 173 | 3300050512 | nmdc:mga0n895_168822_c1 | nmdc:mga0n895_168822_c1_1160_1681 | 161 |
| 174 | 3300050515 | nmdc:mga0a205_2367_c1 | nmdc:mga0a205_2367_c1_1168_1689 | 161 |
| 175 | 3300005334 | Ga0068869_100101367 | Ga0068869_1001013673 | 162 |
| 176 | 3300005354 | Ga0070675_100079298 | Ga0070675_1000792981 | 162 |
| 177 | 3300005543 | Ga0070672_100047993 | Ga0070672_1000479932 | 162 |
| 178 | 3300005719 | Ga0068861_100909754 | Ga0068861_1009097542 | 162 |
| 179 | 3300005840 | Ga0068870_10005245 | Ga0068870_100052452 | 162 |
| 180 | 3300005843 | Ga0068860_101234585 | Ga0068860_1012345852 | 162 |
| 181 | 3300009177 | Ga0105248_10700682 | Ga0105248_107006821 | 162 |
| 182 | 3300025908 | Ga0207643_10015662 | Ga0207643_100156623 | 162 |
| 183 | 3300025926 | Ga0207659_10080639 | Ga0207659_100806392 | 162 |
| 184 | 3300025941 | Ga0207711_10510725 | Ga0207711_105107252 | 162 |
| 185 | 3300026118 | Ga0207675_101767133 | Ga0207675_1017671331 | 162 |
| 186 | 3300050508 | nmdc:mga09592_535017_c1 | nmdc:mga09592_535017_c1_357_851 | 162 |
| 187 | 3300025918 | Ga0207662_10254521 | Ga0207662_102545212 | 163 |
| 188 | 3300046514 | Ga0495618_0469160 | Ga0495618_0469160_174_677 | 163 |
| 189 | 3300048917 | Ga0496114_0211714 | Ga0496114_0211714_1043_1537 | 163 |
| 190 | 3300005334 | Ga0068869_100147857 | Ga0068869_1001478573 | 164 |
| 191 | 3300005444 | Ga0070694_100275093 | Ga0070694_1002750932 | 164 |
| 192 | 3300005841 | Ga0068863_100708525 | Ga0068863_1007085252 | 164 |
| 193 | 3300006175 | Ga0070712_100065995 | Ga0070712_1000659953 | 164 |
| 194 | 3300006237 | Ga0097621_100114746 | Ga0097621_1001147464 | 164 |
| 195 | 3300006358 | Ga0068871_100009325 | Ga0068871_1000093256 | 164 |
| 196 | 3300006844 | Ga0075428_100461214 | Ga0075428_1004612142 | 164 |
| 197 | 3300009094 | Ga0111539_10004119 | Ga0111539_100041193 | 164 |
| 198 | 3300009098 | Ga0105245_10089924 | Ga0105245_100899244 | 164 |
| 199 | 3300009176 | Ga0105242_10261111 | Ga0105242_102611113 | 164 |
| 200 | 3300014326 | Ga0157380_10304910 | Ga0157380_103049102 | 164 |
| 201 | 3300014969 | Ga0157376_10178881 | Ga0157376_101788812 | 164 |
| 202 | 3300025905 | Ga0207685_10099623 | Ga0207685_100996231 | 164 |
| 203 | 3300025915 | Ga0207693_10077455 | Ga0207693_100774552 | 164 |
| 204 | 3300025923 | Ga0207681_10215323 | Ga0207681_102153232 | 164 |
| 205 | 3300025934 | Ga0207686_10087750 | Ga0207686_100877502 | 164 |
| 206 | 3300025938 | Ga0207704_10543792 | Ga0207704_105437921 | 164 |
| 207 | 3300025942 | Ga0207689_10231942 | Ga0207689_102319421 | 164 |
| 208 | 3300027876 | Ga0209974_10096461 | Ga0209974_100964612 | 164 |
| 209 | 3300031548 | Ga0307408_100571971 | Ga0307408_1005719712 | 164 |
| 210 | 3300045051 | Ga0451576_0374127 | Ga0451576_0374127_95_598 | 164 |
| 211 | 3300048903 | Ga0496100_0001360 | Ga0496100_0001360_3145_3663 | 164 |
| 212 | 3300048904 | Ga0496101_0000846 | Ga0496101_0000846_2664_3182 | 164 |
| 213 | 3300048905 | Ga0496102_0187575 | Ga0496102_0187575_1367_1885 | 164 |
| 214 | 3300048907 | Ga0496104_0015664 | Ga0496104_0015664_3860_4378 | 164 |
| 215 | 3300048910 | Ga0496107_0123883 | Ga0496107_0123883_779_1297 | 164 |
| 216 | 3300048917 | Ga0496114_0001483 | Ga0496114_0001483_15611_16129 | 164 |
| 217 | 3300049824 | Ga0501045_0565055 | Ga0501045_0565055_31_531 | 164 |
| 218 | 3300050511 | nmdc:mga08y16_22537_c1 | nmdc:mga08y16_22537_c1_3266_3766 | 164 |
| 219 | 3300005331 | Ga0070670_100017026 | Ga0070670_1000170266 | 165 |
| 220 | 3300005354 | Ga0070675_100672591 | Ga0070675_1006725912 | 165 |
| 221 | 3300005457 | Ga0070662_100041220 | Ga0070662_1000412202 | 165 |
| 222 | 3300005564 | Ga0070664_100125371 | Ga0070664_1001253712 | 165 |
| 223 | 3300005618 | Ga0068864_100219225 | Ga0068864_1002192252 | 165 |
| 224 | 3300014325 | Ga0163163_10084383 | Ga0163163_100843832 | 165 |
| 225 | 3300025920 | Ga0207649_10867919 | Ga0207649_108679191 | 165 |
| 226 | 3300025925 | Ga0207650_10013568 | Ga0207650_100135685 | 165 |
| 227 | 3300025926 | Ga0207659_10731991 | Ga0207659_107319911 | 165 |
| 228 | 3300025935 | Ga0207709_10116381 | Ga0207709_101163812 | 165 |
| 229 | 3300025945 | Ga0207679_10235028 | Ga0207679_102350282 | 165 |
| 230 | 3300025972 | Ga0207668_10101498 | Ga0207668_101014983 | 165 |
| 231 | 3300026089 | Ga0207648_10283806 | Ga0207648_102838062 | 165 |
| 232 | 3300026095 | Ga0207676_10346171 | Ga0207676_103461712 | 165 |
| 233 | 3300028381 | Ga0268264_10539757 | Ga0268264_105397572 | 165 |
| 234 | 3300035120 | Ga0373957_0076732 | Ga0373957_0076732_121_630 | 165 |
| 235 | 3300049591 | Ga0501075_0335127 | Ga0501075_0335127_537_1076 | 165 |
| 236 | 3300005328 | Ga0070676_10025553 | Ga0070676_100255533 | 166 |
| 237 | 3300005329 | Ga0070683_100274055 | Ga0070683_1002740552 | 166 |
| 238 | 3300005330 | Ga0070690_100016542 | Ga0070690_1000165422 | 166 |
| 239 | 3300005331 | Ga0070670_100360632 | Ga0070670_1003606322 | 166 |
| 240 | 3300005333 | Ga0070677_10008361 | Ga0070677_100083612 | 166 |
| 241 | 3300005334 | Ga0068869_100002654 | Ga0068869_1000026549 | 166 |
| 242 | 3300005336 | Ga0070680_100613725 | Ga0070680_1006137252 | 166 |
| 243 | 3300005337 | Ga0070682_100085165 | Ga0070682_1000851652 | 166 |
| 244 | 3300005338 | Ga0068868_100422332 | Ga0068868_1004223322 | 166 |
| 245 | 3300005353 | Ga0070669_100127525 | Ga0070669_1001275252 | 166 |
| 246 | 3300005354 | Ga0070675_100040295 | Ga0070675_1000402954 | 166 |
| 247 | 3300005354 | Ga0070675_100050279 | Ga0070675_1000502793 | 166 |
| 248 | 3300005355 | Ga0070671_100088163 | Ga0070671_1000881632 | 166 |
| 249 | 3300005356 | Ga0070674_100056705 | Ga0070674_1000567052 | 166 |
| 250 | 3300005356 | Ga0070674_100058122 | Ga0070674_1000581222 | 166 |
| 251 | 3300005356 | Ga0070674_100242211 | Ga0070674_1002422112 | 166 |
| 252 | 3300005364 | Ga0070673_100154972 | Ga0070673_1001549722 | 166 |
| 253 | 3300005364 | Ga0070673_100204499 | Ga0070673_1002044992 | 166 |
| 254 | 3300005364 | Ga0070673_100377444 | Ga0070673_1003774442 | 166 |
| 255 | 3300005367 | Ga0070667_100400287 | Ga0070667_1004002872 | 166 |
| 256 | 3300005438 | Ga0070701_10049972 | Ga0070701_100499722 | 166 |
| 257 | 3300005441 | Ga0070700_100005699 | Ga0070700_1000056992 | 166 |
| 258 | 3300005456 | Ga0070678_100452672 | Ga0070678_1004526722 | 166 |
| 259 | 3300005456 | Ga0070678_101436306 | Ga0070678_1014363061 | 166 |
| 260 | 3300005459 | Ga0068867_100011607 | Ga0068867_1000116073 | 166 |
| 261 | 3300005535 | Ga0070684_100223479 | Ga0070684_1002234792 | 166 |
| 262 | 3300005543 | Ga0070672_100513638 | Ga0070672_1005136381 | 166 |
| 263 | 3300005544 | Ga0070686_100029149 | Ga0070686_1000291492 | 166 |
| 264 | 3300005544 | Ga0070686_100037356 | Ga0070686_1000373563 | 166 |
| 265 | 3300005564 | Ga0070664_100353655 | Ga0070664_1003536552 | 166 |
| 266 | 3300005578 | Ga0068854_100070505 | Ga0068854_1000705052 | 166 |
| 267 | 3300005617 | Ga0068859_100270316 | Ga0068859_1002703162 | 166 |
| 268 | 3300005719 | Ga0068861_100033380 | Ga0068861_1000333803 | 166 |
| 269 | 3300005842 | Ga0068858_100280117 | Ga0068858_1002801172 | 166 |
| 270 | 3300005843 | Ga0068860_100432741 | Ga0068860_1004327412 | 166 |
| 271 | 3300005843 | Ga0068860_100684724 | Ga0068860_1006847242 | 166 |
| 272 | 3300006237 | Ga0097621_100116794 | Ga0097621_1001167942 | 166 |
| 273 | 3300006358 | Ga0068871_100089891 | Ga0068871_1000898912 | 166 |
| 274 | 3300006358 | Ga0068871_100211492 | Ga0068871_1002114922 | 166 |
| 275 | 3300006846 | Ga0075430_100149126 | Ga0075430_1001491261 | 166 |
| 276 | 3300006881 | Ga0068865_100024156 | Ga0068865_1000241566 | 166 |
| 277 | 3300006931 | Ga0097620_100270331 | Ga0097620_1002703312 | 166 |
| 278 | 3300006931 | Ga0097620_100319830 | Ga0097620_1003198302 | 166 |
| 279 | 3300009094 | Ga0111539_11081049 | Ga0111539_110810492 | 166 |
| 280 | 3300009101 | Ga0105247_10131311 | Ga0105247_101313112 | 166 |
| 281 | 3300009148 | Ga0105243_10877193 | Ga0105243_108771932 | 166 |
| 282 | 3300009148 | Ga0105243_11115303 | Ga0105243_111153032 | 166 |
| 283 | 3300009177 | Ga0105248_10284303 | Ga0105248_102843032 | 166 |
| 284 | 3300009553 | Ga0105249_10539476 | Ga0105249_105394763 | 166 |
| 285 | 3300011119 | Ga0105246_11044526 | Ga0105246_110445261 | 166 |
| 286 | 3300014326 | Ga0157380_10056754 | Ga0157380_100567544 | 166 |
| 287 | 3300014745 | Ga0157377_10014587 | Ga0157377_100145872 | 166 |
| 288 | 3300025893 | Ga0207682_10010733 | Ga0207682_100107332 | 166 |
| 289 | 3300025903 | Ga0207680_10527041 | Ga0207680_105270412 | 166 |
| 290 | 3300025907 | Ga0207645_10005120 | Ga0207645_100051203 | 166 |
| 291 | 3300025908 | Ga0207643_10335672 | Ga0207643_103356721 | 166 |
| 292 | 3300025912 | Ga0207707_10454562 | Ga0207707_104545622 | 166 |
| 293 | 3300025918 | Ga0207662_10093548 | Ga0207662_100935482 | 166 |
| 294 | 3300025923 | Ga0207681_10024808 | Ga0207681_100248082 | 166 |
| 295 | 3300025923 | Ga0207681_10778878 | Ga0207681_107788781 | 166 |
| 296 | 3300025926 | Ga0207659_10063706 | Ga0207659_100637062 | 166 |
| 297 | 3300025926 | Ga0207659_10188994 | Ga0207659_101889942 | 166 |
| 298 | 3300025926 | Ga0207659_10305560 | Ga0207659_103055602 | 166 |
| 299 | 3300025931 | Ga0207644_10004157 | Ga0207644_100041575 | 166 |
| 300 | 3300025934 | Ga0207686_10046729 | Ga0207686_100467292 | 166 |
| 301 | 3300025935 | Ga0207709_10413188 | Ga0207709_104131882 | 166 |
| 302 | 3300025936 | Ga0207670_10737854 | Ga0207670_107378542 | 166 |
| 303 | 3300025937 | Ga0207669_10108875 | Ga0207669_101088752 | 166 |
| 304 | 3300025937 | Ga0207669_10253429 | Ga0207669_102534291 | 166 |
| 305 | 3300025940 | Ga0207691_10086995 | Ga0207691_100869954 | 166 |
| 306 | 3300025941 | Ga0207711_10163033 | Ga0207711_101630332 | 166 |
| 307 | 3300025942 | Ga0207689_10016858 | Ga0207689_100168585 | 166 |
| 308 | 3300025960 | Ga0207651_10026016 | Ga0207651_100260164 | 166 |
| 309 | 3300025960 | Ga0207651_10264174 | Ga0207651_102641742 | 166 |
| 310 | 3300025972 | Ga0207668_10595863 | Ga0207668_105958632 | 166 |
| 311 | 3300025986 | Ga0207658_10985333 | Ga0207658_109853332 | 166 |
| 312 | 3300025986 | Ga0207658_11356407 | Ga0207658_113564072 | 166 |
| 313 | 3300026035 | Ga0207703_10095736 | Ga0207703_100957362 | 166 |
| 314 | 3300026075 | Ga0207708_10003780 | Ga0207708_100037805 | 166 |
| 315 | 3300026088 | Ga0207641_10400358 | Ga0207641_104003582 | 166 |
| 316 | 3300026089 | Ga0207648_10004440 | Ga0207648_1000444010 | 166 |
| 317 | 3300026089 | Ga0207648_10538969 | Ga0207648_105389692 | 166 |
| 318 | 3300026095 | Ga0207676_10290312 | Ga0207676_102903122 | 166 |
| 319 | 3300026116 | Ga0207674_10647704 | Ga0207674_106477042 | 166 |
| 320 | 3300026118 | Ga0207675_100028731 | Ga0207675_1000287312 | 166 |
| 321 | 3300026118 | Ga0207675_100340353 | Ga0207675_1003403532 | 166 |
| 322 | 3300026121 | Ga0207683_10061989 | Ga0207683_100619891 | 166 |
| 323 | 3300026121 | Ga0207683_10873474 | Ga0207683_108734742 | 166 |
| 324 | 3300027907 | Ga0207428_10266016 | Ga0207428_102660162 | 166 |
| 325 | 3300028380 | Ga0268265_10861288 | Ga0268265_108612882 | 166 |
| 326 | 3300028381 | Ga0268264_10722997 | Ga0268264_107229972 | 166 |
| 327 | 3300028381 | Ga0268264_11041616 | Ga0268264_110416162 | 166 |
| 328 | 3300032002 | Ga0307416_102321715 | Ga0307416_1023217151 | 166 |
| 329 | 3300037068 | Ga0373925_0407438 | Ga0373925_0407438_474_980 | 166 |
| 330 | 3300048912 | Ga0496109_0506834 | Ga0496109_0506834_309_815 | 166 |
| 331 | 3300049568 | Ga0501031_0280537 | Ga0501031_0280537_144_647 | 166 |
| 332 | 3300049572 | Ga0501036_0025356 | Ga0501036_0025356_3359_3862 | 166 |
| 333 | 3300049575 | Ga0501039_0051689 | Ga0501039_0051689_2300_2803 | 166 |
| 334 | 3300049577 | Ga0501041_0113650 | Ga0501041_0113650_239_742 | 166 |
| 335 | 3300049578 | Ga0501042_0096911 | Ga0501042_0096911_50_553 | 166 |
| 336 | 3300049580 | Ga0501046_0086970 | Ga0501046_0086970_1351_1854 | 166 |
| 337 | 3300049588 | Ga0501072_0378358 | Ga0501072_0378358_370_873 | 166 |
| 338 | 3300049590 | Ga0501074_0052846 | Ga0501074_0052846_2353_2856 | 166 |
| 339 | 3300049591 | Ga0501075_0002170 | Ga0501075_0002170_8432_8935 | 166 |
| 340 | 3300049741 | Ga0501079_0023872 | Ga0501079_0023872_286_789 | 166 |
| 341 | 3300049743 | Ga0501081_0033307 | Ga0501081_0033307_2201_2704 | 166 |
| 342 | 3300050511 | nmdc:mga08y16_559956_c1 | nmdc:mga08y16_559956_c1_336_839 | 166 |
| 343 | 3300050511 | nmdc:mga08y16_79613_c1 | nmdc:mga08y16_79613_c1_884_1417 | 166 |
| 344 | 3300054114 | Ga0501084_0730626 | Ga0501084_0730626_288_791 | 166 |
| 345 | 3300061734 | Ga0530510_0158022 | Ga0530510_0158022_379_882 | 166 |
| 346 | 3300061734 | Ga0530510_0890975 | Ga0530510_0890975_158_661 | 166 |
| 347 | 3300003693 | Ga0032354_1160538 | Ga0032354_11605381 | 167 |
| 348 | 3300005290 | Ga0065712_10362784 | Ga0065712_103627841 | 167 |
| 349 | 3300005293 | Ga0065715_10409456 | Ga0065715_104094561 | 167 |
| 350 | 3300005327 | Ga0070658_10228520 | Ga0070658_102285202 | 167 |
| 351 | 3300005331 | Ga0070670_100444154 | Ga0070670_1004441542 | 167 |
| 352 | 3300005334 | Ga0068869_100400613 | Ga0068869_1004006132 | 167 |
| 353 | 3300005340 | Ga0070689_100080201 | Ga0070689_1000802013 | 167 |
| 354 | 3300005343 | Ga0070687_100243311 | Ga0070687_1002433113 | 167 |
| 355 | 3300005354 | Ga0070675_100148550 | Ga0070675_1001485502 | 167 |
| 356 | 3300005354 | Ga0070675_100402861 | Ga0070675_1004028612 | 167 |
| 357 | 3300005356 | Ga0070674_100078479 | Ga0070674_1000784792 | 167 |
| 358 | 3300005356 | Ga0070674_100085491 | Ga0070674_1000854913 | 167 |
| 359 | 3300005367 | Ga0070667_100598209 | Ga0070667_1005982092 | 167 |
| 360 | 3300005434 | Ga0070709_10003100 | Ga0070709_100031009 | 167 |
| 361 | 3300005458 | Ga0070681_11293904 | Ga0070681_112939041 | 167 |
| 362 | 3300005459 | Ga0068867_100250255 | Ga0068867_1002502552 | 167 |
| 363 | 3300005530 | Ga0070679_100551059 | Ga0070679_1005510592 | 167 |
| 364 | 3300005543 | Ga0070672_100120818 | Ga0070672_1001208182 | 167 |
| 365 | 3300005564 | Ga0070664_100866762 | Ga0070664_1008667622 | 167 |
| 366 | 3300005618 | Ga0068864_100989502 | Ga0068864_1009895022 | 167 |
| 367 | 3300005844 | Ga0068862_101058705 | Ga0068862_1010587052 | 167 |
| 368 | 3300005985 | Ga0081539_10159941 | Ga0081539_101599412 | 167 |
| 369 | 3300006237 | Ga0097621_100096387 | Ga0097621_1000963872 | 167 |
| 370 | 3300006237 | Ga0097621_100652024 | Ga0097621_1006520241 | 167 |
| 371 | 3300006844 | Ga0075428_100006280 | Ga0075428_10000628013 | 167 |
| 372 | 3300006871 | Ga0075434_100262828 | Ga0075434_1002628283 | 167 |
| 373 | 3300009147 | Ga0114129_11524196 | Ga0114129_115241962 | 167 |
| 374 | 3300009553 | Ga0105249_10318556 | Ga0105249_103185562 | 167 |
| 375 | 3300009553 | Ga0105249_10388544 | Ga0105249_103885442 | 167 |
| 376 | 3300013104 | Ga0157370_10506971 | Ga0157370_105069711 | 167 |
| 377 | 3300013296 | Ga0157374_10142197 | Ga0157374_101421972 | 167 |
| 378 | 3300013308 | Ga0157375_10838355 | Ga0157375_108383552 | 167 |
| 379 | 3300014969 | Ga0157376_10321442 | Ga0157376_103214423 | 167 |
| 380 | 3300025906 | Ga0207699_10015884 | Ga0207699_100158844 | 167 |
| 381 | 3300025923 | Ga0207681_10039323 | Ga0207681_100393233 | 167 |
| 382 | 3300025923 | Ga0207681_10987669 | Ga0207681_109876691 | 167 |
| 383 | 3300025926 | Ga0207659_10006225 | Ga0207659_100062251 | 167 |
| 384 | 3300025933 | Ga0207706_10911017 | Ga0207706_109110171 | 167 |
| 385 | 3300025936 | Ga0207670_10378750 | Ga0207670_103787501 | 167 |
| 386 | 3300025940 | Ga0207691_10154117 | Ga0207691_101541172 | 167 |
| 387 | 3300025940 | Ga0207691_10329726 | Ga0207691_103297263 | 167 |
| 388 | 3300025942 | Ga0207689_10360359 | Ga0207689_103603592 | 167 |
| 389 | 3300025945 | Ga0207679_10481815 | Ga0207679_104818152 | 167 |
| 390 | 3300025960 | Ga0207651_10420207 | Ga0207651_104202071 | 167 |
| 391 | 3300025981 | Ga0207640_11048437 | Ga0207640_110484371 | 167 |
| 392 | 3300028379 | Ga0268266_11943180 | Ga0268266_119431801 | 167 |
| 393 | 3300028380 | Ga0268265_10331123 | Ga0268265_103311232 | 167 |
| 394 | 3300028380 | Ga0268265_11432363 | Ga0268265_114323632 | 167 |
| 395 | 3300031911 | Ga0307412_10244115 | Ga0307412_102441152 | 167 |
| 396 | 3300032004 | Ga0307414_10098941 | Ga0307414_100989412 | 167 |
| 397 | 3300035086 | Ga0373934_0338459 | Ga0373934_0338459_64_570 | 167 |
| 398 | 3300035089 | Ga0373944_0119666 | Ga0373944_0119666_336_842 | 167 |
| 399 | 3300035111 | Ga0373923_0071212 | Ga0373923_0071212_446_952 | 167 |
| 400 | 3300035113 | Ga0373936_0195869 | Ga0373936_0195869_338_844 | 167 |
| 401 | 3300035119 | Ga0373956_0159430 | Ga0373956_0159430_151_657 | 167 |
| 402 | 3300035171 | Ga0373946_0122461 | Ga0373946_0122461_228_734 | 167 |
| 403 | 3300035410 | Ga0373924_0010264 | Ga0373924_0010264_2601_3107 | 167 |
| 404 | 3300035692 | Ga0373935_0077317 | Ga0373935_0077317_1320_1826 | 167 |
| 405 | 3300035695 | Ga0373927_0046317 | Ga0373927_0046317_35_541 | 167 |
| 406 | 3300035724 | Ga0373933_0034019 | Ga0373933_0034019_2055_2561 | 167 |
| 407 | 3300035725 | Ga0373947_0528679 | Ga0373947_0528679_32_538 | 167 |
| 408 | 3300037068 | Ga0373925_0160875 | Ga0373925_0160875_64_570 | 167 |
| 409 | 3300042008 | Ga0439450_000889 | Ga0439450_000889_859_1365 | 167 |
| 410 | 3300046663 | Ga0495635_0615813 | Ga0495635_0615813_37_543 | 167 |
| 411 | 3300049742 | Ga0501080_0356052 | Ga0501080_0356052_25_531 | 167 |
| 412 | 3300050513 | nmdc:mga0rr50_360128_c1 | nmdc:mga0rr50_360128_c1_667_1179 | 167 |
| 413 | 3300005293 | Ga0065715_10637425 | Ga0065715_106374251 | 168 |
| 414 | 3300005295 | Ga0065707_10347754 | Ga0065707_103477542 | 168 |
| 415 | 3300005331 | Ga0070670_100117322 | Ga0070670_1001173223 | 168 |
| 416 | 3300005343 | Ga0070687_100159786 | Ga0070687_1001597862 | 168 |
| 417 | 3300005344 | Ga0070661_100039282 | Ga0070661_1000392827 | 168 |
| 418 | 3300005353 | Ga0070669_100074475 | Ga0070669_1000744753 | 168 |
| 419 | 3300005354 | Ga0070675_100597646 | Ga0070675_1005976463 | 168 |
| 420 | 3300005356 | Ga0070674_100870565 | Ga0070674_1008705652 | 168 |
| 421 | 3300005364 | Ga0070673_100072044 | Ga0070673_1000720447 | 168 |
| 422 | 3300005365 | Ga0070688_100059811 | Ga0070688_1000598112 | 168 |
| 423 | 3300005437 | Ga0070710_10654775 | Ga0070710_106547751 | 168 |
| 424 | 3300005471 | Ga0070698_101257434 | Ga0070698_1012574341 | 168 |
| 425 | 3300005543 | Ga0070672_100040491 | Ga0070672_1000404914 | 168 |
| 426 | 3300005577 | Ga0068857_100153666 | Ga0068857_1001536666 | 168 |
| 427 | 3300005840 | Ga0068870_10280160 | Ga0068870_102801602 | 168 |
| 428 | 3300005841 | Ga0068863_100690952 | Ga0068863_1006909521 | 168 |
| 429 | 3300005842 | Ga0068858_100319433 | Ga0068858_1003194332 | 168 |
| 430 | 3300006358 | Ga0068871_100023640 | Ga0068871_1000236401 | 168 |
| 431 | 3300006846 | Ga0075430_100407542 | Ga0075430_1004075422 | 168 |
| 432 | 3300006880 | Ga0075429_100108355 | Ga0075429_1001083552 | 168 |
| 433 | 3300009094 | Ga0111539_10619580 | Ga0111539_106195802 | 168 |
| 434 | 3300011119 | Ga0105246_10514072 | Ga0105246_105140721 | 168 |
| 435 | 3300013297 | Ga0157378_10015960 | Ga0157378_100159603 | 168 |
| 436 | 3300013306 | Ga0163162_11277892 | Ga0163162_112778921 | 168 |
| 437 | 3300014325 | Ga0163163_10007402 | Ga0163163_1000740212 | 168 |
| 438 | 3300014326 | Ga0157380_10633440 | Ga0157380_106334402 | 168 |
| 439 | 3300025908 | Ga0207643_10328224 | Ga0207643_103282242 | 168 |
| 440 | 3300025918 | Ga0207662_10164625 | Ga0207662_101646251 | 168 |
| 441 | 3300025920 | Ga0207649_10141043 | Ga0207649_101410432 | 168 |
| 442 | 3300025923 | Ga0207681_10598263 | Ga0207681_105982632 | 168 |
| 443 | 3300025925 | Ga0207650_10008303 | Ga0207650_100083033 | 168 |
| 444 | 3300025931 | Ga0207644_11406544 | Ga0207644_114065441 | 168 |
| 445 | 3300025933 | Ga0207706_10367007 | Ga0207706_103670072 | 168 |
| 446 | 3300025936 | Ga0207670_10268042 | Ga0207670_102680423 | 168 |
| 447 | 3300025937 | Ga0207669_10324175 | Ga0207669_103241752 | 168 |
| 448 | 3300025940 | Ga0207691_10129135 | Ga0207691_101291352 | 168 |
| 449 | 3300025960 | Ga0207651_10013216 | Ga0207651_100132166 | 168 |
| 450 | 3300026095 | Ga0207676_10137579 | Ga0207676_101375792 | 168 |
| 451 | 3300026121 | Ga0207683_10344671 | Ga0207683_103446712 | 168 |
| 452 | 3300028380 | Ga0268265_11530201 | Ga0268265_115302011 | 168 |
| 453 | 3300039437 | Ga0436365_1567992 | Ga0436365_1567992_505_1026 | 168 |
| 454 | 3300049576 | Ga0501040_0543941 | Ga0501040_0543941_35_583 | 168 |
| 455 | 3300049592 | Ga0501076_0194456 | Ga0501076_0194456_317_823 | 168 |
| 456 | 3300049592 | Ga0501076_0319875 | Ga0501076_0319875_585_1097 | 168 |
| 457 | 3300049744 | Ga0501083_0922848 | Ga0501083_0922848_21_527 | 168 |
| 458 | 3300050509 | nmdc:mga0qj67_391437_c1 | nmdc:mga0qj67_391437_c1_322_828 | 168 |
| 459 | 3300050510 | nmdc:mga06r32_706084_c1 | nmdc:mga06r32_706084_c1_187_693 | 168 |
| 460 | 3300050511 | nmdc:mga08y16_501584_c1 | nmdc:mga08y16_501584_c1_591_1097 | 168 |
| 461 | 3300002459 | JGI24751J29686_10046709 | JGI24751J29686_100467091 | 169 |
| 462 | 3300005288 | Ga0065714_10171130 | Ga0065714_101711302 | 169 |
| 463 | 3300005289 | Ga0065704_10431499 | Ga0065704_104314991 | 169 |
| 464 | 3300005290 | Ga0065712_10076915 | Ga0065712_100769153 | 169 |
| 465 | 3300005295 | Ga0065707_10177611 | Ga0065707_101776112 | 169 |
| 466 | 3300005328 | Ga0070676_10130483 | Ga0070676_101304832 | 169 |
| 467 | 3300005330 | Ga0070690_100463406 | Ga0070690_1004634062 | 169 |
| 468 | 3300005331 | Ga0070670_100004657 | Ga0070670_1000046575 | 169 |
| 469 | 3300005333 | Ga0070677_10082849 | Ga0070677_100828492 | 169 |
| 470 | 3300005335 | Ga0070666_10132949 | Ga0070666_101329491 | 169 |
| 471 | 3300005340 | Ga0070689_100263952 | Ga0070689_1002639521 | 169 |
| 472 | 3300005353 | Ga0070669_100431996 | Ga0070669_1004319962 | 169 |
| 473 | 3300005354 | Ga0070675_100126282 | Ga0070675_1001262822 | 169 |
| 474 | 3300005356 | Ga0070674_101412161 | Ga0070674_1014121611 | 169 |
| 475 | 3300005364 | Ga0070673_100347021 | Ga0070673_1003470212 | 169 |
| 476 | 3300005459 | Ga0068867_100088701 | Ga0068867_1000887012 | 169 |
| 477 | 3300005543 | Ga0070672_100248880 | Ga0070672_1002488802 | 169 |
| 478 | 3300005548 | Ga0070665_101446636 | Ga0070665_1014466361 | 169 |
| 479 | 3300005617 | Ga0068859_100506800 | Ga0068859_1005068001 | 169 |
| 480 | 3300005618 | Ga0068864_100684233 | Ga0068864_1006842331 | 169 |
| 481 | 3300005840 | Ga0068870_10065360 | Ga0068870_100653602 | 169 |
| 482 | 3300005844 | Ga0068862_100155394 | Ga0068862_1001553942 | 169 |
| 483 | 3300006871 | Ga0075434_100569555 | Ga0075434_1005695551 | 169 |
| 484 | 3300006881 | Ga0068865_100127083 | Ga0068865_1001270832 | 169 |
| 485 | 3300006931 | Ga0097620_100506788 | Ga0097620_1005067881 | 169 |
| 486 | 3300009094 | Ga0111539_10205600 | Ga0111539_102056002 | 169 |
| 487 | 3300009176 | Ga0105242_10362698 | Ga0105242_103626982 | 169 |
| 488 | 3300013306 | Ga0163162_10287143 | Ga0163162_102871431 | 169 |
| 489 | 3300013308 | Ga0157375_10022547 | Ga0157375_100225473 | 169 |
| 490 | 3300017792 | Ga0163161_10310195 | Ga0163161_103101952 | 169 |
| 491 | 3300025315 | Ga0207697_10181949 | Ga0207697_101819492 | 169 |
| 492 | 3300025893 | Ga0207682_10136135 | Ga0207682_101361351 | 169 |
| 493 | 3300025901 | Ga0207688_10022695 | Ga0207688_100226953 | 169 |
| 494 | 3300025907 | Ga0207645_10011662 | Ga0207645_100116622 | 169 |
| 495 | 3300025908 | Ga0207643_10013928 | Ga0207643_100139282 | 169 |
| 496 | 3300025916 | Ga0207663_10706010 | Ga0207663_107060102 | 169 |
| 497 | 3300025922 | Ga0207646_10437071 | Ga0207646_104370712 | 169 |
| 498 | 3300025926 | Ga0207659_10033487 | Ga0207659_100334872 | 169 |
| 499 | 3300025936 | Ga0207670_10086705 | Ga0207670_100867052 | 169 |
| 500 | 3300025940 | Ga0207691_10026751 | Ga0207691_100267512 | 169 |
| 501 | 3300025972 | Ga0207668_10947617 | Ga0207668_109476171 | 169 |
| 502 | 3300026075 | Ga0207708_10049416 | Ga0207708_100494161 | 169 |
| 503 | 3300026089 | Ga0207648_10190889 | Ga0207648_101908891 | 169 |
| 504 | 3300026116 | Ga0207674_10357838 | Ga0207674_103578382 | 169 |
| 505 | 3300026118 | Ga0207675_100165904 | Ga0207675_1001659042 | 169 |
| 506 | 3300026121 | Ga0207683_10068505 | Ga0207683_100685051 | 169 |
| 507 | 3300026121 | Ga0207683_10822012 | Ga0207683_108220122 | 169 |
| 508 | 3300028379 | Ga0268266_11711544 | Ga0268266_117115441 | 169 |
| 509 | 3300032002 | Ga0307416_100979985 | Ga0307416_1009799852 | 169 |
| 510 | 3300035172 | Ga0373955_0080303 | Ga0373955_0080303_784_1305 | 169 |
| 511 | 3300035725 | Ga0373947_0479446 | Ga0373947_0479446_182_703 | 169 |
| 512 | 3300046459 | Ga0495629_0536806 | Ga0495629_0536806_76_597 | 169 |
| 513 | 3300046492 | Ga0495585_0474076 | Ga0495585_0474076_56_565 | 169 |
| 514 | 3300046517 | Ga0495630_0013012 | Ga0495630_0013012_3724_4245 | 169 |
| 515 | 3300046522 | Ga0495643_0005221 | Ga0495643_0005221_6778_7287 | 169 |
| 516 | 3300046533 | Ga0495640_0055542 | Ga0495640_0055542_1036_1557 | 169 |
| 517 | 3300046536 | Ga0495587_0125866 | Ga0495587_0125866_660_1181 | 169 |
| 518 | 3300046543 | Ga0495645_0083112 | Ga0495645_0083112_361_882 | 169 |
| 519 | 3300046689 | Ga0495613_0001316 | Ga0495613_0001316_409_930 | 169 |
| 520 | 3300048088 | Ga0495602_0417327 | Ga0495602_0417327_179_691 | 169 |
| 521 | 3300050511 | nmdc:mga08y16_637677_c1 | nmdc:mga08y16_637677_c1_270_779 | 169 |
| 522 | 3300050512 | nmdc:mga0n895_818270_c1 | nmdc:mga0n895_818270_c1_253_765 | 169 |
| 523 | 3300053077 | Ga0495601_0053665 | Ga0495601_0053665_1861_2382 | 169 |
| 524 | 3300053085 | Ga0495619_0002013 | Ga0495619_0002013_2457_2978 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tpj-assembly1.cif.gz_A | crystal structure of a de novo designed protein with curved beta-sheet | 0.7311 | 44 | 157 |
| 4kvh-assembly1.cif.gz_A-2 | crystal structure of ketosteroid isomerase fold protein hmuk_0747 | 0.726 | 44 | 161 |
| 5evh-assembly1.cif.gz_A-2 | crystal structure of known function protein from kribbella flavida dsm 17836 | 0.7216 | 47 | 157 |
| 5l33-assembly1.cif.gz_A | crystal structure of a de novo designed protein with curved beta-sheet | 0.7174 | 44 | 162 |
| 4lc9-assembly1.cif.gz_B | structural basis for regulation of human glucokinase by glucokinase regulatory protein | 0.7142 | 113 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54TU4_103_417_2.115.10.20 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8165 | 113 | 147 | 2.115.10.20 |
| 4kvhA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.726 | 44 | 161 | 3.10.450.50 |
| af_Q80UG2_40_507_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7224 | 109 | 150 | 2.130.10.10 |
| 4lmiA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7127 | 44 | 168 | 3.10.450.50 |
| 4xdvE00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7125 | 22 | 158 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7SBW7-F1-model_v4 | SnoaL-like domain-containing protein | 0.9719 | 40 | 161 |
|
| AF-A0A3A5KWT3-F1-model_v4 | SnoaL-like domain-containing protein | 0.9627 | 51 | 158 |
|
| AF-A0A2V7SUG6-F1-model_v4 | SnoaL-like domain-containing protein | 0.9334 | 21 | 163 |
|
| AF-A0A1Q7SBW7-F1-model_v4 | SnoaL-like domain-containing protein | 0.9321 | 40 | 161 |
|
| AF-T1W9K2-F1-model_v4 | deleted | 0.9299 | 20 | 163 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar