F459136

General Info

Members Datasets Scaffolds Average Seq Length
524 230 524 166

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10321442|Ga0157376_103214423
Length 188
Sequence MPYRADDSQFQMLTLWGDCRMKMRVMLLMVAIVAAGAALPAQEPVIGVKDPESLFKDPDAKLNKNKQAALHIMRELLQCNQWDRAGEWLTKAYHQHNPNAASGLDGVVTYFTKVRNAKRVDKCDKLTTEVVAVMADDDYVTVLTPRKFPDPRTPGKEYFTSWFDTWRFVDGKADEHWDPATITAPAAK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
175 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10046709 3300002459 Bacteria 894
2 Ga0032354_1160538 3300003693 Unclassified 529
3 Ga0065714_10171130 3300005288 Bacteria 1004
4 Ga0065704_10431499 3300005289 Bacteria 722
5 Ga0065712_10076915 3300005290 Bacteria 3580
6 Ga0065712_10112287 3300005290 Bacteria 1802
7 Ga0065712_10362784 3300005290 Bacteria 773
8 Ga0065715_10409456 3300005293 Bacteria 871
9 Ga0065715_10637425 3300005293 Bacteria 686
10 Ga0065707_10177611 3300005295 Bacteria 1437
11 Ga0065707_10347754 3300005295 Bacteria 923
12 Ga0070658_10228520 3300005327 Bacteria 1575
13 Ga0070676_10025553 3300005328 Bacteria 3339
14 Ga0070676_10103655 3300005328 Bacteria 1761
15 Ga0070676_10130483 3300005328 Bacteria 1589
16 Ga0070683_100020814 3300005329 Bacteria 5843
17 Ga0070683_100274055 3300005329 Bacteria 1605
18 Ga0070690_100016542 3300005330 Bacteria 4421
19 Ga0070690_100070728 3300005330 Bacteria 2266
20 Ga0070690_100100435 3300005330 Bacteria 1918
21 Ga0070690_100463406 3300005330 Bacteria 942
22 Ga0070670_100004657 3300005331 Bacteria 11510
23 Ga0070670_100017026 3300005331 Bacteria 6238
24 Ga0070670_100117322 3300005331 Bacteria 2295
25 Ga0070670_100360632 3300005331 Unclassified 1278
26 Ga0070670_100444154 3300005331 Bacteria 1149
27 Ga0070677_10008361 3300005333 Bacteria 3479
28 Ga0070677_10082849 3300005333 Bacteria 1377
29 Ga0068869_100002654 3300005334 Bacteria 10804
30 Ga0068869_100011901 3300005334 Bacteria 5723
31 Ga0068869_100101367 3300005334 Bacteria 2178
32 Ga0068869_100147857 3300005334 Bacteria 1820
33 Ga0068869_100400613 3300005334 Unclassified 1129
34 Ga0070666_10061623 3300005335 Bacteria 2540
35 Ga0070666_10132949 3300005335 Bacteria 1730
36 Ga0070680_100613725 3300005336 Bacteria 934
37 Ga0070682_100085165 3300005337 Bacteria 2056
38 Ga0068868_100135468 3300005338 Bacteria 2018
39 Ga0068868_100422332 3300005338 Bacteria 1155
40 Ga0070689_100051402 3300005340 Bacteria 3186
41 Ga0070689_100080201 3300005340 Bacteria 2561
42 Ga0070689_100263952 3300005340 Bacteria 1424
43 Ga0070687_100159786 3300005343 Bacteria 1331
44 Ga0070687_100243311 3300005343 Bacteria 1114
45 Ga0070661_100039282 3300005344 Bacteria 3449
46 Ga0070661_100078609 3300005344 Bacteria 2433
47 Ga0070668_100070680 3300005347 Bacteria 2718
48 Ga0070669_100038877 3300005353 Bacteria 3455
49 Ga0070669_100074475 3300005353 Bacteria 2517
50 Ga0070669_100127525 3300005353 Bacteria 1949
51 Ga0070669_100431996 3300005353 Bacteria 1082
52 Ga0070675_100040295 3300005354 Bacteria 3813
53 Ga0070675_100050279 3300005354 Bacteria 3422
54 Ga0070675_100079298 3300005354 Bacteria 2736
55 Ga0070675_100126282 3300005354 Bacteria 2176
56 Ga0070675_100148550 3300005354 Bacteria 2008
57 Ga0070675_100402861 3300005354 Bacteria 1221
58 Ga0070675_100597646 3300005354 Bacteria 1000
59 Ga0070675_100672591 3300005354 Bacteria 942
60 Ga0070675_100717048 3300005354 Bacteria 911
61 Ga0070671_100088163 3300005355 Bacteria 2597
62 Ga0070671_100475622 3300005355 Bacteria 1073
63 Ga0070674_100005871 3300005356 Bacteria 7139
64 Ga0070674_100056705 3300005356 Bacteria 2717
65 Ga0070674_100058122 3300005356 Unclassified 2687
66 Ga0070674_100078479 3300005356 Bacteria 2353
67 Ga0070674_100085491 3300005356 Bacteria 2264
68 Ga0070674_100242211 3300005356 Bacteria 1412
69 Ga0070674_100870565 3300005356 Bacteria 783
70 Ga0070674_101412161 3300005356 Bacteria 623
71 Ga0070673_100072044 3300005364 Bacteria 2778
72 Ga0070673_100125429 3300005364 Bacteria 2147
73 Ga0070673_100154972 3300005364 Bacteria 1943
74 Ga0070673_100182036 3300005364 Bacteria 1799
75 Ga0070673_100204499 3300005364 Bacteria 1702
76 Ga0070673_100347021 3300005364 Bacteria 1316
77 Ga0070673_100377444 3300005364 Bacteria 1263
78 Ga0070688_100002480 3300005365 Bacteria 9334
79 Ga0070688_100059811 3300005365 Bacteria 2404
80 Ga0070659_100167048 3300005366 Bacteria 1801
81 Ga0070667_100180671 3300005367 Bacteria 1866
82 Ga0070667_100400287 3300005367 Bacteria 1250
83 Ga0070667_100583883 3300005367 Bacteria 1029
84 Ga0070667_100598209 3300005367 Bacteria 1016
85 Ga0070709_10003100 3300005434 Bacteria 8927
86 Ga0070710_10654775 3300005437 Bacteria 737
87 Ga0070701_10049972 3300005438 Bacteria 2164
88 Ga0070700_100005699 3300005441 Bacteria 6609
89 Ga0070694_100080568 3300005444 Bacteria 2263
90 Ga0070694_100275093 3300005444 Bacteria 1282
91 Ga0070663_100184710 3300005455 Bacteria 1620
92 Ga0070678_100395795 3300005456 Bacteria 1199
93 Ga0070678_100452672 3300005456 Bacteria 1124
94 Ga0070678_101436306 3300005456 Bacteria 645
95 Ga0070662_100041220 3300005457 Bacteria 3292
96 Ga0070681_11293904 3300005458 Bacteria 652
97 Ga0068867_100011607 3300005459 Bacteria 6220
98 Ga0068867_100088701 3300005459 Bacteria 2344
99 Ga0068867_100184069 3300005459 Bacteria 1663
100 Ga0068867_100250255 3300005459 Bacteria 1441
101 Ga0068867_100869622 3300005459 Bacteria 809
102 Ga0070685_10080674 3300005466 Bacteria 1950
103 Ga0070698_101257434 3300005471 Bacteria 690
104 Ga0070699_100862359 3300005518 Bacteria 829
105 Ga0070679_100551059 3300005530 Bacteria 1097
106 Ga0070684_100223479 3300005535 Bacteria 1718
107 Ga0070672_100040491 3300005543 Bacteria 3575
108 Ga0070672_100047993 3300005543 Bacteria 3316
109 Ga0070672_100120818 3300005543 Unclassified 2144
110 Ga0070672_100248880 3300005543 Bacteria 1496
111 Ga0070672_100513638 3300005543 Bacteria 1037
112 Ga0070686_100029149 3300005544 Bacteria 3354
113 Ga0070686_100034606 3300005544 Bacteria 3114
114 Ga0070686_100037356 3300005544 Bacteria 3012
115 Ga0070665_100254009 3300005548 Bacteria 1759
116 Ga0070665_101446636 3300005548 Bacteria 696
117 Ga0070664_100040531 3300005564 Bacteria 3926
118 Ga0070664_100125371 3300005564 Bacteria 2252
119 Ga0070664_100353655 3300005564 Bacteria 1337
120 Ga0070664_100866762 3300005564 Bacteria 846
121 Ga0068857_100153666 3300005577 Bacteria 2086
122 Ga0068854_100070505 3300005578 Bacteria 2555
123 Ga0070702_100213936 3300005615 Bacteria 1285
124 Ga0068859_100129807 3300005617 Bacteria 2591
125 Ga0068859_100270316 3300005617 Bacteria 1792
126 Ga0068859_100506800 3300005617 Bacteria 1302
127 Ga0068864_100219225 3300005618 Bacteria 1755
128 Ga0068864_100684233 3300005618 Bacteria 1001
129 Ga0068864_100989502 3300005618 Bacteria 834
130 Ga0068861_100033380 3300005719 Bacteria 3795
131 Ga0068861_100909754 3300005719 Bacteria 834
132 Ga0068870_10000249 3300005840 Bacteria 19958
133 Ga0068870_10005245 3300005840 Bacteria 5642
134 Ga0068870_10065360 3300005840 Bacteria 1967
135 Ga0068870_10280160 3300005840 Bacteria 1045
136 Ga0068863_100050412 3300005841 Bacteria 3945
137 Ga0068863_100690952 3300005841 Bacteria 1014
138 Ga0068863_100708525 3300005841 Unclassified 1001
139 Ga0068858_100023389 3300005842 Bacteria 5756
140 Ga0068858_100280117 3300005842 Bacteria 1588
141 Ga0068858_100298383 3300005842 Bacteria 1537
142 Ga0068858_100319433 3300005842 Bacteria 1484
143 Ga0068860_100432741 3300005843 Bacteria 1306
144 Ga0068860_100684724 3300005843 Bacteria 1034
145 Ga0068860_101234585 3300005843 Bacteria 768
146 Ga0068862_100155394 3300005844 Bacteria 2039
147 Ga0068862_101058705 3300005844 Bacteria 804
148 Ga0081539_10159941 3300005985 Bacteria 1074
149 Ga0070712_100065995 3300006175 Bacteria 2571
150 Ga0097621_100096387 3300006237 Bacteria 2482
151 Ga0097621_100114746 3300006237 Bacteria 2279
152 Ga0097621_100116794 3300006237 Bacteria 2260
153 Ga0097621_100652024 3300006237 Bacteria 966
154 Ga0068871_100009325 3300006358 Bacteria 7104
155 Ga0068871_100023640 3300006358 Bacteria 4758
156 Ga0068871_100089891 3300006358 Bacteria 2557
157 Ga0068871_100211492 3300006358 Bacteria 1678
158 Ga0075428_100006280 3300006844 Bacteria 13210
159 Ga0075428_100165734 3300006844 Bacteria 2397
160 Ga0075428_100461214 3300006844 Bacteria 1360
161 Ga0075428_100659159 3300006844 Bacteria 1116
162 Ga0075430_100033279 3300006846 Bacteria 4375
163 Ga0075430_100046284 3300006846 Bacteria 3674
164 Ga0075430_100109062 3300006846 Bacteria 2309
165 Ga0075430_100149126 3300006846 Bacteria 1947
166 Ga0075430_100317421 3300006846 Bacteria 1288
167 Ga0075430_100407542 3300006846 Bacteria 1122
168 Ga0075431_100007236 3300006847 Bacteria 11043
169 Ga0075431_100182982 3300006847 Bacteria 2150
170 Ga0075431_100700663 3300006847 Bacteria 990
171 Ga0075433_10002930 3300006852 Bacteria 13096
172 Ga0075433_10003186 3300006852 Bacteria 12645
173 Ga0075433_10063472 3300006852 Bacteria 3236
174 Ga0075433_10589679 3300006852 Bacteria 976
175 Ga0075434_100000852 3300006871 Bacteria 24305
176 Ga0075434_100003273 3300006871 Bacteria 14491
177 Ga0075434_100198948 3300006871 Bacteria 2023
178 Ga0075434_100262828 3300006871 Bacteria 1745
179 Ga0075434_100569555 3300006871 Bacteria 1152
180 Ga0075429_100013532 3300006880 Bacteria 7079
181 Ga0075429_100103729 3300006880 Bacteria 2483
182 Ga0075429_100108355 3300006880 Bacteria 2428
183 Ga0068865_100024156 3300006881 Bacteria 3985
184 Ga0068865_100127083 3300006881 Bacteria 1904
185 Ga0097620_100129813 3300006931 Bacteria 2591
186 Ga0097620_100270331 3300006931 Bacteria 1792
187 Ga0097620_100319830 3300006931 Bacteria 1646
188 Ga0097620_100506788 3300006931 Bacteria 1302
189 Ga0075435_100007756 3300007076 Bacteria 7672
190 Ga0111539_10004119 3300009094 Bacteria 19078
191 Ga0111539_10019888 3300009094 Bacteria 8272
192 Ga0111539_10076600 3300009094 Bacteria 3938
193 Ga0111539_10205600 3300009094 Bacteria 2295
194 Ga0111539_10619580 3300009094 Bacteria 1260
195 Ga0111539_11081049 3300009094 Bacteria 932
196 Ga0111539_11293813 3300009094 Bacteria 846
197 Ga0105245_10089924 3300009098 Bacteria 2823
198 Ga0105245_11995562 3300009098 Bacteria 634
199 Ga0105247_10019728 3300009101 Bacteria 4049
200 Ga0105247_10131311 3300009101 Bacteria 1633
201 Ga0114129_10019563 3300009147 Bacteria 9639
202 Ga0114129_10261922 3300009147 Bacteria 2317
203 Ga0114129_11524196 3300009147 Bacteria 821
204 Ga0105243_10877193 3300009148 Bacteria 891
205 Ga0105243_11115303 3300009148 Bacteria 798
206 Ga0105242_10003977 3300009176 Bacteria 11492
207 Ga0105242_10261111 3300009176 Bacteria 1564
208 Ga0105242_10362698 3300009176 Bacteria 1341
209 Ga0105248_10284303 3300009177 Bacteria 1862
210 Ga0105248_10415461 3300009177 Bacteria 1515
211 Ga0105248_10700682 3300009177 Bacteria 1143
212 Ga0105249_10103716 3300009553 Bacteria 2679
213 Ga0105249_10318556 3300009553 Bacteria 1566
214 Ga0105249_10388544 3300009553 Bacteria 1423
215 Ga0105249_10539476 3300009553 Bacteria 1216
216 Ga0105246_10460497 3300011119 Bacteria 1071
217 Ga0105246_10514072 3300011119 Bacteria 1019
218 Ga0105246_11044526 3300011119 Bacteria 742
219 Ga0157325_1001121 3300012485 Bacteria 1167
220 Ga0157370_10506971 3300013104 Bacteria 1108
221 Ga0157374_10047279 3300013296 Bacteria 3989
222 Ga0157374_10142197 3300013296 Unclassified 2330
223 Ga0157378_10015960 3300013297 Bacteria 6578
224 Ga0163162_10036676 3300013306 Bacteria 4888
225 Ga0163162_10287143 3300013306 Bacteria 1777
226 Ga0163162_11277892 3300013306 Bacteria 834
227 Ga0163162_12022121 3300013306 Bacteria 660
228 Ga0157375_10022547 3300013308 Bacteria 5796
229 Ga0157375_10838355 3300013308 Unclassified 1066
230 Ga0157375_12472354 3300013308 Bacteria 620
231 Ga0163163_10007402 3300014325 Bacteria 9693
232 Ga0163163_10084383 3300014325 Bacteria 3182
233 Ga0157380_10012560 3300014326 Bacteria 6146
234 Ga0157380_10056754 3300014326 Bacteria 3116
235 Ga0157380_10179800 3300014326 Bacteria 1857
236 Ga0157380_10224100 3300014326 Bacteria 1684
237 Ga0157380_10304910 3300014326 Bacteria 1469
238 Ga0157380_10633440 3300014326 Bacteria 1064
239 Ga0157377_10014587 3300014745 Bacteria 4001
240 Ga0157377_10057497 3300014745 Bacteria 2212
241 Ga0157379_10167390 3300014968 Bacteria 1984
242 Ga0157376_10178881 3300014969 Bacteria 1937
243 Ga0157376_10321442 3300014969 Bacteria 1471
244 Ga0157376_10492502 3300014969 Bacteria 1203
245 Ga0163161_10042416 3300017792 Bacteria 3272
246 Ga0163161_10310195 3300017792 Bacteria 1245
247 Ga0207697_10020719 3300025315 Bacteria 2691
248 Ga0207697_10181949 3300025315 Bacteria 921
249 Ga0207682_10004445 3300025893 Bacteria 5866
250 Ga0207682_10010733 3300025893 Bacteria 3585
251 Ga0207682_10136135 3300025893 Bacteria 1099
252 Ga0207642_10003899 3300025899 Bacteria 4756
253 Ga0207710_10142543 3300025900 Bacteria 1158
254 Ga0207688_10022695 3300025901 Bacteria 3436
255 Ga0207688_10245469 3300025901 Bacteria 1083
256 Ga0207680_10019297 3300025903 Bacteria 3643
257 Ga0207680_10527041 3300025903 Bacteria 842
258 Ga0207685_10099623 3300025905 Bacteria 1240
259 Ga0207699_10015884 3300025906 Bacteria 3924
260 Ga0207645_10005120 3300025907 Bacteria 9591
261 Ga0207645_10011662 3300025907 Bacteria 5992
262 Ga0207645_10084768 3300025907 Bacteria 2034
263 Ga0207643_10013928 3300025908 Bacteria 4363
264 Ga0207643_10015662 3300025908 Bacteria 4129
265 Ga0207643_10091464 3300025908 Bacteria 1774
266 Ga0207643_10328224 3300025908 Bacteria 957
267 Ga0207643_10335672 3300025908 Bacteria 946
268 Ga0207707_10454562 3300025912 Bacteria 1096
269 Ga0207693_10077455 3300025915 Bacteria 2604
270 Ga0207663_10706010 3300025916 Bacteria 799
271 Ga0207662_10047524 3300025918 Bacteria 2542
272 Ga0207662_10093548 3300025918 Bacteria 1852
273 Ga0207662_10164625 3300025918 Bacteria 1419
274 Ga0207662_10254521 3300025918 Bacteria 1154
275 Ga0207649_10076890 3300025920 Bacteria 2149
276 Ga0207649_10141043 3300025920 Bacteria 1649
277 Ga0207649_10867919 3300025920 Bacteria 706
278 Ga0207646_10437071 3300025922 Bacteria 1181
279 Ga0207681_10024808 3300025923 Bacteria 3850
280 Ga0207681_10039323 3300025923 Unclassified 3140
281 Ga0207681_10186071 3300025923 Bacteria 1585
282 Ga0207681_10215323 3300025923 Bacteria 1483
283 Ga0207681_10598263 3300025923 Bacteria 911
284 Ga0207681_10778878 3300025923 Bacteria 798
285 Ga0207681_10987669 3300025923 Bacteria 706
286 Ga0207650_10008303 3300025925 Bacteria 7090
287 Ga0207650_10013568 3300025925 Bacteria 5643
288 Ga0207659_10006225 3300025926 Bacteria 7300
289 Ga0207659_10018444 3300025926 Bacteria 4575
290 Ga0207659_10033487 3300025926 Bacteria 3536
291 Ga0207659_10063706 3300025926 Bacteria 2666
292 Ga0207659_10080639 3300025926 Bacteria 2404
293 Ga0207659_10188994 3300025926 Bacteria 1638
294 Ga0207659_10305560 3300025926 Bacteria 1308
295 Ga0207659_10731991 3300025926 Bacteria 848
296 Ga0207644_10004157 3300025931 Bacteria 9388
297 Ga0207644_11406544 3300025931 Bacteria 586
298 Ga0207690_10115505 3300025932 Bacteria 1940
299 Ga0207706_10088339 3300025933 Bacteria 2725
300 Ga0207706_10367007 3300025933 Bacteria 1250
301 Ga0207706_10911017 3300025933 Bacteria 742
302 Ga0207686_10046729 3300025934 Bacteria 2672
303 Ga0207686_10087750 3300025934 Bacteria 2047
304 Ga0207709_10116381 3300025935 Bacteria 1797
305 Ga0207709_10413188 3300025935 Bacteria 1034
306 Ga0207670_10086705 3300025936 Bacteria 2204
307 Ga0207670_10158599 3300025936 Bacteria 1686
308 Ga0207670_10206116 3300025936 Bacteria 1496
309 Ga0207670_10268042 3300025936 Bacteria 1326
310 Ga0207670_10378750 3300025936 Bacteria 1126
311 Ga0207670_10737854 3300025936 Bacteria 817
312 Ga0207669_10003643 3300025937 Bacteria 6685
313 Ga0207669_10108875 3300025937 Bacteria 1851
314 Ga0207669_10253429 3300025937 Bacteria 1312
315 Ga0207669_10324175 3300025937 Unclassified 1180
316 Ga0207704_10543792 3300025938 Unclassified 943
317 Ga0207691_10026751 3300025940 Bacteria 5413
318 Ga0207691_10086995 3300025940 Bacteria 2804
319 Ga0207691_10112553 3300025940 Bacteria 2419
320 Ga0207691_10129135 3300025940 Bacteria 2234
321 Ga0207691_10154117 3300025940 Unclassified 2019
322 Ga0207691_10329726 3300025940 Bacteria 1308
323 Ga0207711_10163033 3300025941 Bacteria 2019
324 Ga0207711_10510725 3300025941 Bacteria 1120
325 Ga0207689_10004330 3300025942 Bacteria 12928
326 Ga0207689_10016858 3300025942 Bacteria 6182
327 Ga0207689_10231942 3300025942 Bacteria 1525
328 Ga0207689_10360359 3300025942 Unclassified 1209
329 Ga0207679_10004309 3300025945 Bacteria 8852
330 Ga0207679_10235028 3300025945 Bacteria 1550
331 Ga0207679_10481815 3300025945 Bacteria 1104
332 Ga0207651_10013216 3300025960 Bacteria 4713
333 Ga0207651_10026016 3300025960 Bacteria 3647
334 Ga0207651_10264174 3300025960 Bacteria 1414
335 Ga0207651_10420207 3300025960 Bacteria 1141
336 Ga0207712_10170279 3300025961 Bacteria 1702
337 Ga0207668_10035146 3300025972 Bacteria 3334
338 Ga0207668_10101498 3300025972 Bacteria 2139
339 Ga0207668_10595863 3300025972 Bacteria 962
340 Ga0207668_10947617 3300025972 Bacteria 768
341 Ga0207640_11048437 3300025981 Bacteria 719
342 Ga0207658_10040198 3300025986 Bacteria 3379
343 Ga0207658_10985333 3300025986 Bacteria 769
344 Ga0207658_11356407 3300025986 Bacteria 650
345 Ga0207677_10060546 3300026023 Bacteria 2617
346 Ga0207703_10095736 3300026035 Bacteria 2505
347 Ga0207703_10218371 3300026035 Bacteria 1703
348 Ga0207703_10503021 3300026035 Bacteria 1138
349 Ga0207703_10934015 3300026035 Bacteria 831
350 Ga0207678_10172884 3300026067 Bacteria 1844
351 Ga0207708_10003780 3300026075 Bacteria 11157
352 Ga0207708_10049416 3300026075 Bacteria 3202
353 Ga0207641_10048112 3300026088 Bacteria 3598
354 Ga0207641_10400358 3300026088 Bacteria 1318
355 Ga0207648_10004440 3300026089 Bacteria 14396
356 Ga0207648_10084034 3300026089 Bacteria 2776
357 Ga0207648_10093227 3300026089 Bacteria 2634
358 Ga0207648_10190889 3300026089 Bacteria 1815
359 Ga0207648_10283806 3300026089 Bacteria 1481
360 Ga0207648_10538969 3300026089 Bacteria 1071
361 Ga0207676_10137579 3300026095 Bacteria 2086
362 Ga0207676_10290312 3300026095 Bacteria 1489
363 Ga0207676_10346171 3300026095 Bacteria 1373
364 Ga0207674_10336889 3300026116 Bacteria 1458
365 Ga0207674_10357838 3300026116 Bacteria 1411
366 Ga0207674_10647704 3300026116 Bacteria 1020
367 Ga0207675_100028731 3300026118 Bacteria 5180
368 Ga0207675_100165904 3300026118 Bacteria 2109
369 Ga0207675_100340353 3300026118 Bacteria 1468
370 Ga0207675_100589610 3300026118 Bacteria 1114
371 Ga0207675_101767133 3300026118 Bacteria 638
372 Ga0207683_10061989 3300026121 Bacteria 3293
373 Ga0207683_10068505 3300026121 Bacteria 3133
374 Ga0207683_10344671 3300026121 Bacteria 1367
375 Ga0207683_10822012 3300026121 Bacteria 862
376 Ga0207683_10873474 3300026121 Bacteria 835
377 Ga0209967_1033901 3300027364 Bacteria 768
378 Ga0209971_1142949 3300027682 Bacteria 590
379 Ga0209974_10096461 3300027876 Bacteria 1030
380 Ga0207428_10003132 3300027907 Bacteria 16221
381 Ga0207428_10007180 3300027907 Bacteria 10186
382 Ga0207428_10266016 3300027907 Bacteria 1276
383 Ga0268266_11228805 3300028379 Bacteria 724
384 Ga0268266_11711544 3300028379 Bacteria 604
385 Ga0268266_11943180 3300028379 Bacteria 562
386 Ga0268265_10094017 3300028380 Bacteria 2403
387 Ga0268265_10281684 3300028380 Bacteria 1488
388 Ga0268265_10331123 3300028380 Bacteria 1383
389 Ga0268265_10861288 3300028380 Bacteria 887
390 Ga0268265_11432363 3300028380 Bacteria 693
391 Ga0268265_11530201 3300028380 Bacteria 671
392 Ga0268264_10305485 3300028381 Bacteria 1499
393 Ga0268264_10539757 3300028381 Bacteria 1142
394 Ga0268264_10722997 3300028381 Bacteria 990
395 Ga0268264_11041616 3300028381 Bacteria 826
396 Ga0307408_100571971 3300031548 Bacteria 1000
397 Ga0307408_101212501 3300031548 Bacteria 704
398 Ga0307412_10244115 3300031911 Bacteria 1391
399 Ga0307416_100195506 3300032002 Bacteria 1913
400 Ga0307416_100979985 3300032002 Unclassified 948
401 Ga0307416_102321715 3300032002 Bacteria 637
402 Ga0307414_10098941 3300032004 Unclassified 2190
403 Ga0373934_0338459 3300035086 Bacteria 626
404 Ga0373944_0119666 3300035089 Bacteria 906
405 Ga0373923_0071212 3300035111 Bacteria 1493
406 Ga0373932_0008500 3300035112 Bacteria 2456
407 Ga0373936_0195869 3300035113 Bacteria 890
408 Ga0373936_0239746 3300035113 Bacteria 808
409 Ga0373956_0159430 3300035119 Bacteria 1063
410 Ga0373957_0076732 3300035120 Bacteria 1314
411 Ga0373946_0122461 3300035171 Bacteria 1189
412 Ga0373955_0080303 3300035172 Bacteria 1842
413 Ga0373962_0181723 3300035242 Bacteria 703
414 Ga0373924_0010264 3300035410 Bacteria 3447
415 Ga0373935_0077317 3300035692 Bacteria 2157
416 Ga0373927_0046317 3300035695 Bacteria 2814
417 Ga0373933_0034019 3300035724 Bacteria 2968
418 Ga0373947_0479446 3300035725 Bacteria 844
419 Ga0373947_0528679 3300035725 Bacteria 802
420 Ga0373947_0568487 3300035725 Bacteria 772
421 Ga0373937_0222939 3300036401 Unclassified 1775
422 Ga0373925_0160875 3300037068 Bacteria 1768
423 Ga0373925_0407438 3300037068 Bacteria 1110
424 Ga0436365_1567992 3300039437 Bacteria 1247
425 Ga0439453_0000854 3300041408 Bacteria 3626
426 Ga0451853_2385990 3300041512 Bacteria 1816
427 Ga0439450_000889 3300042008 Bacteria 4143
428 Ga0439435_0045205 3300042436 Bacteria 1244
429 Ga0450901_015139 3300042533 Bacteria 810
430 Ga0439440_0047066 3300042993 Bacteria 1067
431 Ga0451576_0161262 3300045051 Bacteria 2340
432 Ga0451576_0374127 3300045051 Bacteria 1493
433 Ga0495629_0227805 3300046459 Bacteria 1285
434 Ga0495629_0536806 3300046459 Unclassified 786
435 Ga0495585_0474076 3300046492 Bacteria 597
436 Ga0495618_0469160 3300046514 Unclassified 762
437 Ga0495630_0013012 3300046517 Bacteria 6045
438 Ga0495643_0005221 3300046522 Bacteria 8844
439 Ga0495640_0055542 3300046533 Bacteria 2709
440 Ga0495587_0125866 3300046536 Bacteria 1466
441 Ga0495645_0083112 3300046543 Unclassified 2296
442 Ga0495656_0169954 3300046615 Bacteria 1065
443 Ga0495635_0615813 3300046663 Unclassified 708
444 Ga0495613_0001316 3300046689 Bacteria 18966
445 Ga0495602_0417327 3300048088 Unclassified 954
446 Ga0496100_0001360 3300048903 Bacteria 11981
447 Ga0496101_0000846 3300048904 Bacteria 18019
448 Ga0496102_0187575 3300048905 Bacteria 1949
449 Ga0496104_0015664 3300048907 Bacteria 6876
450 Ga0496107_0123883 3300048910 Bacteria 1905
451 Ga0496109_0506834 3300048912 Bacteria 1139
452 Ga0496112_1072729 3300048915 Bacteria 724
453 Ga0496114_0001483 3300048917 Bacteria 17820
454 Ga0496114_0211714 3300048917 Bacteria 1700
455 Ga0501309_025150 3300049129 Bacteria 854
456 Ga0501031_0280537 3300049568 Bacteria 1081
457 Ga0501032_0492573 3300049569 Bacteria 784
458 Ga0501036_0025356 3300049572 Bacteria 5002
459 Ga0501039_0051689 3300049575 Bacteria 3180
460 Ga0501040_0278360 3300049576 Bacteria 1195
461 Ga0501040_0543941 3300049576 Bacteria 838
462 Ga0501041_0113650 3300049577 Bacteria 1681
463 Ga0501042_0096911 3300049578 Bacteria 2120
464 Ga0501042_0455038 3300049578 Bacteria 928
465 Ga0501046_0086970 3300049580 Bacteria 2409
466 Ga0501071_1107896 3300049587 Bacteria 612
467 Ga0501072_0378358 3300049588 Bacteria 1123
468 Ga0501074_0052846 3300049590 Bacteria 2932
469 Ga0501075_0002170 3300049591 Bacteria 12998
470 Ga0501075_0335127 3300049591 Bacteria 1153
471 Ga0501076_0194456 3300049592 Bacteria 1656
472 Ga0501076_0319875 3300049592 Bacteria 1273
473 Ga0501249_004712 3300049679 Bacteria 2778
474 Ga0501225_0080192 3300049705 Bacteria 937
475 Ga0501079_0023872 3300049741 Bacteria 4691
476 Ga0501080_0356052 3300049742 Bacteria 1321
477 Ga0501081_0033307 3300049743 Bacteria 3500
478 Ga0501083_0922848 3300049744 Bacteria 568
479 Ga0501045_0560585 3300049824 Bacteria 847
480 Ga0501045_0565055 3300049824 Bacteria 843
481 nmdc:mga05p37_106831_c1 3300050507 Bacteria 3444
482 nmdc:mga05p37_26749_c1 3300050507 Bacteria 7015
483 nmdc:mga09592_23720_c1 3300050508 Bacteria 5068
484 nmdc:mga09592_498579_c1 3300050508 Bacteria 1048
485 nmdc:mga09592_535017_c1 3300050508 Bacteria 1007
486 nmdc:mga09592_65965_c1 3300050508 Bacteria 3067
487 nmdc:mga0qj67_1929_c1 3300050509 Bacteria 14733
488 nmdc:mga0qj67_196838_c1 3300050509 Bacteria 1638
489 nmdc:mga0qj67_272867_c1 3300050509 Bacteria 1371
490 nmdc:mga0qj67_391437_c1 3300050509 Bacteria 1122
491 nmdc:mga0qj67_529411_c1 3300050509 Bacteria 946
492 nmdc:mga0qj67_633138_c1 3300050509 Bacteria 854
493 nmdc:mga0qj67_98047_c1 3300050509 Bacteria 2361
494 nmdc:mga0qj67_99176_c1 3300050509 Bacteria 2347
495 nmdc:mga06r32_115284_c1 3300050510 Bacteria 2646
496 nmdc:mga06r32_1374241_c1 3300050510 Bacteria 649
497 nmdc:mga06r32_1971_c2 3300050510 Bacteria 13750
498 nmdc:mga06r32_334279_c1 3300050510 Bacteria 1500
499 nmdc:mga06r32_622581_c1 3300050510 Bacteria 1049
500 nmdc:mga06r32_706084_c1 3300050510 Bacteria 974
501 nmdc:mga08y16_127440_c1 3300050511 Bacteria 2648
502 nmdc:mga08y16_22537_c1 3300050511 Bacteria 6649
503 nmdc:mga08y16_38144_c1 3300050511 Bacteria 5046
504 nmdc:mga08y16_501584_c1 3300050511 Bacteria 1233
505 nmdc:mga08y16_559956_c1 3300050511 Bacteria 1156
506 nmdc:mga08y16_637677_c1 3300050511 Bacteria 1071
507 nmdc:mga08y16_7050_c1 3300050511 Bacteria 11796
508 nmdc:mga08y16_79613_c1 3300050511 Bacteria 3415
509 nmdc:mga0n895_1486_c1 3300050512 Bacteria 17585
510 nmdc:mga0n895_168822_c1 3300050512 Bacteria 2220
511 nmdc:mga0n895_24554_c1 3300050512 Bacteria 5682
512 nmdc:mga0n895_818270_c1 3300050512 Bacteria 921
513 nmdc:mga0rr50_19004_c1 3300050513 Bacteria 4628
514 nmdc:mga0rr50_360128_c1 3300050513 Bacteria 1224
515 nmdc:mga0rr50_5456_c1 3300050513 Bacteria 7588
516 nmdc:mga0a205_16818_c1 3300050515 Bacteria 6851
517 nmdc:mga0a205_2367_c1 3300050515 Bacteria 16616
518 nmdc:mga0a205_550167_c1 3300050515 Bacteria 1009
519 Ga0495601_0053665 3300053077 Bacteria 2548
520 Ga0495595_0178438 3300053084 Bacteria 1053
521 Ga0495619_0002013 3300053085 Bacteria 13507
522 Ga0501084_0730626 3300054114 Bacteria 834
523 Ga0530510_0158022 3300061734 Bacteria 1676
524 Ga0530510_0890975 3300061734 Bacteria 680

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100862359 Ga0070699_1008623591 131
2 3300035113 Ga0373936_0239746 Ga0373936_0239746_292_792 135
3 3300006852 Ga0075433_10003186 Ga0075433_100031869 136
4 3300006871 Ga0075434_100000852 Ga0075434_10000085221 136
5 3300007076 Ga0075435_100007756 Ga0075435_1000077561 136
6 3300050512 nmdc:mga0n895_1486_c1 nmdc:mga0n895_1486_c1_10512_11024 136
7 3300050513 nmdc:mga0rr50_5456_c1 nmdc:mga0rr50_5456_c1_18_530 136
8 3300006852 Ga0075433_10002930 Ga0075433_100029308 141
9 3300006871 Ga0075434_100003273 Ga0075434_1000032739 141
10 3300050512 nmdc:mga0n895_24554_c1 nmdc:mga0n895_24554_c1_2079_2591 141
11 3300050513 nmdc:mga0rr50_19004_c1 nmdc:mga0rr50_19004_c1_118_630 141
12 3300050515 nmdc:mga0a205_16818_c1 nmdc:mga0a205_16818_c1_1309_1821 141
13 3300005329 Ga0070683_100020814 Ga0070683_1000208147 148
14 3300013296 Ga0157374_10047279 Ga0157374_100472794 148
15 3300013308 Ga0157375_12472354 Ga0157375_124723542 148
16 3300026118 Ga0207675_100589610 Ga0207675_1005896101 150
17 3300049679 Ga0501249_004712 Ga0501249_004712_850_1335 150
18 3300049705 Ga0501225_0080192 Ga0501225_0080192_382_867 150
19 3300009098 Ga0105245_11995562 Ga0105245_119955621 152
20 3300026089 Ga0207648_10093227 Ga0207648_100932273 152
21 3300046459 Ga0495629_0227805 Ga0495629_0227805_764_1258 152
22 3300049569 Ga0501032_0492573 Ga0501032_0492573_14_481 152
23 3300049587 Ga0501071_1107896 Ga0501071_1107896_122_583 152
24 3300006846 Ga0075430_100033279 Ga0075430_1000332793 153
25 3300006847 Ga0075431_100700663 Ga0075431_1007006631 153
26 3300035725 Ga0373947_0568487 Ga0373947_0568487_248_760 153
27 3300006844 Ga0075428_100165734 Ga0075428_1001657343 154
28 3300006846 Ga0075430_100317421 Ga0075430_1003174212 154
29 3300009147 Ga0114129_10019563 Ga0114129_100195635 154
30 3300027364 Ga0209967_1033901 Ga0209967_10339012 154
31 3300050507 nmdc:mga05p37_26749_c1 nmdc:mga05p37_26749_c1_1022_1552 154
32 3300006846 Ga0075430_100046284 Ga0075430_1000462842 155
33 3300006847 Ga0075431_100182982 Ga0075431_1001829821 155
34 3300006852 Ga0075433_10589679 Ga0075433_105896792 155
35 3300006880 Ga0075429_100013532 Ga0075429_1000135328 155
36 3300009094 Ga0111539_11293813 Ga0111539_112938132 155
37 3300027907 Ga0207428_10007180 Ga0207428_100071802 155
38 3300028380 Ga0268265_10281684 Ga0268265_102816842 155
39 3300031548 Ga0307408_101212501 Ga0307408_1012125011 155
40 3300049578 Ga0501042_0455038 Ga0501042_0455038_415_915 155
41 3300050509 nmdc:mga0qj67_196838_c1 nmdc:mga0qj67_196838_c1_473_979 155
42 3300050510 nmdc:mga06r32_1374241_c1 nmdc:mga06r32_1374241_c1_124_630 155
43 3300050511 nmdc:mga08y16_7050_c1 nmdc:mga08y16_7050_c1_451_954 155
44 3300050515 nmdc:mga0a205_550167_c1 nmdc:mga0a205_550167_c1_357_929 155
45 3300005328 Ga0070676_10103655 Ga0070676_101036552 156
46 3300025900 Ga0207710_10142543 Ga0207710_101425432 156
47 3300050509 nmdc:mga0qj67_272867_c1 nmdc:mga0qj67_272867_c1_690_1211 156
48 3300009101 Ga0105247_10019728 Ga0105247_100197284 157
49 3300014968 Ga0157379_10167390 Ga0157379_101673902 157
50 3300025899 Ga0207642_10003899 Ga0207642_100038994 157
51 3300026035 Ga0207703_10934015 Ga0207703_109340152 157
52 3300032002 Ga0307416_100195506 Ga0307416_1001955061 157
53 3300049576 Ga0501040_0278360 Ga0501040_0278360_449_955 157
54 3300049824 Ga0501045_0560585 Ga0501045_0560585_236_772 157
55 3300050508 nmdc:mga09592_23720_c1 nmdc:mga09592_23720_c1_1347_1853 157
56 3300050509 nmdc:mga0qj67_99176_c1 nmdc:mga0qj67_99176_c1_1732_2238 157
57 3300050510 nmdc:mga06r32_115284_c1 nmdc:mga06r32_115284_c1_2052_2561 157
58 3300005355 Ga0070671_100475622 Ga0070671_1004756221 158
59 3300005842 Ga0068858_100298383 Ga0068858_1002983832 158
60 3300006844 Ga0075428_100659159 Ga0075428_1006591592 158
61 3300025936 Ga0207670_10206116 Ga0207670_102061163 158
62 3300036401 Ga0373937_0222939 Ga0373937_0222939_30_542 158
63 3300041512 Ga0451853_2385990 Ga0451853_2385990_598_1110 158
64 3300042436 Ga0439435_0045205 Ga0439435_0045205_218_724 158
65 3300048915 Ga0496112_1072729 Ga0496112_1072729_22_531 158
66 3300050509 nmdc:mga0qj67_1929_c1 nmdc:mga0qj67_1929_c1_3250_3729 158
67 3300050509 nmdc:mga0qj67_529411_c1 nmdc:mga0qj67_529411_c1_240_746 158
68 3300050510 nmdc:mga06r32_1971_c2 nmdc:mga06r32_1971_c2_1946_2425 158
69 3300050510 nmdc:mga06r32_622581_c1 nmdc:mga06r32_622581_c1_21_527 158
70 3300053084 Ga0495595_0178438 Ga0495595_0178438_27_539 158
71 3300005290 Ga0065712_10112287 Ga0065712_101122872 159
72 3300005330 Ga0070690_100070728 Ga0070690_1000707284 159
73 3300005334 Ga0068869_100011901 Ga0068869_1000119015 159
74 3300005335 Ga0070666_10061623 Ga0070666_100616233 159
75 3300005338 Ga0068868_100135468 Ga0068868_1001354682 159
76 3300005340 Ga0070689_100051402 Ga0070689_1000514022 159
77 3300005344 Ga0070661_100078609 Ga0070661_1000786092 159
78 3300005347 Ga0070668_100070680 Ga0070668_1000706804 159
79 3300005353 Ga0070669_100038877 Ga0070669_1000388773 159
80 3300005356 Ga0070674_100005871 Ga0070674_1000058714 159
81 3300005364 Ga0070673_100182036 Ga0070673_1001820361 159
82 3300005365 Ga0070688_100002480 Ga0070688_1000024806 159
83 3300005366 Ga0070659_100167048 Ga0070659_1001670482 159
84 3300005367 Ga0070667_100180671 Ga0070667_1001806712 159
85 3300005444 Ga0070694_100080568 Ga0070694_1000805683 159
86 3300005455 Ga0070663_100184710 Ga0070663_1001847102 159
87 3300005459 Ga0068867_100184069 Ga0068867_1001840692 159
88 3300005459 Ga0068867_100869622 Ga0068867_1008696221 159
89 3300005466 Ga0070685_10080674 Ga0070685_100806742 159
90 3300005544 Ga0070686_100034606 Ga0070686_1000346065 159
91 3300005548 Ga0070665_100254009 Ga0070665_1002540091 159
92 3300005564 Ga0070664_100040531 Ga0070664_1000405314 159
93 3300005617 Ga0068859_100129807 Ga0068859_1001298073 159
94 3300005840 Ga0068870_10000249 Ga0068870_1000024910 159
95 3300006846 Ga0075430_100109062 Ga0075430_1001090622 159
96 3300006847 Ga0075431_100007236 Ga0075431_1000072365 159
97 3300006852 Ga0075433_10063472 Ga0075433_100634722 159
98 3300006871 Ga0075434_100198948 Ga0075434_1001989483 159
99 3300006931 Ga0097620_100129813 Ga0097620_1001298132 159
100 3300014326 Ga0157380_10012560 Ga0157380_100125604 159
101 3300017792 Ga0163161_10042416 Ga0163161_100424162 159
102 3300025315 Ga0207697_10020719 Ga0207697_100207193 159
103 3300025893 Ga0207682_10004445 Ga0207682_100044452 159
104 3300025901 Ga0207688_10245469 Ga0207688_102454692 159
105 3300025903 Ga0207680_10019297 Ga0207680_100192973 159
106 3300025907 Ga0207645_10084768 Ga0207645_100847683 159
107 3300025908 Ga0207643_10091464 Ga0207643_100914644 159
108 3300025918 Ga0207662_10047524 Ga0207662_100475243 159
109 3300025920 Ga0207649_10076890 Ga0207649_100768902 159
110 3300025923 Ga0207681_10186071 Ga0207681_101860711 159
111 3300025932 Ga0207690_10115505 Ga0207690_101155052 159
112 3300025933 Ga0207706_10088339 Ga0207706_100883394 159
113 3300025936 Ga0207670_10158599 Ga0207670_101585992 159
114 3300025937 Ga0207669_10003643 Ga0207669_100036435 159
115 3300025940 Ga0207691_10112553 Ga0207691_101125532 159
116 3300025942 Ga0207689_10004330 Ga0207689_100043308 159
117 3300025945 Ga0207679_10004309 Ga0207679_100043094 159
118 3300025961 Ga0207712_10170279 Ga0207712_101702791 159
119 3300025972 Ga0207668_10035146 Ga0207668_100351464 159
120 3300025986 Ga0207658_10040198 Ga0207658_100401987 159
121 3300026023 Ga0207677_10060546 Ga0207677_100605464 159
122 3300026035 Ga0207703_10218371 Ga0207703_102183712 159
123 3300026067 Ga0207678_10172884 Ga0207678_101728844 159
124 3300026088 Ga0207641_10048112 Ga0207641_100481121 159
125 3300026089 Ga0207648_10084034 Ga0207648_100840343 159
126 3300026116 Ga0207674_10336889 Ga0207674_103368891 159
127 3300027682 Ga0209971_1142949 Ga0209971_11429491 159
128 3300027907 Ga0207428_10003132 Ga0207428_100031324 159
129 3300028380 Ga0268265_10094017 Ga0268265_100940174 159
130 3300028381 Ga0268264_10305485 Ga0268264_103054851 159
131 3300041408 Ga0439453_0000854 Ga0439453_0000854_1027_1509 159
132 3300049129 Ga0501309_025150 Ga0501309_025150_140_658 159
133 3300050509 nmdc:mga0qj67_98047_c1 nmdc:mga0qj67_98047_c1_789_1334 159
134 3300050510 nmdc:mga06r32_334279_c1 nmdc:mga06r32_334279_c1_306_851 159
135 3300005330 Ga0070690_100100435 Ga0070690_1001004353 160
136 3300005364 Ga0070673_100125429 Ga0070673_1001254291 160
137 3300005367 Ga0070667_100583883 Ga0070667_1005838832 160
138 3300005456 Ga0070678_100395795 Ga0070678_1003957953 160
139 3300009094 Ga0111539_10019888 Ga0111539_100198886 160
140 3300009147 Ga0114129_10261922 Ga0114129_102619222 160
141 3300026035 Ga0207703_10503021 Ga0207703_105030212 160
142 3300046615 Ga0495656_0169954 Ga0495656_0169954_22_507 160
143 3300050507 nmdc:mga05p37_106831_c1 nmdc:mga05p37_106831_c1_68_553 160
144 3300050509 nmdc:mga0qj67_633138_c1 nmdc:mga0qj67_633138_c1_271_756 160
145 3300050511 nmdc:mga08y16_127440_c1 nmdc:mga08y16_127440_c1_594_1079 160
146 3300005354 Ga0070675_100717048 Ga0070675_1007170481 161
147 3300005615 Ga0070702_100213936 Ga0070702_1002139361 161
148 3300005841 Ga0068863_100050412 Ga0068863_1000504124 161
149 3300005842 Ga0068858_100023389 Ga0068858_1000233892 161
150 3300006880 Ga0075429_100103729 Ga0075429_1001037291 161
151 3300009094 Ga0111539_10076600 Ga0111539_100766004 161
152 3300009176 Ga0105242_10003977 Ga0105242_100039772 161
153 3300009177 Ga0105248_10415461 Ga0105248_104154612 161
154 3300009553 Ga0105249_10103716 Ga0105249_101037163 161
155 3300011119 Ga0105246_10460497 Ga0105246_104604972 161
156 3300012485 Ga0157325_1001121 Ga0157325_10011212 161
157 3300013306 Ga0163162_10036676 Ga0163162_100366762 161
158 3300013306 Ga0163162_12022121 Ga0163162_120221211 161
159 3300014326 Ga0157380_10179800 Ga0157380_101798003 161
160 3300014326 Ga0157380_10224100 Ga0157380_102241002 161
161 3300014745 Ga0157377_10057497 Ga0157377_100574972 161
162 3300014969 Ga0157376_10492502 Ga0157376_104925022 161
163 3300025926 Ga0207659_10018444 Ga0207659_100184445 161
164 3300028379 Ga0268266_11228805 Ga0268266_112288052 161
165 3300035112 Ga0373932_0008500 Ga0373932_0008500_526_1047 161
166 3300035242 Ga0373962_0181723 Ga0373962_0181723_86_607 161
167 3300042533 Ga0450901_015139 Ga0450901_015139_29_574 161
168 3300042993 Ga0439440_0047066 Ga0439440_0047066_269_814 161
169 3300045051 Ga0451576_0161262 Ga0451576_0161262_1807_2328 161
170 3300050508 nmdc:mga09592_498579_c1 nmdc:mga09592_498579_c1_385_915 161
171 3300050508 nmdc:mga09592_65965_c1 nmdc:mga09592_65965_c1_918_1439 161
172 3300050511 nmdc:mga08y16_38144_c1 nmdc:mga08y16_38144_c1_929_1450 161
173 3300050512 nmdc:mga0n895_168822_c1 nmdc:mga0n895_168822_c1_1160_1681 161
174 3300050515 nmdc:mga0a205_2367_c1 nmdc:mga0a205_2367_c1_1168_1689 161
175 3300005334 Ga0068869_100101367 Ga0068869_1001013673 162
176 3300005354 Ga0070675_100079298 Ga0070675_1000792981 162
177 3300005543 Ga0070672_100047993 Ga0070672_1000479932 162
178 3300005719 Ga0068861_100909754 Ga0068861_1009097542 162
179 3300005840 Ga0068870_10005245 Ga0068870_100052452 162
180 3300005843 Ga0068860_101234585 Ga0068860_1012345852 162
181 3300009177 Ga0105248_10700682 Ga0105248_107006821 162
182 3300025908 Ga0207643_10015662 Ga0207643_100156623 162
183 3300025926 Ga0207659_10080639 Ga0207659_100806392 162
184 3300025941 Ga0207711_10510725 Ga0207711_105107252 162
185 3300026118 Ga0207675_101767133 Ga0207675_1017671331 162
186 3300050508 nmdc:mga09592_535017_c1 nmdc:mga09592_535017_c1_357_851 162
187 3300025918 Ga0207662_10254521 Ga0207662_102545212 163
188 3300046514 Ga0495618_0469160 Ga0495618_0469160_174_677 163
189 3300048917 Ga0496114_0211714 Ga0496114_0211714_1043_1537 163
190 3300005334 Ga0068869_100147857 Ga0068869_1001478573 164
191 3300005444 Ga0070694_100275093 Ga0070694_1002750932 164
192 3300005841 Ga0068863_100708525 Ga0068863_1007085252 164
193 3300006175 Ga0070712_100065995 Ga0070712_1000659953 164
194 3300006237 Ga0097621_100114746 Ga0097621_1001147464 164
195 3300006358 Ga0068871_100009325 Ga0068871_1000093256 164
196 3300006844 Ga0075428_100461214 Ga0075428_1004612142 164
197 3300009094 Ga0111539_10004119 Ga0111539_100041193 164
198 3300009098 Ga0105245_10089924 Ga0105245_100899244 164
199 3300009176 Ga0105242_10261111 Ga0105242_102611113 164
200 3300014326 Ga0157380_10304910 Ga0157380_103049102 164
201 3300014969 Ga0157376_10178881 Ga0157376_101788812 164
202 3300025905 Ga0207685_10099623 Ga0207685_100996231 164
203 3300025915 Ga0207693_10077455 Ga0207693_100774552 164
204 3300025923 Ga0207681_10215323 Ga0207681_102153232 164
205 3300025934 Ga0207686_10087750 Ga0207686_100877502 164
206 3300025938 Ga0207704_10543792 Ga0207704_105437921 164
207 3300025942 Ga0207689_10231942 Ga0207689_102319421 164
208 3300027876 Ga0209974_10096461 Ga0209974_100964612 164
209 3300031548 Ga0307408_100571971 Ga0307408_1005719712 164
210 3300045051 Ga0451576_0374127 Ga0451576_0374127_95_598 164
211 3300048903 Ga0496100_0001360 Ga0496100_0001360_3145_3663 164
212 3300048904 Ga0496101_0000846 Ga0496101_0000846_2664_3182 164
213 3300048905 Ga0496102_0187575 Ga0496102_0187575_1367_1885 164
214 3300048907 Ga0496104_0015664 Ga0496104_0015664_3860_4378 164
215 3300048910 Ga0496107_0123883 Ga0496107_0123883_779_1297 164
216 3300048917 Ga0496114_0001483 Ga0496114_0001483_15611_16129 164
217 3300049824 Ga0501045_0565055 Ga0501045_0565055_31_531 164
218 3300050511 nmdc:mga08y16_22537_c1 nmdc:mga08y16_22537_c1_3266_3766 164
219 3300005331 Ga0070670_100017026 Ga0070670_1000170266 165
220 3300005354 Ga0070675_100672591 Ga0070675_1006725912 165
221 3300005457 Ga0070662_100041220 Ga0070662_1000412202 165
222 3300005564 Ga0070664_100125371 Ga0070664_1001253712 165
223 3300005618 Ga0068864_100219225 Ga0068864_1002192252 165
224 3300014325 Ga0163163_10084383 Ga0163163_100843832 165
225 3300025920 Ga0207649_10867919 Ga0207649_108679191 165
226 3300025925 Ga0207650_10013568 Ga0207650_100135685 165
227 3300025926 Ga0207659_10731991 Ga0207659_107319911 165
228 3300025935 Ga0207709_10116381 Ga0207709_101163812 165
229 3300025945 Ga0207679_10235028 Ga0207679_102350282 165
230 3300025972 Ga0207668_10101498 Ga0207668_101014983 165
231 3300026089 Ga0207648_10283806 Ga0207648_102838062 165
232 3300026095 Ga0207676_10346171 Ga0207676_103461712 165
233 3300028381 Ga0268264_10539757 Ga0268264_105397572 165
234 3300035120 Ga0373957_0076732 Ga0373957_0076732_121_630 165
235 3300049591 Ga0501075_0335127 Ga0501075_0335127_537_1076 165
236 3300005328 Ga0070676_10025553 Ga0070676_100255533 166
237 3300005329 Ga0070683_100274055 Ga0070683_1002740552 166
238 3300005330 Ga0070690_100016542 Ga0070690_1000165422 166
239 3300005331 Ga0070670_100360632 Ga0070670_1003606322 166
240 3300005333 Ga0070677_10008361 Ga0070677_100083612 166
241 3300005334 Ga0068869_100002654 Ga0068869_1000026549 166
242 3300005336 Ga0070680_100613725 Ga0070680_1006137252 166
243 3300005337 Ga0070682_100085165 Ga0070682_1000851652 166
244 3300005338 Ga0068868_100422332 Ga0068868_1004223322 166
245 3300005353 Ga0070669_100127525 Ga0070669_1001275252 166
246 3300005354 Ga0070675_100040295 Ga0070675_1000402954 166
247 3300005354 Ga0070675_100050279 Ga0070675_1000502793 166
248 3300005355 Ga0070671_100088163 Ga0070671_1000881632 166
249 3300005356 Ga0070674_100056705 Ga0070674_1000567052 166
250 3300005356 Ga0070674_100058122 Ga0070674_1000581222 166
251 3300005356 Ga0070674_100242211 Ga0070674_1002422112 166
252 3300005364 Ga0070673_100154972 Ga0070673_1001549722 166
253 3300005364 Ga0070673_100204499 Ga0070673_1002044992 166
254 3300005364 Ga0070673_100377444 Ga0070673_1003774442 166
255 3300005367 Ga0070667_100400287 Ga0070667_1004002872 166
256 3300005438 Ga0070701_10049972 Ga0070701_100499722 166
257 3300005441 Ga0070700_100005699 Ga0070700_1000056992 166
258 3300005456 Ga0070678_100452672 Ga0070678_1004526722 166
259 3300005456 Ga0070678_101436306 Ga0070678_1014363061 166
260 3300005459 Ga0068867_100011607 Ga0068867_1000116073 166
261 3300005535 Ga0070684_100223479 Ga0070684_1002234792 166
262 3300005543 Ga0070672_100513638 Ga0070672_1005136381 166
263 3300005544 Ga0070686_100029149 Ga0070686_1000291492 166
264 3300005544 Ga0070686_100037356 Ga0070686_1000373563 166
265 3300005564 Ga0070664_100353655 Ga0070664_1003536552 166
266 3300005578 Ga0068854_100070505 Ga0068854_1000705052 166
267 3300005617 Ga0068859_100270316 Ga0068859_1002703162 166
268 3300005719 Ga0068861_100033380 Ga0068861_1000333803 166
269 3300005842 Ga0068858_100280117 Ga0068858_1002801172 166
270 3300005843 Ga0068860_100432741 Ga0068860_1004327412 166
271 3300005843 Ga0068860_100684724 Ga0068860_1006847242 166
272 3300006237 Ga0097621_100116794 Ga0097621_1001167942 166
273 3300006358 Ga0068871_100089891 Ga0068871_1000898912 166
274 3300006358 Ga0068871_100211492 Ga0068871_1002114922 166
275 3300006846 Ga0075430_100149126 Ga0075430_1001491261 166
276 3300006881 Ga0068865_100024156 Ga0068865_1000241566 166
277 3300006931 Ga0097620_100270331 Ga0097620_1002703312 166
278 3300006931 Ga0097620_100319830 Ga0097620_1003198302 166
279 3300009094 Ga0111539_11081049 Ga0111539_110810492 166
280 3300009101 Ga0105247_10131311 Ga0105247_101313112 166
281 3300009148 Ga0105243_10877193 Ga0105243_108771932 166
282 3300009148 Ga0105243_11115303 Ga0105243_111153032 166
283 3300009177 Ga0105248_10284303 Ga0105248_102843032 166
284 3300009553 Ga0105249_10539476 Ga0105249_105394763 166
285 3300011119 Ga0105246_11044526 Ga0105246_110445261 166
286 3300014326 Ga0157380_10056754 Ga0157380_100567544 166
287 3300014745 Ga0157377_10014587 Ga0157377_100145872 166
288 3300025893 Ga0207682_10010733 Ga0207682_100107332 166
289 3300025903 Ga0207680_10527041 Ga0207680_105270412 166
290 3300025907 Ga0207645_10005120 Ga0207645_100051203 166
291 3300025908 Ga0207643_10335672 Ga0207643_103356721 166
292 3300025912 Ga0207707_10454562 Ga0207707_104545622 166
293 3300025918 Ga0207662_10093548 Ga0207662_100935482 166
294 3300025923 Ga0207681_10024808 Ga0207681_100248082 166
295 3300025923 Ga0207681_10778878 Ga0207681_107788781 166
296 3300025926 Ga0207659_10063706 Ga0207659_100637062 166
297 3300025926 Ga0207659_10188994 Ga0207659_101889942 166
298 3300025926 Ga0207659_10305560 Ga0207659_103055602 166
299 3300025931 Ga0207644_10004157 Ga0207644_100041575 166
300 3300025934 Ga0207686_10046729 Ga0207686_100467292 166
301 3300025935 Ga0207709_10413188 Ga0207709_104131882 166
302 3300025936 Ga0207670_10737854 Ga0207670_107378542 166
303 3300025937 Ga0207669_10108875 Ga0207669_101088752 166
304 3300025937 Ga0207669_10253429 Ga0207669_102534291 166
305 3300025940 Ga0207691_10086995 Ga0207691_100869954 166
306 3300025941 Ga0207711_10163033 Ga0207711_101630332 166
307 3300025942 Ga0207689_10016858 Ga0207689_100168585 166
308 3300025960 Ga0207651_10026016 Ga0207651_100260164 166
309 3300025960 Ga0207651_10264174 Ga0207651_102641742 166
310 3300025972 Ga0207668_10595863 Ga0207668_105958632 166
311 3300025986 Ga0207658_10985333 Ga0207658_109853332 166
312 3300025986 Ga0207658_11356407 Ga0207658_113564072 166
313 3300026035 Ga0207703_10095736 Ga0207703_100957362 166
314 3300026075 Ga0207708_10003780 Ga0207708_100037805 166
315 3300026088 Ga0207641_10400358 Ga0207641_104003582 166
316 3300026089 Ga0207648_10004440 Ga0207648_1000444010 166
317 3300026089 Ga0207648_10538969 Ga0207648_105389692 166
318 3300026095 Ga0207676_10290312 Ga0207676_102903122 166
319 3300026116 Ga0207674_10647704 Ga0207674_106477042 166
320 3300026118 Ga0207675_100028731 Ga0207675_1000287312 166
321 3300026118 Ga0207675_100340353 Ga0207675_1003403532 166
322 3300026121 Ga0207683_10061989 Ga0207683_100619891 166
323 3300026121 Ga0207683_10873474 Ga0207683_108734742 166
324 3300027907 Ga0207428_10266016 Ga0207428_102660162 166
325 3300028380 Ga0268265_10861288 Ga0268265_108612882 166
326 3300028381 Ga0268264_10722997 Ga0268264_107229972 166
327 3300028381 Ga0268264_11041616 Ga0268264_110416162 166
328 3300032002 Ga0307416_102321715 Ga0307416_1023217151 166
329 3300037068 Ga0373925_0407438 Ga0373925_0407438_474_980 166
330 3300048912 Ga0496109_0506834 Ga0496109_0506834_309_815 166
331 3300049568 Ga0501031_0280537 Ga0501031_0280537_144_647 166
332 3300049572 Ga0501036_0025356 Ga0501036_0025356_3359_3862 166
333 3300049575 Ga0501039_0051689 Ga0501039_0051689_2300_2803 166
334 3300049577 Ga0501041_0113650 Ga0501041_0113650_239_742 166
335 3300049578 Ga0501042_0096911 Ga0501042_0096911_50_553 166
336 3300049580 Ga0501046_0086970 Ga0501046_0086970_1351_1854 166
337 3300049588 Ga0501072_0378358 Ga0501072_0378358_370_873 166
338 3300049590 Ga0501074_0052846 Ga0501074_0052846_2353_2856 166
339 3300049591 Ga0501075_0002170 Ga0501075_0002170_8432_8935 166
340 3300049741 Ga0501079_0023872 Ga0501079_0023872_286_789 166
341 3300049743 Ga0501081_0033307 Ga0501081_0033307_2201_2704 166
342 3300050511 nmdc:mga08y16_559956_c1 nmdc:mga08y16_559956_c1_336_839 166
343 3300050511 nmdc:mga08y16_79613_c1 nmdc:mga08y16_79613_c1_884_1417 166
344 3300054114 Ga0501084_0730626 Ga0501084_0730626_288_791 166
345 3300061734 Ga0530510_0158022 Ga0530510_0158022_379_882 166
346 3300061734 Ga0530510_0890975 Ga0530510_0890975_158_661 166
347 3300003693 Ga0032354_1160538 Ga0032354_11605381 167
348 3300005290 Ga0065712_10362784 Ga0065712_103627841 167
349 3300005293 Ga0065715_10409456 Ga0065715_104094561 167
350 3300005327 Ga0070658_10228520 Ga0070658_102285202 167
351 3300005331 Ga0070670_100444154 Ga0070670_1004441542 167
352 3300005334 Ga0068869_100400613 Ga0068869_1004006132 167
353 3300005340 Ga0070689_100080201 Ga0070689_1000802013 167
354 3300005343 Ga0070687_100243311 Ga0070687_1002433113 167
355 3300005354 Ga0070675_100148550 Ga0070675_1001485502 167
356 3300005354 Ga0070675_100402861 Ga0070675_1004028612 167
357 3300005356 Ga0070674_100078479 Ga0070674_1000784792 167
358 3300005356 Ga0070674_100085491 Ga0070674_1000854913 167
359 3300005367 Ga0070667_100598209 Ga0070667_1005982092 167
360 3300005434 Ga0070709_10003100 Ga0070709_100031009 167
361 3300005458 Ga0070681_11293904 Ga0070681_112939041 167
362 3300005459 Ga0068867_100250255 Ga0068867_1002502552 167
363 3300005530 Ga0070679_100551059 Ga0070679_1005510592 167
364 3300005543 Ga0070672_100120818 Ga0070672_1001208182 167
365 3300005564 Ga0070664_100866762 Ga0070664_1008667622 167
366 3300005618 Ga0068864_100989502 Ga0068864_1009895022 167
367 3300005844 Ga0068862_101058705 Ga0068862_1010587052 167
368 3300005985 Ga0081539_10159941 Ga0081539_101599412 167
369 3300006237 Ga0097621_100096387 Ga0097621_1000963872 167
370 3300006237 Ga0097621_100652024 Ga0097621_1006520241 167
371 3300006844 Ga0075428_100006280 Ga0075428_10000628013 167
372 3300006871 Ga0075434_100262828 Ga0075434_1002628283 167
373 3300009147 Ga0114129_11524196 Ga0114129_115241962 167
374 3300009553 Ga0105249_10318556 Ga0105249_103185562 167
375 3300009553 Ga0105249_10388544 Ga0105249_103885442 167
376 3300013104 Ga0157370_10506971 Ga0157370_105069711 167
377 3300013296 Ga0157374_10142197 Ga0157374_101421972 167
378 3300013308 Ga0157375_10838355 Ga0157375_108383552 167
379 3300014969 Ga0157376_10321442 Ga0157376_103214423 167
380 3300025906 Ga0207699_10015884 Ga0207699_100158844 167
381 3300025923 Ga0207681_10039323 Ga0207681_100393233 167
382 3300025923 Ga0207681_10987669 Ga0207681_109876691 167
383 3300025926 Ga0207659_10006225 Ga0207659_100062251 167
384 3300025933 Ga0207706_10911017 Ga0207706_109110171 167
385 3300025936 Ga0207670_10378750 Ga0207670_103787501 167
386 3300025940 Ga0207691_10154117 Ga0207691_101541172 167
387 3300025940 Ga0207691_10329726 Ga0207691_103297263 167
388 3300025942 Ga0207689_10360359 Ga0207689_103603592 167
389 3300025945 Ga0207679_10481815 Ga0207679_104818152 167
390 3300025960 Ga0207651_10420207 Ga0207651_104202071 167
391 3300025981 Ga0207640_11048437 Ga0207640_110484371 167
392 3300028379 Ga0268266_11943180 Ga0268266_119431801 167
393 3300028380 Ga0268265_10331123 Ga0268265_103311232 167
394 3300028380 Ga0268265_11432363 Ga0268265_114323632 167
395 3300031911 Ga0307412_10244115 Ga0307412_102441152 167
396 3300032004 Ga0307414_10098941 Ga0307414_100989412 167
397 3300035086 Ga0373934_0338459 Ga0373934_0338459_64_570 167
398 3300035089 Ga0373944_0119666 Ga0373944_0119666_336_842 167
399 3300035111 Ga0373923_0071212 Ga0373923_0071212_446_952 167
400 3300035113 Ga0373936_0195869 Ga0373936_0195869_338_844 167
401 3300035119 Ga0373956_0159430 Ga0373956_0159430_151_657 167
402 3300035171 Ga0373946_0122461 Ga0373946_0122461_228_734 167
403 3300035410 Ga0373924_0010264 Ga0373924_0010264_2601_3107 167
404 3300035692 Ga0373935_0077317 Ga0373935_0077317_1320_1826 167
405 3300035695 Ga0373927_0046317 Ga0373927_0046317_35_541 167
406 3300035724 Ga0373933_0034019 Ga0373933_0034019_2055_2561 167
407 3300035725 Ga0373947_0528679 Ga0373947_0528679_32_538 167
408 3300037068 Ga0373925_0160875 Ga0373925_0160875_64_570 167
409 3300042008 Ga0439450_000889 Ga0439450_000889_859_1365 167
410 3300046663 Ga0495635_0615813 Ga0495635_0615813_37_543 167
411 3300049742 Ga0501080_0356052 Ga0501080_0356052_25_531 167
412 3300050513 nmdc:mga0rr50_360128_c1 nmdc:mga0rr50_360128_c1_667_1179 167
413 3300005293 Ga0065715_10637425 Ga0065715_106374251 168
414 3300005295 Ga0065707_10347754 Ga0065707_103477542 168
415 3300005331 Ga0070670_100117322 Ga0070670_1001173223 168
416 3300005343 Ga0070687_100159786 Ga0070687_1001597862 168
417 3300005344 Ga0070661_100039282 Ga0070661_1000392827 168
418 3300005353 Ga0070669_100074475 Ga0070669_1000744753 168
419 3300005354 Ga0070675_100597646 Ga0070675_1005976463 168
420 3300005356 Ga0070674_100870565 Ga0070674_1008705652 168
421 3300005364 Ga0070673_100072044 Ga0070673_1000720447 168
422 3300005365 Ga0070688_100059811 Ga0070688_1000598112 168
423 3300005437 Ga0070710_10654775 Ga0070710_106547751 168
424 3300005471 Ga0070698_101257434 Ga0070698_1012574341 168
425 3300005543 Ga0070672_100040491 Ga0070672_1000404914 168
426 3300005577 Ga0068857_100153666 Ga0068857_1001536666 168
427 3300005840 Ga0068870_10280160 Ga0068870_102801602 168
428 3300005841 Ga0068863_100690952 Ga0068863_1006909521 168
429 3300005842 Ga0068858_100319433 Ga0068858_1003194332 168
430 3300006358 Ga0068871_100023640 Ga0068871_1000236401 168
431 3300006846 Ga0075430_100407542 Ga0075430_1004075422 168
432 3300006880 Ga0075429_100108355 Ga0075429_1001083552 168
433 3300009094 Ga0111539_10619580 Ga0111539_106195802 168
434 3300011119 Ga0105246_10514072 Ga0105246_105140721 168
435 3300013297 Ga0157378_10015960 Ga0157378_100159603 168
436 3300013306 Ga0163162_11277892 Ga0163162_112778921 168
437 3300014325 Ga0163163_10007402 Ga0163163_1000740212 168
438 3300014326 Ga0157380_10633440 Ga0157380_106334402 168
439 3300025908 Ga0207643_10328224 Ga0207643_103282242 168
440 3300025918 Ga0207662_10164625 Ga0207662_101646251 168
441 3300025920 Ga0207649_10141043 Ga0207649_101410432 168
442 3300025923 Ga0207681_10598263 Ga0207681_105982632 168
443 3300025925 Ga0207650_10008303 Ga0207650_100083033 168
444 3300025931 Ga0207644_11406544 Ga0207644_114065441 168
445 3300025933 Ga0207706_10367007 Ga0207706_103670072 168
446 3300025936 Ga0207670_10268042 Ga0207670_102680423 168
447 3300025937 Ga0207669_10324175 Ga0207669_103241752 168
448 3300025940 Ga0207691_10129135 Ga0207691_101291352 168
449 3300025960 Ga0207651_10013216 Ga0207651_100132166 168
450 3300026095 Ga0207676_10137579 Ga0207676_101375792 168
451 3300026121 Ga0207683_10344671 Ga0207683_103446712 168
452 3300028380 Ga0268265_11530201 Ga0268265_115302011 168
453 3300039437 Ga0436365_1567992 Ga0436365_1567992_505_1026 168
454 3300049576 Ga0501040_0543941 Ga0501040_0543941_35_583 168
455 3300049592 Ga0501076_0194456 Ga0501076_0194456_317_823 168
456 3300049592 Ga0501076_0319875 Ga0501076_0319875_585_1097 168
457 3300049744 Ga0501083_0922848 Ga0501083_0922848_21_527 168
458 3300050509 nmdc:mga0qj67_391437_c1 nmdc:mga0qj67_391437_c1_322_828 168
459 3300050510 nmdc:mga06r32_706084_c1 nmdc:mga06r32_706084_c1_187_693 168
460 3300050511 nmdc:mga08y16_501584_c1 nmdc:mga08y16_501584_c1_591_1097 168
461 3300002459 JGI24751J29686_10046709 JGI24751J29686_100467091 169
462 3300005288 Ga0065714_10171130 Ga0065714_101711302 169
463 3300005289 Ga0065704_10431499 Ga0065704_104314991 169
464 3300005290 Ga0065712_10076915 Ga0065712_100769153 169
465 3300005295 Ga0065707_10177611 Ga0065707_101776112 169
466 3300005328 Ga0070676_10130483 Ga0070676_101304832 169
467 3300005330 Ga0070690_100463406 Ga0070690_1004634062 169
468 3300005331 Ga0070670_100004657 Ga0070670_1000046575 169
469 3300005333 Ga0070677_10082849 Ga0070677_100828492 169
470 3300005335 Ga0070666_10132949 Ga0070666_101329491 169
471 3300005340 Ga0070689_100263952 Ga0070689_1002639521 169
472 3300005353 Ga0070669_100431996 Ga0070669_1004319962 169
473 3300005354 Ga0070675_100126282 Ga0070675_1001262822 169
474 3300005356 Ga0070674_101412161 Ga0070674_1014121611 169
475 3300005364 Ga0070673_100347021 Ga0070673_1003470212 169
476 3300005459 Ga0068867_100088701 Ga0068867_1000887012 169
477 3300005543 Ga0070672_100248880 Ga0070672_1002488802 169
478 3300005548 Ga0070665_101446636 Ga0070665_1014466361 169
479 3300005617 Ga0068859_100506800 Ga0068859_1005068001 169
480 3300005618 Ga0068864_100684233 Ga0068864_1006842331 169
481 3300005840 Ga0068870_10065360 Ga0068870_100653602 169
482 3300005844 Ga0068862_100155394 Ga0068862_1001553942 169
483 3300006871 Ga0075434_100569555 Ga0075434_1005695551 169
484 3300006881 Ga0068865_100127083 Ga0068865_1001270832 169
485 3300006931 Ga0097620_100506788 Ga0097620_1005067881 169
486 3300009094 Ga0111539_10205600 Ga0111539_102056002 169
487 3300009176 Ga0105242_10362698 Ga0105242_103626982 169
488 3300013306 Ga0163162_10287143 Ga0163162_102871431 169
489 3300013308 Ga0157375_10022547 Ga0157375_100225473 169
490 3300017792 Ga0163161_10310195 Ga0163161_103101952 169
491 3300025315 Ga0207697_10181949 Ga0207697_101819492 169
492 3300025893 Ga0207682_10136135 Ga0207682_101361351 169
493 3300025901 Ga0207688_10022695 Ga0207688_100226953 169
494 3300025907 Ga0207645_10011662 Ga0207645_100116622 169
495 3300025908 Ga0207643_10013928 Ga0207643_100139282 169
496 3300025916 Ga0207663_10706010 Ga0207663_107060102 169
497 3300025922 Ga0207646_10437071 Ga0207646_104370712 169
498 3300025926 Ga0207659_10033487 Ga0207659_100334872 169
499 3300025936 Ga0207670_10086705 Ga0207670_100867052 169
500 3300025940 Ga0207691_10026751 Ga0207691_100267512 169
501 3300025972 Ga0207668_10947617 Ga0207668_109476171 169
502 3300026075 Ga0207708_10049416 Ga0207708_100494161 169
503 3300026089 Ga0207648_10190889 Ga0207648_101908891 169
504 3300026116 Ga0207674_10357838 Ga0207674_103578382 169
505 3300026118 Ga0207675_100165904 Ga0207675_1001659042 169
506 3300026121 Ga0207683_10068505 Ga0207683_100685051 169
507 3300026121 Ga0207683_10822012 Ga0207683_108220122 169
508 3300028379 Ga0268266_11711544 Ga0268266_117115441 169
509 3300032002 Ga0307416_100979985 Ga0307416_1009799852 169
510 3300035172 Ga0373955_0080303 Ga0373955_0080303_784_1305 169
511 3300035725 Ga0373947_0479446 Ga0373947_0479446_182_703 169
512 3300046459 Ga0495629_0536806 Ga0495629_0536806_76_597 169
513 3300046492 Ga0495585_0474076 Ga0495585_0474076_56_565 169
514 3300046517 Ga0495630_0013012 Ga0495630_0013012_3724_4245 169
515 3300046522 Ga0495643_0005221 Ga0495643_0005221_6778_7287 169
516 3300046533 Ga0495640_0055542 Ga0495640_0055542_1036_1557 169
517 3300046536 Ga0495587_0125866 Ga0495587_0125866_660_1181 169
518 3300046543 Ga0495645_0083112 Ga0495645_0083112_361_882 169
519 3300046689 Ga0495613_0001316 Ga0495613_0001316_409_930 169
520 3300048088 Ga0495602_0417327 Ga0495602_0417327_179_691 169
521 3300050511 nmdc:mga08y16_637677_c1 nmdc:mga08y16_637677_c1_270_779 169
522 3300050512 nmdc:mga0n895_818270_c1 nmdc:mga0n895_818270_c1_253_765 169
523 3300053077 Ga0495601_0053665 Ga0495601_0053665_1861_2382 169
524 3300053085 Ga0495619_0002013 Ga0495619_0002013_2457_2978 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

72

176

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tpj-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.7311 44 157
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.726 44 161
5evh-assembly1.cif.gz_A-2 crystal structure of known function protein from kribbella flavida dsm 17836 0.7216 47 157
5l33-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.7174 44 162
4lc9-assembly1.cif.gz_B structural basis for regulation of human glucokinase by glucokinase regulatory protein 0.7142 113 150
ID Description Score Start End Superfamily
af_Q54TU4_103_417_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8165 113 147 2.115.10.20
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.726 44 161 3.10.450.50
af_Q80UG2_40_507_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7224 109 150 2.130.10.10
4lmiA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7127 44 168 3.10.450.50
4xdvE00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7125 22 158 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1Q7SBW7-F1-model_v4 SnoaL-like domain-containing protein 0.9719 40 161
AF-A0A3A5KWT3-F1-model_v4 SnoaL-like domain-containing protein 0.9627 51 158
AF-A0A2V7SUG6-F1-model_v4 SnoaL-like domain-containing protein 0.9334 21 163
AF-A0A1Q7SBW7-F1-model_v4 SnoaL-like domain-containing protein 0.9321 40 161
AF-T1W9K2-F1-model_v4 deleted 0.9299 20 163

Feature Viewer

pLDDT pTM Quality
87.36 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map