F459130

General Info

Members Datasets Scaffolds Average Seq Length
524 232 515 116

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10203167|Ga0157370_102031672
Length 123
Sequence MNDDKHGQTMSSPGAEITWADFEKIVIAAGTVTRVEAFPEARKPAWKLWVDFGPYGERKTSAQIAALYGAEELVGRQIVGVINFPEKQIGPFRSQFLLTGFATAQGVVITTLERPVPNGTRMT

Samples

Sample ID Description Type Environment
1 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
2 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
3 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
4 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
5 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
6 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
7 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
8 2928963466 Dyella japonica 1073 Isolate Unclassified
9 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
74 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
75 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
156 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.38
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.36
Nodule 0
Rhizoplane 2.86
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 10.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007799 3300001979 Bacteria 4323
2 JGI24739J22299_10000033 3300001989 Bacteria 38389
3 JGI24737J22298_10013123 3300001990 Bacteria 2699
4 JGI24737J22298_10021419 3300001990 Bacteria 2061
5 JGI25156J39149_1051552 3300002705 Bacteria 539
6 JGI25162J39368_1000807 3300002737 Bacteria 20744
7 JGI25162J39368_1001350 3300002737 Bacteria 13599
8 JGI25162J39368_1001755 3300002737 Bacteria 10338
9 JGI25157J39369_1001042 3300002741 Bacteria 12663
10 JGI25157J39369_1001056 3300002741 Bacteria 12500
11 JGI25157J39369_1009836 3300002741 Bacteria 1272
12 JGI25163J39215_1001074 3300002771 Bacteria 5739
13 JGI25164J39214_1000049 3300002772 Bacteria 123464
14 JGI25164J39214_1000313 3300002772 Bacteria 31898
15 JGI25164J39214_1001055 3300002772 Bacteria 8240
16 JGI25165J46597_1000009 3300003214 Bacteria 467965
17 JGI25165J46597_1001249 3300003214 Bacteria 15023
18 JGI25165J46597_1009148 3300003214 Bacteria 1507
19 JGI25165J46597_1016339 3300003214 Bacteria 996
20 JGI25153J46596_10010577 3300003215 Bacteria 4160
21 rootH1_10014550 3300003316 Bacteria 3415
22 rootH2_10125304 3300003320 Bacteria 1685
23 rootH2_10214389 3300003320 Bacteria 2550
24 rootH2_10222491 3300003320 Bacteria 1003
25 rootL2_10244164 3300003322 Bacteria 3422
26 Ga0055538_1001554 3300003751 Bacteria 4223
27 Ga0055539_1008633 3300003752 Bacteria 1273
28 Ga0055533_1001321 3300003756 Bacteria 6722
29 Ga0055527_1000329 3300003760 Bacteria 25482
30 Ga0055527_1012851 3300003760 Bacteria 941
31 Ga0055535_1000082 3300003761 Bacteria 106958
32 Ga0055535_1000621 3300003761 Bacteria 28838
33 Ga0055535_1000709 3300003761 Bacteria 25482
34 Ga0055542_1000151 3300003762 Bacteria 87857
35 Ga0055542_1000732 3300003762 Bacteria 25482
36 Ga0055542_1000882 3300003762 Bacteria 20744
37 Ga0055529_1000020 3300003763 Bacteria 324857
38 Ga0055529_1000643 3300003763 Bacteria 25482
39 Ga0055529_1002129 3300003763 Bacteria 4170
40 Ga0055530_10081420 3300003791 Bacteria 679
41 Ga0055531_10024457 3300003794 Bacteria 2228
42 Ga0065165_1008327 3300005262 Bacteria 4878
43 Ga0070658_10002748 3300005327 Bacteria 14650
44 Ga0070658_10135831 3300005327 Bacteria 2052
45 Ga0070658_10638668 3300005327 Bacteria 923
46 Ga0070683_101492413 3300005329 Bacteria 650
47 Ga0070666_10000003 3300005335 Bacteria 463666
48 Ga0070682_100003242 3300005337 Bacteria 9029
49 Ga0070682_100319903 3300005337 Bacteria 1145
50 Ga0070660_100097823 3300005339 Bacteria 2322
51 Ga0070660_100176126 3300005339 Bacteria 1730
52 Ga0070660_100468098 3300005339 Bacteria 1047
53 Ga0070661_100253535 3300005344 Bacteria 1359
54 Ga0070661_100530397 3300005344 Bacteria 945
55 Ga0070661_101080727 3300005344 Bacteria 668
56 Ga0070692_10100591 3300005345 Bacteria 1584
57 Ga0070668_100058952 3300005347 Bacteria 2971
58 Ga0070668_100084582 3300005347 Bacteria 2492
59 Ga0070668_100393917 3300005347 Unclassified 1181
60 Ga0070669_100277379 3300005353 Bacteria 1342
61 Ga0070671_100128118 3300005355 Bacteria 2137
62 Ga0070659_100004655 3300005366 Bacteria 9798
63 Ga0070659_100025540 3300005366 Bacteria 4539
64 Ga0070659_100218200 3300005366 Bacteria 1573
65 Ga0070659_100628625 3300005366 Bacteria 924
66 Ga0070659_101846942 3300005366 Bacteria 541
67 Ga0070667_100000090 3300005367 Bacteria 112981
68 Ga0070667_100073924 3300005367 Bacteria 2907
69 Ga0070714_100000068 3300005435 Bacteria 94765
70 Ga0070714_100044958 3300005435 Bacteria 3740
71 Ga0070710_10204700 3300005437 Bacteria 1248
72 Ga0070694_100108194 3300005444 Bacteria 1977
73 Ga0070663_100001470 3300005455 Bacteria 12959
74 Ga0070663_100658249 3300005455 Bacteria 886
75 Ga0070662_100234447 3300005457 Bacteria 1469
76 Ga0070662_100592297 3300005457 Bacteria 932
77 Ga0070681_10253313 3300005458 Bacteria 1673
78 Ga0068867_100446701 3300005459 Bacteria 1101
79 Ga0070679_100129545 3300005530 Bacteria 2505
80 Ga0068853_100000795 3300005539 Bacteria 21890
81 Ga0068853_100007996 3300005539 Bacteria 8482
82 Ga0068853_100122239 3300005539 Bacteria 2323
83 Ga0068853_100310484 3300005539 Bacteria 1460
84 Ga0068853_100557827 3300005539 Bacteria 1086
85 Ga0068853_101866436 3300005539 Bacteria 583
86 Ga0068853_102115948 3300005539 Bacteria 546
87 Ga0070696_101008472 3300005546 Bacteria 696
88 Ga0070665_100015364 3300005548 Bacteria 7688
89 Ga0070665_100063376 3300005548 Bacteria 3706
90 Ga0070665_100271289 3300005548 Bacteria 1698
91 Ga0070665_100900187 3300005548 Bacteria 897
92 Ga0070665_101956295 3300005548 Bacteria 592
93 Ga0068855_100006982 3300005563 Bacteria 13708
94 Ga0068855_100010376 3300005563 Bacteria 11238
95 Ga0068855_100035861 3300005563 Bacteria 5906
96 Ga0068855_100482344 3300005563 Bacteria 1349
97 Ga0068855_100534727 3300005563 Bacteria 1270
98 Ga0068855_100904024 3300005563 Bacteria 932
99 Ga0068855_101706820 3300005563 Bacteria 642
100 Ga0070664_100199995 3300005564 Bacteria 1783
101 Ga0068857_100000799 3300005577 Bacteria 23528
102 Ga0068857_100120856 3300005577 Bacteria 2358
103 Ga0068854_100000905 3300005578 Bacteria 17838
104 Ga0068854_100007293 3300005578 Bacteria 7063
105 Ga0068854_100497616 3300005578 Bacteria 1026
106 Ga0068854_100671601 3300005578 Bacteria 891
107 Ga0068856_100001223 3300005614 Bacteria 26898
108 Ga0068856_100038472 3300005614 Bacteria 4696
109 Ga0068856_100282002 3300005614 Bacteria 1678
110 Ga0068852_100068970 3300005616 Bacteria 3097
111 Ga0068851_10001583 3300005834 Bacteria 9986
112 Ga0068863_100439726 3300005841 Bacteria 1279
113 Ga0068858_100104061 3300005842 Bacteria 2649
114 Ga0068860_100393563 3300005843 Bacteria 1370
115 Ga0068860_101161603 3300005843 Bacteria 792
116 Ga0105240_10004700 3300009093 Bacteria 20645
117 Ga0105240_10019619 3300009093 Bacteria 9031
118 Ga0105240_10140729 3300009093 Bacteria 2885
119 Ga0105240_10149436 3300009093 Bacteria 2784
120 Ga0105241_10040077 3300009174 Bacteria 3535
121 Ga0105241_10941961 3300009174 Bacteria 804
122 Ga0105248_10074223 3300009177 Bacteria 3823
123 Ga0105248_10150983 3300009177 Bacteria 2621
124 Ga0105248_11409479 3300009177 Bacteria 788
125 Ga0105237_10000016 3300009545 Bacteria 256506
126 Ga0105237_10000345 3300009545 Bacteria 65477
127 Ga0105237_10000371 3300009545 Bacteria 63699
128 Ga0105237_10169593 3300009545 Bacteria 2182
129 Ga0105237_10392862 3300009545 Bacteria 1392
130 Ga0105238_10001660 3300009551 Bacteria 22345
131 Ga0105238_10009092 3300009551 Bacteria 9943
132 Ga0105238_10035682 3300009551 Bacteria 5054
133 Ga0105238_10113504 3300009551 Bacteria 2689
134 Ga0105238_10309338 3300009551 Bacteria 1565
135 Ga0105238_10531907 3300009551 Bacteria 1179
136 Ga0105238_10593886 3300009551 Bacteria 1115
137 Ga0105238_11968598 3300009551 Bacteria 618
138 Ga0105249_10003742 3300009553 Bacteria 13128
139 Ga0105239_10000063 3300010375 Bacteria 151845
140 Ga0105239_10121167 3300010375 Bacteria 2905
141 Ga0105239_10195692 3300010375 Bacteria 2264
142 Ga0105239_10706102 3300010375 Bacteria 1153
143 Ga0105239_12197853 3300010375 Bacteria 642
144 Ga0157314_1000404 3300012500 Bacteria 4355
145 Ga0157347_1006181 3300012502 Bacteria 1166
146 Ga0157339_1056366 3300012505 Bacteria 534
147 Ga0157373_10023464 3300013100 Bacteria 4472
148 Ga0157373_10103511 3300013100 Bacteria 2002
149 Ga0157373_10471023 3300013100 Bacteria 905
150 Ga0157371_10078870 3300013102 Bacteria 2333
151 Ga0157371_10081064 3300013102 Bacteria 2298
152 Ga0157370_10007514 3300013104 Bacteria 11841
153 Ga0157370_10018266 3300013104 Bacteria 7053
154 Ga0157370_10062160 3300013104 Bacteria 3542
155 Ga0157370_10200144 3300013104 Bacteria 1853
156 Ga0157370_10203167 3300013104 Bacteria 1838
157 Ga0157370_10427079 3300013104 Unclassified 1219
158 Ga0157370_10448563 3300013104 Bacteria 1186
159 Ga0157369_10014122 3300013105 Bacteria 9027
160 Ga0157369_10122787 3300013105 Bacteria 2755
161 Ga0157369_10640360 3300013105 Bacteria 1097
162 Ga0157369_10678711 3300013105 Bacteria 1061
163 Ga0157369_10726832 3300013105 Bacteria 1022
164 Ga0163162_10000532 3300013306 Bacteria 35291
165 Ga0157372_10538647 3300013307 Bacteria 1361
166 Ga0157372_11015924 3300013307 Bacteria 960
167 Ga0157372_11336230 3300013307 Bacteria 827
168 Ga0157372_11705253 3300013307 Bacteria 725
169 Ga0157372_12017477 3300013307 Bacteria 663
170 Ga0182008_10023932 3300014497 Bacteria 3113
171 Ga0182008_10088317 3300014497 Bacteria 1527
172 Ga0182008_10213764 3300014497 Bacteria 985
173 Ga0182006_1008631 3300015261 Bacteria 4616
174 Ga0182007_10008724 3300015262 Bacteria 4140
175 Ga0182007_10009117 3300015262 Bacteria 4032
176 Ga0182007_10040931 3300015262 Bacteria 1546
177 Ga0182007_10114430 3300015262 Bacteria 900
178 Ga0182007_10198418 3300015262 Bacteria 700
179 Ga0183368_1004 3300015687 Bacteria 1211761
180 Ga0206356_11568625 3300020070 Bacteria 3873
181 Ga0206353_11584667 3300020082 Bacteria 3657
182 Ga0209435_101084 3300025206 Bacteria 3777
183 Ga0209760_100481 3300025207 Bacteria 8558
184 Ga0209784_100013 3300025224 Bacteria 518664
185 Ga0209674_100026 3300025226 Bacteria 490631
186 Ga0209674_100062 3300025226 Bacteria 276316
187 Ga0209672_100017 3300025228 Bacteria 514236
188 Ga0209672_101880 3300025228 Bacteria 6177
189 Ga0207427_100073 3300025231 Bacteria 156503
190 Ga0207427_100229 3300025231 Bacteria 47034
191 Ga0207427_100396 3300025231 Bacteria 25810
192 Ga0209437_100012 3300025233 Bacteria 792625
193 Ga0209437_100039 3300025233 Bacteria 448321
194 Ga0209437_100129 3300025233 Bacteria 184661
195 Ga0209258_100019 3300025242 Bacteria 566728
196 Ga0209258_100213 3300025242 Bacteria 115394
197 Ga0209258_100272 3300025242 Bacteria 88382
198 Ga0209258_101145 3300025242 Bacteria 10883
199 Ga0209646_1000735 3300025246 Bacteria 11511
200 Ga0209646_1002693 3300025246 Bacteria 3804
201 Ga0209026_1000125 3300025250 Bacteria 124729
202 Ga0209026_1000207 3300025250 Bacteria 81332
203 Ga0209677_101574 3300025253 Bacteria 9683
204 Ga0209148_1000001 3300025254 Bacteria 2545271
205 Ga0209148_1000009 3300025254 Bacteria 1395625
206 Ga0209148_1000185 3300025254 Bacteria 118117
207 Ga0209759_1000595 3300025256 Bacteria 35053
208 Ga0209759_1003876 3300025256 Bacteria 5779
209 Ga0209129_1002584 3300025258 Bacteria 8697
210 Ga0209233_1000002 3300025261 Bacteria 2501366
211 Ga0209233_1000020 3300025261 Bacteria 798224
212 Ga0209233_1000090 3300025261 Bacteria 315680
213 Ga0209233_1022045 3300025261 Bacteria 1637
214 Ga0209455_1000027 3300025272 Bacteria 566710
215 Ga0209455_1000032 3300025272 Bacteria 514243
216 Ga0209455_1000535 3300025272 Bacteria 26363
217 Ga0209455_1003416 3300025272 Bacteria 5626
218 Ga0209758_1001236 3300025297 Bacteria 31915
219 Ga0209758_1015642 3300025297 Bacteria 3913
220 Ga0209050_1038478 3300025298 Bacteria 1363
221 Ga0209051_1023642 3300025303 Bacteria 2549
222 Ga0209257_1000179 3300025304 Bacteria 158484
223 Ga0207656_10001923 3300025321 Bacteria 6910
224 Ga0207692_10726804 3300025898 Bacteria 646
225 Ga0207680_10000006 3300025903 Bacteria 635950
226 Ga0207680_10933683 3300025903 Bacteria 622
227 Ga0207647_10002923 3300025904 Bacteria 12866
228 Ga0207647_10025409 3300025904 Bacteria 3892
229 Ga0207647_10052653 3300025904 Bacteria 2512
230 Ga0207647_10054149 3300025904 Bacteria 2469
231 Ga0207705_10004426 3300025909 Bacteria 10619
232 Ga0207705_10170764 3300025909 Bacteria 1637
233 Ga0207705_10299090 3300025909 Bacteria 1234
234 Ga0207654_10049669 3300025911 Bacteria 2407
235 Ga0207654_10383024 3300025911 Bacteria 974
236 Ga0207707_10233465 3300025912 Bacteria 1600
237 Ga0207695_10000405 3300025913 Bacteria 96061
238 Ga0207695_10000493 3300025913 Bacteria 84173
239 Ga0207695_10002440 3300025913 Bacteria 27479
240 Ga0207695_10005605 3300025913 Bacteria 16583
241 Ga0207695_10114722 3300025913 Bacteria 2668
242 Ga0207671_10000137 3300025914 Bacteria 112029
243 Ga0207671_10000490 3300025914 Bacteria 53783
244 Ga0207671_10001184 3300025914 Bacteria 31016
245 Ga0207671_10047325 3300025914 Bacteria 3183
246 Ga0207671_10589551 3300025914 Bacteria 886
247 Ga0207657_10070116 3300025919 Bacteria 2972
248 Ga0207657_10714954 3300025919 Bacteria 777
249 Ga0207649_10132794 3300025920 Bacteria 1693
250 Ga0207649_10385391 3300025920 Bacteria 1046
251 Ga0207652_10825962 3300025921 Bacteria 822
252 Ga0207694_10000438 3300025924 Bacteria 38673
253 Ga0207694_10050013 3300025924 Bacteria 3236
254 Ga0207694_10131526 3300025924 Bacteria 2006
255 Ga0207694_10201754 3300025924 Bacteria 1618
256 Ga0207664_10000056 3300025929 Bacteria 125763
257 Ga0207664_10004243 3300025929 Bacteria 9692
258 Ga0207644_10743333 3300025931 Bacteria 819
259 Ga0207690_10001320 3300025932 Bacteria 15606
260 Ga0207690_10072858 3300025932 Bacteria 2373
261 Ga0207690_10136541 3300025932 Bacteria 1801
262 Ga0207690_10530352 3300025932 Bacteria 955
263 Ga0207690_10805869 3300025932 Bacteria 776
264 Ga0207706_10066673 3300025933 Bacteria 3168
265 Ga0207706_10128099 3300025933 Bacteria 2232
266 Ga0207711_10001221 3300025941 Bacteria 24350
267 Ga0207711_10087318 3300025941 Bacteria 2736
268 Ga0207661_11249758 3300025944 Bacteria 683
269 Ga0207679_10249687 3300025945 Bacteria 1508
270 Ga0207667_10001885 3300025949 Bacteria 26382
271 Ga0207667_10002174 3300025949 Bacteria 24585
272 Ga0207667_10033011 3300025949 Bacteria 5570
273 Ga0207667_10046572 3300025949 Bacteria 4592
274 Ga0207667_10053720 3300025949 Bacteria 4238
275 Ga0207667_10143554 3300025949 Bacteria 2457
276 Ga0207667_10619864 3300025949 Bacteria 1090
277 Ga0207667_10836558 3300025949 Bacteria 915
278 Ga0207712_10004404 3300025961 Bacteria 8901
279 Ga0207668_10001027 3300025972 Bacteria 16669
280 Ga0207668_10233282 3300025972 Unclassified 1485
281 Ga0207640_10000408 3300025981 Bacteria 27247
282 Ga0207640_10017160 3300025981 Bacteria 4229
283 Ga0207640_10095783 3300025981 Bacteria 2068
284 Ga0207640_10154610 3300025981 Bacteria 1689
285 Ga0207640_10643045 3300025981 Bacteria 903
286 Ga0207658_10000111 3300025986 Bacteria 89180
287 Ga0207658_10338296 3300025986 Bacteria 1307
288 Ga0207658_11636910 3300025986 Bacteria 588
289 Ga0207703_10190969 3300026035 Bacteria 1814
290 Ga0207703_10927014 3300026035 Bacteria 834
291 Ga0207639_10070671 3300026041 Bacteria 2727
292 Ga0207639_10081698 3300026041 Bacteria 2560
293 Ga0207639_10445954 3300026041 Bacteria 1174
294 Ga0207639_10801587 3300026041 Bacteria 878
295 Ga0207639_10901975 3300026041 Bacteria 826
296 Ga0207678_10004034 3300026067 Bacteria 13211
297 Ga0207678_10006781 3300026067 Bacteria 10151
298 Ga0207678_10036117 3300026067 Bacteria 4301
299 Ga0207702_10000104 3300026078 Bacteria 98370
300 Ga0207702_10001817 3300026078 Bacteria 21006
301 Ga0207702_10270493 3300026078 Bacteria 1603
302 Ga0207702_11643926 3300026078 Bacteria 635
303 Ga0207641_10723968 3300026088 Bacteria 981
304 Ga0207674_10000818 3300026116 Bacteria 40463
305 Ga0207674_10021120 3300026116 Bacteria 7019
306 Ga0207674_11228141 3300026116 Bacteria 719
307 Ga0207698_10300123 3300026142 Bacteria 1495
308 Ga0268266_10000043 3300028379 Bacteria 316604
309 Ga0268266_10499300 3300028379 Bacteria 1161
310 Ga0268265_10057018 3300028380 Bacteria 2975
311 Ga0268264_11087416 3300028381 Bacteria 808
312 Ga0316575_10038066 3300031665 Bacteria 1896
313 Ga0307510_10081293 3300033180 Bacteria 3142
314 Ga0307510_10131138 3300033180 Bacteria 2179
315 Ga0395899_0000169 3300037312 Bacteria 100056
316 Ga0395899_0013443 3300037312 Bacteria 6262
317 Ga0395900_0000069 3300037418 Bacteria 190578
318 Ga0395900_0727778 3300037418 Bacteria 924
319 Ga0395900_1903390 3300037418 Bacteria 505
320 Ga0395898_0000097 3300037466 Bacteria 230579
321 Ga0395898_0001110 3300037466 Bacteria 41435
322 Ga0395901_0006786 3300038443 Bacteria 11563
323 Ga0395901_0165305 3300038443 Bacteria 2323
324 Ga0395901_0426482 3300038443 Bacteria 1359
325 Ga0395901_1577098 3300038443 Bacteria 610
326 Ga0451787_564197 3300041441 Bacteria 1050
327 Ga0451789_0550781 3300041443 Bacteria 530
328 Ga0451797_0108775 3300041453 Bacteria 1909
329 Ga0451798_0155906 3300041458 Bacteria 617
330 Ga0451798_0969286 3300041458 Bacteria 511
331 Ga0451800_0435905 3300041459 Bacteria 712
332 Ga0451807_1077082 3300041486 Bacteria 1631
333 Ga0451837_1232363 3300041494 Bacteria 512
334 Ga0451837_1258977 3300041494 Bacteria 1301
335 Ga0451837_1622034 3300041494 Bacteria 1736
336 Ga0451841_1204303 3300041498 Bacteria 761
337 Ga0439448_0048718 3300042005 Bacteria 1384
338 Ga0439448_0180373 3300042005 Bacteria 738
339 Ga0466969_0010009 3300044656 Bacteria 5028
340 Ga0466969_0015993 3300044656 Bacteria 3931
341 Ga0466969_0027761 3300044656 Bacteria 2897
342 Ga0466969_0125910 3300044656 Bacteria 1190
343 Ga0466972_0031219 3300044658 Bacteria 2621
344 Ga0466972_0435337 3300044658 Bacteria 615
345 Ga0466982_0000002 3300044672 Bacteria 454900
346 Ga0466965_0016024 3300044683 Bacteria 3561
347 Ga0466966_0002617 3300044684 Bacteria 11792
348 Ga0466966_0025957 3300044684 Bacteria 3826
349 Ga0466966_0074862 3300044684 Bacteria 2115
350 Ga0466966_0148684 3300044684 Bacteria 1429
351 Ga0466961_0001299 3300044693 Bacteria 15419
352 Ga0466961_0003971 3300044693 Bacteria 9254
353 Ga0466961_0007582 3300044693 Bacteria 6910
354 Ga0466964_0006645 3300044706 Bacteria 4310
355 Ga0466971_0022289 3300044719 Bacteria 2821
356 Ga0466968_0135008 3300044735 Bacteria 1125
357 Ga0466970_0009863 3300044765 Bacteria 4836
358 Ga0466970_0025468 3300044765 Bacteria 3097
359 Ga0466970_0576436 3300044765 Bacteria 651
360 Ga0466957_0005568 3300044842 Bacteria 7077
361 Ga0466960_0002860 3300044901 Bacteria 6541
362 Ga0466959_0000198 3300045049 Bacteria 39567
363 Ga0466959_0062727 3300045049 Bacteria 2700
364 Ga0466959_0196778 3300045049 Bacteria 1404
365 Ga0466959_0220648 3300045049 Bacteria 1315
366 Ga0466959_0330022 3300045049 Bacteria 1042
367 Ga0466958_0004503 3300045836 Bacteria 7363
368 Ga0466958_0006900 3300045836 Bacteria 6210
369 Ga0466958_0044615 3300045836 Bacteria 2672
370 Ga0466967_0178341 3300045976 Bacteria 2002
371 Ga0495650_0000353 3300046471 Bacteria 81130
372 Ga0495650_0029678 3300046471 Bacteria 2489
373 Ga0495650_0110694 3300046471 Bacteria 1020
374 Ga0495584_0002455 3300046491 Bacteria 10510
375 Ga0495585_0016140 3300046492 Bacteria 4328
376 Ga0495606_0000937 3300046507 Bacteria 42986
377 Ga0495606_0017318 3300046507 Bacteria 5453
378 Ga0495616_0000085 3300046513 Bacteria 79620
379 Ga0495683_0012969 3300047323 Bacteria 4367
380 Ga0495686_0003987 3300047472 Bacteria 12356
381 Ga0495686_0016589 3300047472 Bacteria 4992
382 Ga0496100_0075174 3300048903 Bacteria 2265
383 Ga0496101_0134473 3300048904 Bacteria 1880
384 Ga0496104_0320610 3300048907 Bacteria 1462
385 Ga0496105_0375403 3300048908 Bacteria 1132
386 Ga0496113_0525903 3300048916 Bacteria 949
387 Ga0496113_0612012 3300048916 Bacteria 872
388 Ga0496115_0000505 3300048918 Bacteria 30593
389 Ga0496115_0040871 3300048918 Bacteria 3688
390 Ga0496117_0007917 3300048920 Bacteria 10212
391 Ga0496117_0043569 3300048920 Bacteria 3261
392 Ga0496117_0056002 3300048920 Bacteria 2750
393 Ga0496117_0122736 3300048920 Bacteria 1592
394 Ga0496118_0000677 3300048921 Bacteria 55423
395 Ga0496118_0001754 3300048921 Bacteria 31454
396 Ga0496118_0009342 3300048921 Bacteria 9935
397 Ga0496118_0016257 3300048921 Bacteria 6834
398 Ga0496118_0630851 3300048921 Bacteria 507
399 Ga0496119_0000184 3300048922 Bacteria 87765
400 Ga0496120_0000719 3300048923 Bacteria 48509
401 Ga0496121_0006838 3300048924 Bacteria 13949
402 Ga0496121_0009095 3300048924 Bacteria 11496
403 Ga0496121_0121849 3300048924 Bacteria 1968
404 Ga0496121_0184807 3300048924 Bacteria 1500
405 Ga0496121_0243495 3300048924 Bacteria 1251
406 Ga0496121_0580195 3300048924 Bacteria 696
407 Ga0496122_0000129 3300048925 Bacteria 173688
408 Ga0496123_0000113 3300048926 Bacteria 163689
409 Ga0496125_0000479 3300048928 Bacteria 70840
410 Ga0496125_0445116 3300048928 Bacteria 744
411 Ga0496126_0005763 3300048929 Bacteria 14010
412 Ga0496126_0084867 3300048929 Bacteria 2793
413 Ga0496126_0141634 3300048929 Bacteria 2069
414 Ga0496126_0436172 3300048929 Bacteria 1057
415 Ga0501031_0017717 3300049568 Bacteria 4631
416 Ga0501031_0038579 3300049568 Bacteria 3117
417 Ga0501031_0888014 3300049568 Bacteria 571
418 Ga0501032_0008569 3300049569 Bacteria 7456
419 Ga0501032_0023594 3300049569 Bacteria 4246
420 Ga0501032_0050822 3300049569 Bacteria 2795
421 Ga0501032_0096231 3300049569 Bacteria 1962
422 Ga0501033_0002102 3300049570 Bacteria 17249
423 Ga0501033_0011309 3300049570 Bacteria 6833
424 Ga0501033_0223467 3300049570 Bacteria 1339
425 Ga0501033_0574945 3300049570 Bacteria 774
426 Ga0501033_0764583 3300049570 Bacteria 655
427 Ga0501034_0000996 3300049571 Bacteria 40586
428 Ga0501034_0007828 3300049571 Bacteria 11365
429 Ga0501034_0049233 3300049571 Bacteria 4252
430 Ga0501034_0129136 3300049571 Bacteria 2511
431 Ga0501036_0019131 3300049572 Bacteria 5745
432 Ga0501036_0163002 3300049572 Bacteria 1879
433 Ga0501036_1359202 3300049572 Bacteria 576
434 Ga0501037_0004446 3300049573 Bacteria 10181
435 Ga0501037_0007587 3300049573 Bacteria 7941
436 Ga0501037_0029753 3300049573 Bacteria 4034
437 Ga0501038_0001697 3300049574 Bacteria 20435
438 Ga0501038_0050881 3300049574 Bacteria 3578
439 Ga0501038_0150103 3300049574 Bacteria 1900
440 Ga0501038_0277764 3300049574 Bacteria 1319
441 Ga0501039_0010391 3300049575 Bacteria 7095
442 Ga0501039_0012497 3300049575 Bacteria 6484
443 Ga0501039_0056275 3300049575 Bacteria 3046
444 Ga0501040_0037069 3300049576 Bacteria 3311
445 Ga0501043_0001923 3300049579 Bacteria 17777
446 Ga0501043_0036413 3300049579 Bacteria 3871
447 Ga0501043_0225476 3300049579 Bacteria 1448
448 Ga0501046_0000711 3300049580 Bacteria 32113
449 Ga0501046_0008834 3300049580 Bacteria 8752
450 Ga0501046_0021868 3300049580 Bacteria 5272
451 Ga0501046_0024525 3300049580 Bacteria 4945
452 Ga0501046_0191696 3300049580 Bacteria 1524
453 Ga0501047_0044957 3300049581 Bacteria 4268
454 Ga0501047_0094860 3300049581 Bacteria 2862
455 Ga0501047_0204447 3300049581 Bacteria 1834
456 Ga0501047_0272623 3300049581 Bacteria 1538
457 Ga0501047_0710652 3300049581 Bacteria 822
458 Ga0501047_1234180 3300049581 Bacteria 561
459 Ga0501048_0038677 3300049582 Bacteria 3423
460 Ga0501048_0127233 3300049582 Bacteria 1801
461 Ga0501048_0569096 3300049582 Bacteria 813
462 Ga0501067_0010924 3300049583 Bacteria 5026
463 Ga0501068_0028147 3300049584 Bacteria 3321
464 Ga0501069_0108078 3300049585 Bacteria 1582
465 Ga0501069_0225534 3300049585 Bacteria 1090
466 Ga0501070_0039815 3300049586 Bacteria 3919
467 Ga0501070_0122133 3300049586 Bacteria 2152
468 Ga0501070_0456302 3300049586 Bacteria 1030
469 Ga0501070_1220463 3300049586 Unclassified 576
470 Ga0501072_0144392 3300049588 Bacteria 1898
471 Ga0501072_0293085 3300049588 Bacteria 1293
472 Ga0501073_0029339 3300049589 Bacteria 3931
473 Ga0501073_0083776 3300049589 Bacteria 2218
474 Ga0501074_0008690 3300049590 Bacteria 7360
475 Ga0501074_0061280 3300049590 Bacteria 2710
476 Ga0501076_0422386 3300049592 Bacteria 1097
477 Ga0501079_0084719 3300049741 Bacteria 2452
478 Ga0501080_0046617 3300049742 Bacteria 4034
479 Ga0501080_0111924 3300049742 Bacteria 2530
480 Ga0501080_0114548 3300049742 Bacteria 2500
481 Ga0501080_0427326 3300049742 Bacteria 1189
482 Ga0501080_0678103 3300049742 Bacteria 910
483 Ga0501080_1758258 3300049742 Bacteria 522
484 Ga0501081_0035222 3300049743 Bacteria 3407
485 Ga0501083_0208989 3300049744 Bacteria 1273
486 Ga0501083_0607486 3300049744 Bacteria 712
487 Ga0501035_0005012 3300049822 Bacteria 12540
488 Ga0501035_0005378 3300049822 Bacteria 12108
489 Ga0501035_0023870 3300049822 Bacteria 5611
490 Ga0501035_0037869 3300049822 Bacteria 4365
491 Ga0501035_0598420 3300049822 Bacteria 899
492 Ga0501044_0005271 3300049823 Bacteria 14380
493 Ga0501044_0006764 3300049823 Bacteria 12636
494 Ga0501044_0039474 3300049823 Bacteria 4925
495 Ga0501044_0040398 3300049823 Bacteria 4861
496 Ga0501044_0204017 3300049823 Bacteria 1934
497 Ga0501044_0240740 3300049823 Bacteria 1753
498 Ga0501044_0794008 3300049823 Bacteria 826
499 Ga0501044_0899289 3300049823 Bacteria 760
500 Ga0501044_1198637 3300049823 Bacteria 627
501 Ga0501045_0083512 3300049824 Bacteria 2356
502 Ga0500646_0019194 3300053090 Bacteria 1807
503 Ga0500651_0000070 3300053093 Bacteria 67252
504 Ga0500651_0007394 3300053093 Bacteria 6414
505 Ga0500597_000038 3300053120 Bacteria 26399
506 Ga0500568_0001067 3300053139 Bacteria 18606
507 Ga0500638_068598 3300053162 Bacteria 1697
508 Ga0501084_0315907 3300054114 Bacteria 1319
509 Ga0501084_1281996 3300054114 Unclassified 614
510 Ga0500661_000953 3300055283 Bacteria 5412
511 Ga0501082_0081779 3300060353 Bacteria 2787
512 Ga0501082_0300596 3300060353 Bacteria 1397
513 Ga0466962_0002198 3300061719 Bacteria 9225
514 Ga0466962_0053717 3300061719 Bacteria 1925
515 Ga0530510_0451399 3300061734 Bacteria 972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2818991440 2819565145 107
2 iso_pu_bacteria 2904463128 2904466813 107
3 3300003320 rootH2_10214389 rootH2_102143893 110
4 3300005327 Ga0070658_10002748 Ga0070658_100027485 110
5 3300005335 Ga0070666_10000003 Ga0070666_1000000347 110
6 3300005344 Ga0070661_101080727 Ga0070661_1010807272 110
7 3300005347 Ga0070668_100058952 Ga0070668_1000589522 110
8 3300005347 Ga0070668_100084582 Ga0070668_1000845822 110
9 3300005347 Ga0070668_100393917 Ga0070668_1003939172 110
10 3300005353 Ga0070669_100277379 Ga0070669_1002773793 110
11 3300005355 Ga0070671_100128118 Ga0070671_1001281182 110
12 3300005367 Ga0070667_100073924 Ga0070667_1000739242 110
13 3300005459 Ga0068867_100446701 Ga0068867_1004467012 110
14 3300005539 Ga0068853_100000795 Ga0068853_1000007959 110
15 3300005548 Ga0070665_100063376 Ga0070665_1000633765 110
16 3300005548 Ga0070665_100271289 Ga0070665_1002712893 110
17 3300005563 Ga0068855_100035861 Ga0068855_1000358614 110
18 3300005577 Ga0068857_100120856 Ga0068857_1001208562 110
19 3300005843 Ga0068860_100393563 Ga0068860_1003935632 110
20 3300005843 Ga0068860_101161603 Ga0068860_1011616032 110
21 3300009177 Ga0105248_10150983 Ga0105248_101509833 110
22 3300009551 Ga0105238_10001660 Ga0105238_1000166015 110
23 3300009551 Ga0105238_10593886 Ga0105238_105938862 110
24 3300013104 Ga0157370_10200144 Ga0157370_102001443 110
25 3300013306 Ga0163162_10000532 Ga0163162_1000053232 110
26 3300025303 Ga0209051_1023642 Ga0209051_10236424 110
27 3300025903 Ga0207680_10000006 Ga0207680_10000006192 110
28 3300025909 Ga0207705_10004426 Ga0207705_100044262 110
29 3300025924 Ga0207694_10000438 Ga0207694_1000043817 110
30 3300025931 Ga0207644_10743333 Ga0207644_107433332 110
31 3300025941 Ga0207711_10087318 Ga0207711_100873183 110
32 3300025949 Ga0207667_10046572 Ga0207667_100465722 110
33 3300025972 Ga0207668_10001027 Ga0207668_100010273 110
34 3300025972 Ga0207668_10233282 Ga0207668_102332822 110
35 3300025981 Ga0207640_10643045 Ga0207640_106430453 110
36 3300025986 Ga0207658_10338296 Ga0207658_103382961 110
37 3300026116 Ga0207674_10021120 Ga0207674_100211203 110
38 3300028379 Ga0268266_10000043 Ga0268266_10000043147 110
39 3300028380 Ga0268265_10057018 Ga0268265_100570182 110
40 3300028381 Ga0268264_11087416 Ga0268264_110874162 110
41 3300033180 Ga0307510_10081293 Ga0307510_100812933 110
42 3300033180 Ga0307510_10131138 Ga0307510_101311382 110
43 3300044658 Ga0466972_0031219 Ga0466972_0031219_1400_1732 110
44 3300044684 Ga0466966_0148684 Ga0466966_0148684_919_1254 110
45 3300045049 Ga0466959_0196778 Ga0466959_0196778_22_354 110
46 3300045049 Ga0466959_0330022 Ga0466959_0330022_65_400 110
47 3300045836 Ga0466958_0044615 Ga0466958_0044615_125_460 110
48 3300046471 Ga0495650_0000353 Ga0495650_0000353_18143_18478 110
49 3300046471 Ga0495650_0029678 Ga0495650_0029678_265_600 110
50 3300046471 Ga0495650_0110694 Ga0495650_0110694_382_717 110
51 3300046491 Ga0495584_0002455 Ga0495584_0002455_1556_1891 110
52 3300046492 Ga0495585_0016140 Ga0495585_0016140_3024_3359 110
53 3300046507 Ga0495606_0000937 Ga0495606_0000937_38443_38778 110
54 3300046513 Ga0495616_0000085 Ga0495616_0000085_38825_39160 110
55 3300047323 Ga0495683_0012969 Ga0495683_0012969_2658_2993 110
56 3300047472 Ga0495686_0003987 Ga0495686_0003987_5055_5390 110
57 3300048920 Ga0496117_0122736 Ga0496117_0122736_924_1256 110
58 3300048921 Ga0496118_0000677 Ga0496118_0000677_12980_13312 110
59 3300048924 Ga0496121_0009095 Ga0496121_0009095_4605_4940 110
60 3300048924 Ga0496121_0184807 Ga0496121_0184807_944_1279 110
61 3300048929 Ga0496126_0141634 Ga0496126_0141634_1712_2047 110
62 3300049568 Ga0501031_0017717 Ga0501031_0017717_3287_3619 110
63 3300049569 Ga0501032_0008569 Ga0501032_0008569_2335_2667 110
64 3300049570 Ga0501033_0002102 Ga0501033_0002102_1710_2042 110
65 3300049571 Ga0501034_0000996 Ga0501034_0000996_127_459 110
66 3300049573 Ga0501037_0004446 Ga0501037_0004446_3300_3632 110
67 3300049574 Ga0501038_0001697 Ga0501038_0001697_9592_9924 110
68 3300049575 Ga0501039_0012497 Ga0501039_0012497_428_760 110
69 3300049579 Ga0501043_0001923 Ga0501043_0001923_11723_12055 110
70 3300049580 Ga0501046_0000711 Ga0501046_0000711_28467_28799 110
71 3300049581 Ga0501047_0094860 Ga0501047_0094860_2335_2667 110
72 3300049582 Ga0501048_0038677 Ga0501048_0038677_463_795 110
73 3300049586 Ga0501070_0456302 Ga0501070_0456302_75_407 110
74 3300049742 Ga0501080_0427326 Ga0501080_0427326_102_434 110
75 3300049822 Ga0501035_0005378 Ga0501035_0005378_5598_5930 110
76 3300049823 Ga0501044_0006764 Ga0501044_0006764_3527_3859 110
77 3300053090 Ga0500646_0019194 Ga0500646_0019194_530_865 110
78 iso_pu_bacteria 2687453130 2687583239 110
79 3300041453 Ga0451797_0108775 Ga0451797_0108775_866_1201 111
80 3300041486 Ga0451807_1077082 Ga0451807_1077082_1106_1441 111
81 3300041494 Ga0451837_1232363 Ga0451837_1232363_148_483 111
82 3300046507 Ga0495606_0017318 Ga0495606_0017318_3220_3555 111
83 iso_pu_bacteria 2895395659 2895395713 111
84 iso_pu_bacteria 2939611941 2939612015 111
85 3300005327 Ga0070658_10135831 Ga0070658_101358313 112
86 3300005329 Ga0070683_101492413 Ga0070683_1014924132 112
87 3300013104 Ga0157370_10203167 Ga0157370_102031672 112
88 3300025909 Ga0207705_10299090 Ga0207705_102990902 112
89 3300025944 Ga0207661_11249758 Ga0207661_112497582 112
90 3300041441 Ga0451787_564197 Ga0451787_564197_521_865 112
91 3300041498 Ga0451841_1204303 Ga0451841_1204303_183_521 112
92 3300045976 Ga0466967_0178341 Ga0466967_0178341_1596_1934 112
93 3300049568 Ga0501031_0888014 Ga0501031_0888014_13_357 112
94 3300049569 Ga0501032_0050822 Ga0501032_0050822_630_1001 112
95 3300049570 Ga0501033_0764583 Ga0501033_0764583_194_565 112
96 3300049571 Ga0501034_0129136 Ga0501034_0129136_1826_2197 112
97 3300049574 Ga0501038_0277764 Ga0501038_0277764_188_559 112
98 3300049579 Ga0501043_0036413 Ga0501043_0036413_265_636 112
99 3300049580 Ga0501046_0008834 Ga0501046_0008834_1308_1679 112
100 3300053093 Ga0500651_0007394 Ga0500651_0007394_872_1210 112
101 3300053162 Ga0500638_068598 Ga0500638_068598_825_1163 112
102 3300055283 Ga0500661_000953 Ga0500661_000953_4288_4626 112
103 iso_pu_bacteria 2643221577 2643894387 112
104 iso_pu_bacteria 2643221685 2644476591 112
105 3300005367 Ga0070667_100000090 Ga0070667_10000009012 114
106 3300005435 Ga0070714_100044958 Ga0070714_1000449582 114
107 3300005437 Ga0070710_10204700 Ga0070710_102047002 114
108 3300005455 Ga0070663_100001470 Ga0070663_10000147011 114
109 3300005539 Ga0068853_100007996 Ga0068853_1000079963 114
110 3300005841 Ga0068863_100439726 Ga0068863_1004397262 114
111 3300009177 Ga0105248_10074223 Ga0105248_100742232 114
112 3300009545 Ga0105237_10000345 Ga0105237_1000034522 114
113 3300009551 Ga0105238_10531907 Ga0105238_105319072 114
114 3300009553 Ga0105249_10003742 Ga0105249_100037423 114
115 3300010375 Ga0105239_10706102 Ga0105239_107061022 114
116 3300013104 Ga0157370_10007514 Ga0157370_100075149 114
117 3300014497 Ga0182008_10088317 Ga0182008_100883171 114
118 3300014497 Ga0182008_10213764 Ga0182008_102137642 114
119 3300015261 Ga0182006_1008631 Ga0182006_10086312 114
120 3300015262 Ga0182007_10009117 Ga0182007_100091175 114
121 3300015262 Ga0182007_10114430 Ga0182007_101144302 114
122 3300025898 Ga0207692_10726804 Ga0207692_107268041 114
123 3300025914 Ga0207671_10001184 Ga0207671_100011844 114
124 3300025929 Ga0207664_10004243 Ga0207664_100042439 114
125 3300025941 Ga0207711_10001221 Ga0207711_1000122111 114
126 3300025961 Ga0207712_10004404 Ga0207712_100044043 114
127 3300025986 Ga0207658_10000111 Ga0207658_1000011148 114
128 3300026035 Ga0207703_10927014 Ga0207703_109270142 114
129 3300026041 Ga0207639_10070671 Ga0207639_100706711 114
130 3300026067 Ga0207678_10004034 Ga0207678_100040342 114
131 3300026088 Ga0207641_10723968 Ga0207641_107239682 114
132 3300041458 Ga0451798_0969286 Ga0451798_0969286_33_377 114
133 3300047472 Ga0495686_0016589 Ga0495686_0016589_3637_3981 114
134 3300048916 Ga0496113_0612012 Ga0496113_0612012_320_664 114
135 3300048921 Ga0496118_0630851 Ga0496118_0630851_25_369 114
136 3300048924 Ga0496121_0580195 Ga0496121_0580195_172_516 114
137 3300048925 Ga0496122_0000129 Ga0496122_0000129_58838_59182 114
138 3300048926 Ga0496123_0000113 Ga0496123_0000113_144946_145290 114
139 3300048929 Ga0496126_0436172 Ga0496126_0436172_379_723 114
140 3300049572 Ga0501036_1359202 Ga0501036_1359202_132_476 114
141 3300049822 Ga0501035_0005012 Ga0501035_0005012_2917_3261 114
142 3300049823 Ga0501044_0005271 Ga0501044_0005271_7146_7490 114
143 3300053120 Ga0500597_000038 Ga0500597_000038_11736_12080 114
144 iso_pu_bacteria 2842780639 2842784391 114
145 iso_pu_bacteria 2928963466 2928967530 114
146 3300002737 JGI25162J39368_1001350 JGI25162J39368_10013507 115
147 3300002737 JGI25162J39368_1001755 JGI25162J39368_10017558 115
148 3300002772 JGI25164J39214_1000313 JGI25164J39214_10003138 115
149 3300002772 JGI25164J39214_1001055 JGI25164J39214_10010553 115
150 3300003214 JGI25165J46597_1001249 JGI25165J46597_10012499 115
151 3300003214 JGI25165J46597_1009148 JGI25165J46597_10091482 115
152 3300003214 JGI25165J46597_1016339 JGI25165J46597_10163392 115
153 3300003320 rootH2_10125304 rootH2_101253042 115
154 3300005262 Ga0065165_1008327 Ga0065165_10083273 115
155 3300005327 Ga0070658_10638668 Ga0070658_106386682 115
156 3300005337 Ga0070682_100003242 Ga0070682_1000032429 115
157 3300005337 Ga0070682_100319903 Ga0070682_1003199031 115
158 3300005339 Ga0070660_100097823 Ga0070660_1000978233 115
159 3300005339 Ga0070660_100176126 Ga0070660_1001761262 115
160 3300005339 Ga0070660_100468098 Ga0070660_1004680982 115
161 3300005344 Ga0070661_100253535 Ga0070661_1002535352 115
162 3300005344 Ga0070661_100530397 Ga0070661_1005303971 115
163 3300005345 Ga0070692_10100591 Ga0070692_101005912 115
164 3300005366 Ga0070659_100004655 Ga0070659_1000046553 115
165 3300005366 Ga0070659_100025540 Ga0070659_1000255403 115
166 3300005366 Ga0070659_100218200 Ga0070659_1002182002 115
167 3300005366 Ga0070659_100628625 Ga0070659_1006286252 115
168 3300005366 Ga0070659_101846942 Ga0070659_1018469422 115
169 3300005435 Ga0070714_100000068 Ga0070714_1000000689 115
170 3300005444 Ga0070694_100108194 Ga0070694_1001081941 115
171 3300005455 Ga0070663_100658249 Ga0070663_1006582492 115
172 3300005457 Ga0070662_100234447 Ga0070662_1002344472 115
173 3300005458 Ga0070681_10253313 Ga0070681_102533132 115
174 3300005530 Ga0070679_100129545 Ga0070679_1001295455 115
175 3300005539 Ga0068853_100122239 Ga0068853_1001222393 115
176 3300005539 Ga0068853_100310484 Ga0068853_1003104842 115
177 3300005539 Ga0068853_100557827 Ga0068853_1005578272 115
178 3300005539 Ga0068853_102115948 Ga0068853_1021159481 115
179 3300005546 Ga0070696_101008472 Ga0070696_1010084721 115
180 3300005548 Ga0070665_100900187 Ga0070665_1009001872 115
181 3300005563 Ga0068855_100010376 Ga0068855_1000103767 115
182 3300005563 Ga0068855_100534727 Ga0068855_1005347272 115
183 3300005563 Ga0068855_100904024 Ga0068855_1009040242 115
184 3300005563 Ga0068855_101706820 Ga0068855_1017068202 115
185 3300005578 Ga0068854_100000905 Ga0068854_1000009056 115
186 3300005578 Ga0068854_100497616 Ga0068854_1004976162 115
187 3300005614 Ga0068856_100282002 Ga0068856_1002820022 115
188 3300009093 Ga0105240_10149436 Ga0105240_101494362 115
189 3300009174 Ga0105241_10040077 Ga0105241_100400773 115
190 3300009174 Ga0105241_10941961 Ga0105241_109419612 115
191 3300009177 Ga0105248_11409479 Ga0105248_114094792 115
192 3300009545 Ga0105237_10169593 Ga0105237_101695933 115
193 3300009545 Ga0105237_10392862 Ga0105237_103928622 115
194 3300009551 Ga0105238_10009092 Ga0105238_100090929 115
195 3300009551 Ga0105238_10035682 Ga0105238_100356823 115
196 3300009551 Ga0105238_10113504 Ga0105238_101135042 115
197 3300009551 Ga0105238_11968598 Ga0105238_119685982 115
198 3300010375 Ga0105239_10195692 Ga0105239_101956922 115
199 3300012505 Ga0157339_1056366 Ga0157339_10563661 115
200 3300013100 Ga0157373_10023464 Ga0157373_100234643 115
201 3300013100 Ga0157373_10103511 Ga0157373_101035113 115
202 3300013100 Ga0157373_10471023 Ga0157373_104710232 115
203 3300013102 Ga0157371_10078870 Ga0157371_100788703 115
204 3300013102 Ga0157371_10081064 Ga0157371_100810643 115
205 3300013104 Ga0157370_10018266 Ga0157370_100182666 115
206 3300013104 Ga0157370_10062160 Ga0157370_100621603 115
207 3300013104 Ga0157370_10448563 Ga0157370_104485632 115
208 3300013105 Ga0157369_10640360 Ga0157369_106403602 115
209 3300013307 Ga0157372_10538647 Ga0157372_105386472 115
210 3300013307 Ga0157372_11336230 Ga0157372_113362302 115
211 3300013307 Ga0157372_11705253 Ga0157372_117052531 115
212 3300013307 Ga0157372_12017477 Ga0157372_120174772 115
213 3300014497 Ga0182008_10023932 Ga0182008_100239323 115
214 3300015262 Ga0182007_10008724 Ga0182007_100087242 115
215 3300015262 Ga0182007_10040931 Ga0182007_100409312 115
216 3300015262 Ga0182007_10198418 Ga0182007_101984182 115
217 3300025231 Ga0207427_100229 Ga0207427_1002298 115
218 3300025231 Ga0207427_100396 Ga0207427_1003969 115
219 3300025233 Ga0209437_100039 Ga0209437_100039159 115
220 3300025233 Ga0209437_100129 Ga0209437_10012922 115
221 3300025261 Ga0209233_1000020 Ga0209233_1000020721 115
222 3300025261 Ga0209233_1000090 Ga0209233_1000090237 115
223 3300025261 Ga0209233_1022045 Ga0209233_10220452 115
224 3300025297 Ga0209758_1015642 Ga0209758_10156423 115
225 3300025904 Ga0207647_10025409 Ga0207647_100254093 115
226 3300025909 Ga0207705_10170764 Ga0207705_101707642 115
227 3300025911 Ga0207654_10049669 Ga0207654_100496693 115
228 3300025911 Ga0207654_10383024 Ga0207654_103830243 115
229 3300025912 Ga0207707_10233465 Ga0207707_102334652 115
230 3300025913 Ga0207695_10114722 Ga0207695_101147222 115
231 3300025914 Ga0207671_10047325 Ga0207671_100473252 115
232 3300025914 Ga0207671_10589551 Ga0207671_105895512 115
233 3300025919 Ga0207657_10070116 Ga0207657_100701162 115
234 3300025919 Ga0207657_10714954 Ga0207657_107149542 115
235 3300025920 Ga0207649_10132794 Ga0207649_101327942 115
236 3300025920 Ga0207649_10385391 Ga0207649_103853912 115
237 3300025921 Ga0207652_10825962 Ga0207652_108259622 115
238 3300025924 Ga0207694_10050013 Ga0207694_100500132 115
239 3300025924 Ga0207694_10131526 Ga0207694_101315262 115
240 3300025924 Ga0207694_10201754 Ga0207694_102017542 115
241 3300025929 Ga0207664_10000056 Ga0207664_10000056103 115
242 3300025932 Ga0207690_10001320 Ga0207690_100013209 115
243 3300025932 Ga0207690_10072858 Ga0207690_100728583 115
244 3300025932 Ga0207690_10136541 Ga0207690_101365412 115
245 3300025932 Ga0207690_10530352 Ga0207690_105303522 115
246 3300025932 Ga0207690_10805869 Ga0207690_108058692 115
247 3300025933 Ga0207706_10066673 Ga0207706_100666734 115
248 3300025949 Ga0207667_10002174 Ga0207667_100021748 115
249 3300025949 Ga0207667_10053720 Ga0207667_100537204 115
250 3300025949 Ga0207667_10143554 Ga0207667_101435543 115
251 3300025949 Ga0207667_10836558 Ga0207667_108365582 115
252 3300025981 Ga0207640_10000408 Ga0207640_1000040811 115
253 3300025981 Ga0207640_10095783 Ga0207640_100957832 115
254 3300026041 Ga0207639_10081698 Ga0207639_100816982 115
255 3300026041 Ga0207639_10445954 Ga0207639_104459542 115
256 3300026041 Ga0207639_10801587 Ga0207639_108015872 115
257 3300026041 Ga0207639_10901975 Ga0207639_109019751 115
258 3300026067 Ga0207678_10036117 Ga0207678_100361174 115
259 3300026078 Ga0207702_10270493 Ga0207702_102704932 115
260 3300026078 Ga0207702_11643926 Ga0207702_116439261 115
261 3300026116 Ga0207674_11228141 Ga0207674_112281411 115
262 3300031665 Ga0316575_10038066 Ga0316575_100380662 115
263 3300037312 Ga0395899_0000169 Ga0395899_0000169_21882_22229 115
264 3300037418 Ga0395900_0000069 Ga0395900_0000069_131321_131668 115
265 3300037418 Ga0395900_0727778 Ga0395900_0727778_31_378 115
266 3300037418 Ga0395900_1903390 Ga0395900_1903390_71_418 115
267 3300037466 Ga0395898_0000097 Ga0395898_0000097_156182_156529 115
268 3300038443 Ga0395901_0006786 Ga0395901_0006786_9532_9879 115
269 3300038443 Ga0395901_0165305 Ga0395901_0165305_898_1245 115
270 3300038443 Ga0395901_0426482 Ga0395901_0426482_471_818 115
271 3300042005 Ga0439448_0180373 Ga0439448_0180373_120_467 115
272 3300044656 Ga0466969_0010009 Ga0466969_0010009_3344_3691 115
273 3300044656 Ga0466969_0015993 Ga0466969_0015993_2558_2905 115
274 3300044656 Ga0466969_0125910 Ga0466969_0125910_650_997 115
275 3300044684 Ga0466966_0025957 Ga0466966_0025957_943_1290 115
276 3300044684 Ga0466966_0074862 Ga0466966_0074862_826_1173 115
277 3300044693 Ga0466961_0003971 Ga0466961_0003971_6212_6559 115
278 3300044693 Ga0466961_0007582 Ga0466961_0007582_2743_3090 115
279 3300044735 Ga0466968_0135008 Ga0466968_0135008_248_595 115
280 3300044765 Ga0466970_0009863 Ga0466970_0009863_4333_4680 115
281 3300044765 Ga0466970_0025468 Ga0466970_0025468_2696_3043 115
282 3300044765 Ga0466970_0576436 Ga0466970_0576436_55_402 115
283 3300044842 Ga0466957_0005568 Ga0466957_0005568_4115_4462 115
284 3300045049 Ga0466959_0000198 Ga0466959_0000198_19901_20248 115
285 3300045049 Ga0466959_0062727 Ga0466959_0062727_2066_2413 115
286 3300061719 Ga0466962_0053717 Ga0466962_0053717_1454_1801 115
287 3300001990 JGI24737J22298_10013123 JGI24737J22298_100131233 116
288 3300003316 rootH1_10014550 rootH1_100145503 116
289 3300003320 rootH2_10222491 rootH2_102224912 116
290 3300003322 rootL2_10244164 rootL2_102441643 116
291 3300003752 Ga0055539_1008633 Ga0055539_10086332 116
292 3300003756 Ga0055533_1001321 Ga0055533_100132111 116
293 3300003760 Ga0055527_1000329 Ga0055527_10003297 116
294 3300003760 Ga0055527_1012851 Ga0055527_10128512 116
295 3300003761 Ga0055535_1000621 Ga0055535_100062111 116
296 3300003761 Ga0055535_1000709 Ga0055535_10007097 116
297 3300003762 Ga0055542_1000151 Ga0055542_100015116 116
298 3300003762 Ga0055542_1000732 Ga0055542_10007327 116
299 3300003763 Ga0055529_1000643 Ga0055529_10006437 116
300 3300003791 Ga0055530_10081420 Ga0055530_100814201 116
301 3300003794 Ga0055531_10024457 Ga0055531_100244572 116
302 3300005614 Ga0068856_100038472 Ga0068856_1000384722 116
303 3300009093 Ga0105240_10004700 Ga0105240_100047006 116
304 3300010375 Ga0105239_10000063 Ga0105239_1000006377 116
305 3300010375 Ga0105239_12197853 Ga0105239_121978531 116
306 3300013105 Ga0157369_10122787 Ga0157369_101227872 116
307 3300013105 Ga0157369_10726832 Ga0157369_107268322 116
308 3300015687 Ga0183368_1004 Ga0183368_10041024 116
309 3300025226 Ga0209674_100026 Ga0209674_10002695 116
310 3300025226 Ga0209674_100062 Ga0209674_100062187 116
311 3300025228 Ga0209672_100017 Ga0209672_100017356 116
312 3300025228 Ga0209672_101880 Ga0209672_1018805 116
313 3300025242 Ga0209258_100213 Ga0209258_10021346 116
314 3300025242 Ga0209258_100272 Ga0209258_10027264 116
315 3300025242 Ga0209258_101145 Ga0209258_10114511 116
316 3300025253 Ga0209677_101574 Ga0209677_1015745 116
317 3300025254 Ga0209148_1000009 Ga0209148_1000009855 116
318 3300025254 Ga0209148_1000185 Ga0209148_100018564 116
319 3300025272 Ga0209455_1000032 Ga0209455_1000032356 116
320 3300025272 Ga0209455_1003416 Ga0209455_10034165 116
321 3300025298 Ga0209050_1038478 Ga0209050_10384781 116
322 3300025304 Ga0209257_1000179 Ga0209257_100017952 116
323 3300025904 Ga0207647_10052653 Ga0207647_100526532 116
324 3300025913 Ga0207695_10002440 Ga0207695_1000244011 116
325 3300025913 Ga0207695_10005605 Ga0207695_100056054 116
326 3300026078 Ga0207702_10001817 Ga0207702_1000181712 116
327 3300037312 Ga0395899_0013443 Ga0395899_0013443_4198_4548 116
328 3300037466 Ga0395898_0001110 Ga0395898_0001110_39223_39573 116
329 3300038443 Ga0395901_1577098 Ga0395901_1577098_235_585 116
330 3300044656 Ga0466969_0027761 Ga0466969_0027761_471_821 116
331 3300044658 Ga0466972_0435337 Ga0466972_0435337_197_547 116
332 3300044672 Ga0466982_0000002 Ga0466982_0000002_28692_29042 116
333 3300044683 Ga0466965_0016024 Ga0466965_0016024_1501_1851 116
334 3300044684 Ga0466966_0002617 Ga0466966_0002617_5161_5511 116
335 3300044693 Ga0466961_0001299 Ga0466961_0001299_9011_9361 116
336 3300044706 Ga0466964_0006645 Ga0466964_0006645_1812_2162 116
337 3300044719 Ga0466971_0022289 Ga0466971_0022289_1937_2287 116
338 3300044901 Ga0466960_0002860 Ga0466960_0002860_3191_3541 116
339 3300045049 Ga0466959_0220648 Ga0466959_0220648_772_1122 116
340 3300045836 Ga0466958_0004503 Ga0466958_0004503_2435_2785 116
341 3300045836 Ga0466958_0006900 Ga0466958_0006900_1770_2120 116
342 3300048903 Ga0496100_0075174 Ga0496100_0075174_223_579 116
343 3300048904 Ga0496101_0134473 Ga0496101_0134473_653_1009 116
344 3300048907 Ga0496104_0320610 Ga0496104_0320610_564_920 116
345 3300048908 Ga0496105_0375403 Ga0496105_0375403_624_974 116
346 3300048916 Ga0496113_0525903 Ga0496113_0525903_162_512 116
347 3300048918 Ga0496115_0000505 Ga0496115_0000505_16529_16879 116
348 3300048918 Ga0496115_0040871 Ga0496115_0040871_1031_1387 116
349 3300048920 Ga0496117_0007917 Ga0496117_0007917_6799_7155 116
350 3300048920 Ga0496117_0043569 Ga0496117_0043569_1503_1859 116
351 3300048920 Ga0496117_0056002 Ga0496117_0056002_926_1282 116
352 3300048921 Ga0496118_0001754 Ga0496118_0001754_9029_9385 116
353 3300048921 Ga0496118_0009342 Ga0496118_0009342_8158_8514 116
354 3300048921 Ga0496118_0016257 Ga0496118_0016257_5010_5366 116
355 3300048922 Ga0496119_0000184 Ga0496119_0000184_75433_75789 116
356 3300048923 Ga0496120_0000719 Ga0496120_0000719_17400_17756 116
357 3300048924 Ga0496121_0006838 Ga0496121_0006838_1553_1909 116
358 3300048924 Ga0496121_0243495 Ga0496121_0243495_318_674 116
359 3300048929 Ga0496126_0005763 Ga0496126_0005763_1419_1775 116
360 3300048929 Ga0496126_0084867 Ga0496126_0084867_70_426 116
361 3300061719 Ga0466962_0002198 Ga0466962_0002198_2628_2978 116
362 3300002741 JGI25157J39369_1001042 JGI25157J39369_100104213 117
363 3300049581 Ga0501047_0710652 Ga0501047_0710652_278_634 117
364 3300049823 Ga0501044_0240740 Ga0501044_0240740_1143_1499 117
365 3300049823 Ga0501044_0899289 Ga0501044_0899289_15_368 117
366 3300053139 Ga0500568_0001067 Ga0500568_0001067_10295_10651 117
367 3300001979 JGI24740J21852_10007799 JGI24740J21852_100077991 118
368 3300001989 JGI24739J22299_10000033 JGI24739J22299_1000003321 118
369 3300001990 JGI24737J22298_10021419 JGI24737J22298_100214192 118
370 3300002705 JGI25156J39149_1051552 JGI25156J39149_10515521 118
371 3300002737 JGI25162J39368_1000807 JGI25162J39368_100080711 118
372 3300002741 JGI25157J39369_1001056 JGI25157J39369_100105616 118
373 3300002741 JGI25157J39369_1009836 JGI25157J39369_10098363 118
374 3300002771 JGI25163J39215_1001074 JGI25163J39215_10010743 118
375 3300002772 JGI25164J39214_1000049 JGI25164J39214_100004984 118
376 3300003214 JGI25165J46597_1000009 JGI25165J46597_1000009356 118
377 3300003215 JGI25153J46596_10010577 JGI25153J46596_100105772 118
378 3300003751 Ga0055538_1001554 Ga0055538_10015545 118
379 3300003761 Ga0055535_1000082 Ga0055535_10000826 118
380 3300003762 Ga0055542_1000882 Ga0055542_10008826 118
381 3300003763 Ga0055529_1000020 Ga0055529_1000020242 118
382 3300003763 Ga0055529_1002129 Ga0055529_10021296 118
383 3300005457 Ga0070662_100592297 Ga0070662_1005922971 118
384 3300005539 Ga0068853_101866436 Ga0068853_1018664361 118
385 3300005548 Ga0070665_100015364 Ga0070665_1000153644 118
386 3300005548 Ga0070665_101956295 Ga0070665_1019562952 118
387 3300005563 Ga0068855_100006982 Ga0068855_1000069824 118
388 3300005563 Ga0068855_100482344 Ga0068855_1004823442 118
389 3300005564 Ga0070664_100199995 Ga0070664_1001999952 118
390 3300005577 Ga0068857_100000799 Ga0068857_1000007994 118
391 3300005578 Ga0068854_100007293 Ga0068854_1000072934 118
392 3300005578 Ga0068854_100671601 Ga0068854_1006716012 118
393 3300005614 Ga0068856_100001223 Ga0068856_10000122316 118
394 3300005616 Ga0068852_100068970 Ga0068852_1000689702 118
395 3300005834 Ga0068851_10001583 Ga0068851_100015834 118
396 3300005842 Ga0068858_100104061 Ga0068858_1001040613 118
397 3300009093 Ga0105240_10019619 Ga0105240_100196192 118
398 3300009093 Ga0105240_10140729 Ga0105240_101407291 118
399 3300009545 Ga0105237_10000016 Ga0105237_10000016190 118
400 3300009545 Ga0105237_10000371 Ga0105237_100003715 118
401 3300009551 Ga0105238_10309338 Ga0105238_103093382 118
402 3300010375 Ga0105239_10121167 Ga0105239_101211673 118
403 3300012500 Ga0157314_1000404 Ga0157314_10004043 118
404 3300012502 Ga0157347_1006181 Ga0157347_10061812 118
405 3300013104 Ga0157370_10427079 Ga0157370_104270792 118
406 3300013105 Ga0157369_10014122 Ga0157369_100141229 118
407 3300013105 Ga0157369_10678711 Ga0157369_106787112 118
408 3300013307 Ga0157372_11015924 Ga0157372_110159242 118
409 3300020070 Ga0206356_11568625 Ga0206356_115686253 118
410 3300020082 Ga0206353_11584667 Ga0206353_115846672 118
411 3300025206 Ga0209435_101084 Ga0209435_1010843 118
412 3300025207 Ga0209760_100481 Ga0209760_10048111 118
413 3300025224 Ga0209784_100013 Ga0209784_10001380 118
414 3300025231 Ga0207427_100073 Ga0207427_10007380 118
415 3300025233 Ga0209437_100012 Ga0209437_100012400 118
416 3300025242 Ga0209258_100019 Ga0209258_100019459 118
417 3300025246 Ga0209646_1000735 Ga0209646_10007353 118
418 3300025246 Ga0209646_1002693 Ga0209646_10026932 118
419 3300025250 Ga0209026_1000125 Ga0209026_100012586 118
420 3300025250 Ga0209026_1000207 Ga0209026_100020759 118
421 3300025254 Ga0209148_1000001 Ga0209148_10000011842 118
422 3300025256 Ga0209759_1000595 Ga0209759_100059527 118
423 3300025256 Ga0209759_1003876 Ga0209759_10038764 118
424 3300025258 Ga0209129_1002584 Ga0209129_10025842 118
425 3300025261 Ga0209233_1000002 Ga0209233_1000002389 118
426 3300025272 Ga0209455_1000027 Ga0209455_100002786 118
427 3300025272 Ga0209455_1000535 Ga0209455_100053518 118
428 3300025297 Ga0209758_1001236 Ga0209758_100123621 118
429 3300025321 Ga0207656_10001923 Ga0207656_100019233 118
430 3300025903 Ga0207680_10933683 Ga0207680_109336832 118
431 3300025904 Ga0207647_10002923 Ga0207647_100029234 118
432 3300025904 Ga0207647_10054149 Ga0207647_100541493 118
433 3300025913 Ga0207695_10000405 Ga0207695_100004056 118
434 3300025913 Ga0207695_10000493 Ga0207695_1000049367 118
435 3300025914 Ga0207671_10000137 Ga0207671_1000013742 118
436 3300025914 Ga0207671_10000490 Ga0207671_1000049025 118
437 3300025933 Ga0207706_10128099 Ga0207706_101280991 118
438 3300025945 Ga0207679_10249687 Ga0207679_102496872 118
439 3300025949 Ga0207667_10001885 Ga0207667_1000188510 118
440 3300025949 Ga0207667_10033011 Ga0207667_100330112 118
441 3300025949 Ga0207667_10619864 Ga0207667_106198642 118
442 3300025981 Ga0207640_10017160 Ga0207640_100171603 118
443 3300025981 Ga0207640_10154610 Ga0207640_101546102 118
444 3300025986 Ga0207658_11636910 Ga0207658_116369101 118
445 3300026035 Ga0207703_10190969 Ga0207703_101909691 118
446 3300026067 Ga0207678_10006781 Ga0207678_100067813 118
447 3300026078 Ga0207702_10000104 Ga0207702_1000010466 118
448 3300026116 Ga0207674_10000818 Ga0207674_1000081823 118
449 3300026142 Ga0207698_10300123 Ga0207698_103001232 118
450 3300028379 Ga0268266_10499300 Ga0268266_104993001 118
451 3300041443 Ga0451789_0550781 Ga0451789_0550781_30_389 118
452 3300041458 Ga0451798_0155906 Ga0451798_0155906_228_587 118
453 3300041459 Ga0451800_0435905 Ga0451800_0435905_342_701 118
454 3300041494 Ga0451837_1258977 Ga0451837_1258977_423_782 118
455 3300041494 Ga0451837_1622034 Ga0451837_1622034_611_973 118
456 3300042005 Ga0439448_0048718 Ga0439448_0048718_586_942 118
457 3300048924 Ga0496121_0121849 Ga0496121_0121849_1352_1708 118
458 3300048928 Ga0496125_0000479 Ga0496125_0000479_10252_10608 118
459 3300048928 Ga0496125_0445116 Ga0496125_0445116_292_648 118
460 3300049568 Ga0501031_0038579 Ga0501031_0038579_904_1263 118
461 3300049569 Ga0501032_0023594 Ga0501032_0023594_1406_1765 118
462 3300049569 Ga0501032_0096231 Ga0501032_0096231_1220_1579 118
463 3300049570 Ga0501033_0011309 Ga0501033_0011309_1770_2129 118
464 3300049570 Ga0501033_0223467 Ga0501033_0223467_597_956 118
465 3300049570 Ga0501033_0574945 Ga0501033_0574945_125_484 118
466 3300049571 Ga0501034_0007828 Ga0501034_0007828_813_1172 118
467 3300049571 Ga0501034_0049233 Ga0501034_0049233_1770_2129 118
468 3300049572 Ga0501036_0019131 Ga0501036_0019131_1769_2128 118
469 3300049572 Ga0501036_0163002 Ga0501036_0163002_111_470 118
470 3300049573 Ga0501037_0007587 Ga0501037_0007587_3517_3876 118
471 3300049573 Ga0501037_0029753 Ga0501037_0029753_384_743 118
472 3300049574 Ga0501038_0050881 Ga0501038_0050881_1450_1809 118
473 3300049574 Ga0501038_0150103 Ga0501038_0150103_450_809 118
474 3300049575 Ga0501039_0010391 Ga0501039_0010391_4167_4526 118
475 3300049575 Ga0501039_0056275 Ga0501039_0056275_1278_1637 118
476 3300049576 Ga0501040_0037069 Ga0501040_0037069_424_783 118
477 3300049579 Ga0501043_0225476 Ga0501043_0225476_706_1065 118
478 3300049580 Ga0501046_0021868 Ga0501046_0021868_1076_1435 118
479 3300049580 Ga0501046_0024525 Ga0501046_0024525_2859_3218 118
480 3300049580 Ga0501046_0191696 Ga0501046_0191696_747_1106 118
481 3300049581 Ga0501047_0044957 Ga0501047_0044957_2140_2499 118
482 3300049581 Ga0501047_0204447 Ga0501047_0204447_384_743 118
483 3300049581 Ga0501047_0272623 Ga0501047_0272623_448_807 118
484 3300049581 Ga0501047_1234180 Ga0501047_1234180_113_472 118
485 3300049582 Ga0501048_0127233 Ga0501048_0127233_846_1205 118
486 3300049582 Ga0501048_0569096 Ga0501048_0569096_330_689 118
487 3300049583 Ga0501067_0010924 Ga0501067_0010924_3974_4333 118
488 3300049584 Ga0501068_0028147 Ga0501068_0028147_1689_2048 118
489 3300049585 Ga0501069_0108078 Ga0501069_0108078_132_491 118
490 3300049585 Ga0501069_0225534 Ga0501069_0225534_190_549 118
491 3300049586 Ga0501070_0039815 Ga0501070_0039815_1001_1360 118
492 3300049586 Ga0501070_0122133 Ga0501070_0122133_384_743 118
493 3300049586 Ga0501070_1220463 Ga0501070_1220463_135_494 118
494 3300049588 Ga0501072_0144392 Ga0501072_0144392_1375_1734 118
495 3300049588 Ga0501072_0293085 Ga0501072_0293085_191_550 118
496 3300049589 Ga0501073_0029339 Ga0501073_0029339_1770_2129 118
497 3300049589 Ga0501073_0083776 Ga0501073_0083776_450_809 118
498 3300049590 Ga0501074_0008690 Ga0501074_0008690_1287_1646 118
499 3300049590 Ga0501074_0061280 Ga0501074_0061280_1260_1619 118
500 3300049592 Ga0501076_0422386 Ga0501076_0422386_682_1041 118
501 3300049741 Ga0501079_0084719 Ga0501079_0084719_621_980 118
502 3300049742 Ga0501080_0046617 Ga0501080_0046617_3292_3651 118
503 3300049742 Ga0501080_0111924 Ga0501080_0111924_1803_2162 118
504 3300049742 Ga0501080_0114548 Ga0501080_0114548_699_1058 118
505 3300049742 Ga0501080_0678103 Ga0501080_0678103_514_873 118
506 3300049742 Ga0501080_1758258 Ga0501080_1758258_147_506 118
507 3300049743 Ga0501081_0035222 Ga0501081_0035222_1751_2110 118
508 3300049744 Ga0501083_0208989 Ga0501083_0208989_204_563 118
509 3300049744 Ga0501083_0607486 Ga0501083_0607486_235_594 118
510 3300049822 Ga0501035_0023870 Ga0501035_0023870_4803_5162 118
511 3300049822 Ga0501035_0037869 Ga0501035_0037869_1675_2034 118
512 3300049822 Ga0501035_0598420 Ga0501035_0598420_177_536 118
513 3300049823 Ga0501044_0039474 Ga0501044_0039474_4183_4542 118
514 3300049823 Ga0501044_0040398 Ga0501044_0040398_1770_2129 118
515 3300049823 Ga0501044_0204017 Ga0501044_0204017_890_1249 118
516 3300049823 Ga0501044_0794008 Ga0501044_0794008_352_711 118
517 3300049823 Ga0501044_1198637 Ga0501044_1198637_193_552 118
518 3300049824 Ga0501045_0083512 Ga0501045_0083512_1150_1509 118
519 3300053093 Ga0500651_0000070 Ga0500651_0000070_34573_34932 118
520 3300054114 Ga0501084_0315907 Ga0501084_0315907_654_1013 118
521 3300054114 Ga0501084_1281996 Ga0501084_1281996_209_568 118
522 3300060353 Ga0501082_0081779 Ga0501082_0081779_1215_1574 118
523 3300060353 Ga0501082_0300596 Ga0501082_0300596_655_1014 118
524 3300061734 Ga0530510_0451399 Ga0530510_0451399_418_777 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

27

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ntg-assembly4.cif.gz_D crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase 0.8951 19 93
1fl0-assembly1.cif.gz_A crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex 0.8733 19 92
3g48-assembly2.cif.gz_A crystal structure of chaperone csaa form bacillus anthracis str. ames 0.8299 12 118
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.8284 12 118
2nzo-assembly2.cif.gz_D crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.8281 12 118
ID Description Score Start End Superfamily
af_Q54X95_575_736_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8471 20 99 2.40.50.140
af_K7UH50_99_267_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8301 19 100 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8267 12 118 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8113 8 118 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8061 12 118 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0Q9F203-F1-model_v4 tRNA-binding protein 0.9167 21 118 GO:0000049
AF-A0A0Q9F203-F1-model_v4 tRNA-binding protein 0.9078 21 118 GO:0000049
AF-A0A2W5KV52-F1-model_v4 deleted 0.907 20 118
AF-A0A537M1T7-F1-model_v4 tRNA-binding protein 0.8894 12 92 GO:0000049
AF-A0A497H2Q0-F1-model_v4 methionine--tRNA ligase (EC 6.1.1.10) (Methionyl-tRNA synthetase) 0.8878 16 104 GO:0000049
GO:0004825
GO:0005524
GO:0005829
GO:0006431

Feature Viewer

pLDDT pTM Quality
88.39 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map