F459116

General Info

Members Datasets Scaffolds Average Seq Length
524 292 1048 365

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10067045|Ga0105251_100670452
Length 395
Sequence MSDQLCVATRKGLFVLQADGNGGWTLDEPCFVGEPVSMVLPDARDGSLYAALNLGHFGVKLHRRRAGATQWEECAVPVYPPQPVEETLAGDNGNATPNGQADTRVDNAAAPRPPAPPWTLQQIWSLETGGPDEPGVLWAGTIPGGLFRSDDGGDTWVLNRALWDRPERCEWFGGGYDAPGIHSVMVDPRDSRHVTIGVSCGGVWQTHDGGATWRVSAEGMEADYMPPERRGDANVQDPHRVVQCPASPDALWTQHHCAIFRSTDGAAHWQRIEAQPSSFGFAVAVHPREPDTAWFVPAEKDQCRIPMDAQFIVTRTRDGGRTFERFSTGLPPAPVYDLVYRHGLAVDETGTRLAMGSTTGSLWTSDDGGESWQLISAHCRLFIVFGLDEGEGRGE

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
223 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
227 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
233 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
234 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
235 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
236 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
237 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
238 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
239 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
240 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
241 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
242 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
243 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
244 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
245 2519103095 Burkholderia sp. KJ006 Isolate Nodule
246 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
247 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
248 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
249 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
250 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
251 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
252 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
253 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
254 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
255 2643221638 Duganella sp. Root336D2 Isolate Unclassified
256 2643221645 Massilia sp. Root351 Isolate Unclassified
257 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
258 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
259 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
260 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
261 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
262 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
263 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
264 2818991452 Burkholderia cepacia 561 Isolate Unclassified
265 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
266 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
267 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
268 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
269 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
270 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
271 2904424332 Duganella sp. 1411 Isolate Rhizosphere
272 2904564687 Burkholderia sp. 571 Isolate Unclassified
273 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
274 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
275 2928163908 Burkholderia sp. 567 Isolate Unclassified
276 2928170801 Burkholderia sp. 572 Isolate Unclassified
277 2928536128 Burkholderia sola 565 Isolate Unclassified
278 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
279 639633007 Azoarcus olearius BH72 Isolate Unclassified
280 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
281 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
282 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
283 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
284 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
285 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
286 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
287 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
288 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
289 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
290 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
291 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
292 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.6
Metatranscriptomes 0.76
Isolates 11.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.32
Nodule 2.1
Rhizoplane 1.53
Rhizosphere 70.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10067045 3300009011 Bacteria 1677
2 JGI25154J39366_1000780 3300002738 Bacteria 14079
3 JGI25158J39367_1000365 3300002739 Bacteria 9781
4 JGI25158J39367_1006645 3300002739 Bacteria 1652
5 JGI25152J39213_1000014 3300002773 Bacteria 123630
6 JGI25150J39212_1008119 3300002774 Bacteria 2073
7 JGI25159J45721_1005352 3300002987 Bacteria 4044
8 JGI25153J46596_10006726 3300003215 Bacteria 5771
9 rootH1_10013178 3300003316 Bacteria 3362
10 rootL2_10212688 3300003322 Bacteria 1781
11 JGI25161J50226_1000418 3300003374 Bacteria 20432
12 JGI25161J50226_1001426 3300003374 Bacteria 7218
13 Ga0055532_1000422 3300003758 Bacteria 20282
14 Ga0055532_1000548 3300003758 Bacteria 16029
15 Ga0055532_1001192 3300003758 Bacteria 7799
16 Ga0055527_1000288 3300003760 Bacteria 29471
17 Ga0055527_1000354 3300003760 Bacteria 22203
18 Ga0055535_1000604 3300003761 Bacteria 29593
19 Ga0055535_1000803 3300003761 Bacteria 22761
20 Ga0055542_1000633 3300003762 Bacteria 29593
21 Ga0055542_1001342 3300003762 Bacteria 12745
22 Ga0055529_1000568 3300003763 Bacteria 30261
23 Ga0055526_1000088 3300003771 Bacteria 83571
24 Ga0055526_1001131 3300003771 Bacteria 19366
25 Ga0055526_1001138 3300003771 Bacteria 19264
26 Ga0055526_1009410 3300003771 Bacteria 4703
27 Ga0055526_1026197 3300003771 Bacteria 1847
28 Ga0055537_1000065 3300003773 Bacteria 77086
29 Ga0055537_1002611 3300003773 Bacteria 5898
30 Ga0055537_1003612 3300003773 Bacteria 4704
31 Ga0055524_1000998 3300003775 Bacteria 17691
32 Ga0055524_1001292 3300003775 Bacteria 14689
33 Ga0055524_1002090 3300003775 Bacteria 10557
34 Ga0055534_1000357 3300003784 Bacteria 28958
35 Ga0055534_1000753 3300003784 Bacteria 15455
36 Ga0055534_1005156 3300003784 Bacteria 3581
37 Ga0055528_1000565 3300003790 Bacteria 28147
38 Ga0055528_1001220 3300003790 Bacteria 16479
39 Ga0055528_1004229 3300003790 Bacteria 6958
40 Ga0055530_10001057 3300003791 Bacteria 21831
41 Ga0055530_10006848 3300003791 Bacteria 4944
42 Ga0055530_10017920 3300003791 Bacteria 2201
43 Ga0055531_10000831 3300003794 Bacteria 25489
44 Ga0055531_10017529 3300003794 Bacteria 3017
45 Ga0055543_1003938 3300004625 Bacteria 4196
46 Ga0065165_1005365 3300005262 Bacteria 7256
47 Ga0070658_10002676 3300005327 Bacteria 14819
48 Ga0070658_10103686 3300005327 Bacteria 2352
49 Ga0070670_100019210 3300005331 Bacteria 5860
50 Ga0070666_10012291 3300005335 Bacteria 5395
51 Ga0070660_100000006 3300005339 Bacteria 166714
52 Ga0070660_100009449 3300005339 Bacteria 6858
53 Ga0070689_100001219 3300005340 Bacteria 16322
54 Ga0070661_100021258 3300005344 Bacteria 4632
55 Ga0070659_100001370 3300005366 Bacteria 17534
56 Ga0070659_100071098 3300005366 Bacteria 2766
57 Ga0070667_100040927 3300005367 Bacteria 3887
58 Ga0070663_100001153 3300005455 Bacteria 14553
59 Ga0070663_100044813 3300005455 Bacteria 3121
60 Ga0068867_100239771 3300005459 Bacteria 1470
61 Ga0070685_10002632 3300005466 Bacteria 9198
62 Ga0070686_100192041 3300005544 Bacteria 1458
63 Ga0070665_100000469 3300005548 Bacteria 58193
64 Ga0070665_100352134 3300005548 Bacteria 1478
65 Ga0068855_100026533 3300005563 Bacteria 6930
66 Ga0068854_100201992 3300005578 Bacteria 1563
67 Ga0068852_100070632 3300005616 Bacteria 3064
68 Ga0068851_10002957 3300005834 Bacteria 7514
69 Ga0068863_100040972 3300005841 Bacteria 4403
70 Ga0068863_100348204 3300005841 Bacteria 1442
71 Ga0068858_100000371 3300005842 Bacteria 46917
72 Ga0075363_100037726 3300006048 Bacteria 2539
73 Ga0075428_100541800 3300006844 Bacteria 1244
74 Ga0079104_1004547 3300006946 Bacteria 5883
75 Ga0105244_10004369 3300009036 Bacteria 9746
76 Ga0105250_10007094 3300009092 Bacteria 4836
77 Ga0105240_10002065 3300009093 Bacteria 32902
78 Ga0105240_10002853 3300009093 Bacteria 27310
79 Ga0105240_10046548 3300009093 Bacteria 5495
80 Ga0105237_10013238 3300009545 Bacteria 8655
81 Ga0105237_10026569 3300009545 Bacteria 5917
82 Ga0105237_10077832 3300009545 Bacteria 3306
83 Ga0105249_10123238 3300009553 Bacteria 2466
84 Ga0105239_10016039 3300010375 Bacteria 8290
85 Ga0157373_10016396 3300013100 Bacteria 5406
86 Ga0157371_10006292 3300013102 Bacteria 9834
87 Ga0157370_10013487 3300013104 Bacteria 8416
88 Ga0157369_10000790 3300013105 Bacteria 40574
89 Ga0157369_10006130 3300013105 Bacteria 13954
90 Ga0157369_10088454 3300013105 Bacteria 3306
91 Ga0157369_10138239 3300013105 Bacteria 2578
92 Ga0157374_10000099 3300013296 Bacteria 80415
93 Ga0157376_10210054 3300014969 Bacteria 1796
94 Ga0182006_1000059 3300015261 Bacteria 164868
95 Ga0182007_10001843 3300015262 Bacteria 11048
96 Ga0182005_1000006 3300015265 Bacteria 515188
97 Ga0206356_11229641 3300020070 Bacteria 2041
98 Ga0206354_10593810 3300020081 Bacteria 1645
99 Ga0206354_11266040 3300020081 Bacteria 1542
100 Ga0213872_10004913 3300021361 Bacteria 6958
101 Ga0224712_10006020 3300022467 Bacteria 3427
102 Ga0209436_100078 3300025208 Bacteria 49369
103 Ga0209436_100612 3300025208 Bacteria 15284
104 Ga0209566_102678 3300025225 Bacteria 3119
105 Ga0209672_100020 3300025228 Bacteria 429003
106 Ga0209672_100066 3300025228 Bacteria 189828
107 Ga0209672_100618 3300025228 Bacteria 18512
108 Ga0209147_100024 3300025229 Bacteria 429003
109 Ga0209147_100084 3300025229 Bacteria 189828
110 Ga0209147_100562 3300025229 Bacteria 20865
111 Ga0209258_100084 3300025242 Bacteria 244783
112 Ga0209258_100117 3300025242 Bacteria 189828
113 Ga0207425_1000009 3300025245 Bacteria 593135
114 Ga0207425_1000068 3300025245 Bacteria 124067
115 Ga0207425_1018176 3300025245 Bacteria 1529
116 Ga0209026_1003655 3300025250 Bacteria 4935
117 Ga0209148_1000442 3300025254 Bacteria 45703
118 Ga0209148_1000644 3300025254 Bacteria 30313
119 Ga0209129_1000061 3300025258 Bacteria 246061
120 Ga0209129_1001146 3300025258 Bacteria 15338
121 Ga0209233_1002786 3300025261 Bacteria 6283
122 Ga0209565_1000032 3300025263 Bacteria 316777
123 Ga0209565_1000342 3300025263 Bacteria 41122
124 Ga0209565_1000669 3300025263 Bacteria 21683
125 Ga0209565_1002472 3300025263 Bacteria 6619
126 Ga0209455_1000110 3300025272 Bacteria 189828
127 Ga0209455_1001559 3300025272 Bacteria 10157
128 Ga0209673_1000029 3300025273 Bacteria 351978
129 Ga0209673_1000057 3300025273 Bacteria 270150
130 Ga0209673_1015553 3300025273 Bacteria 2883
131 Ga0209130_1000721 3300025284 Bacteria 29292
132 Ga0209675_1000019 3300025291 Bacteria 351950
133 Ga0209675_1000519 3300025291 Bacteria 28456
134 Ga0209675_1000974 3300025291 Bacteria 18082
135 Ga0209564_1000067 3300025295 Bacteria 311242
136 Ga0209564_1000115 3300025295 Bacteria 208988
137 Ga0209564_1001163 3300025295 Bacteria 30590
138 Ga0209564_1012651 3300025295 Bacteria 3658
139 Ga0209758_1000101 3300025297 Bacteria 225913
140 Ga0209050_1000040 3300025298 Bacteria 408492
141 Ga0209050_1000123 3300025298 Bacteria 195061
142 Ga0209050_1000573 3300025298 Bacteria 59710
143 Ga0209256_1000058 3300025299 Bacteria 272934
144 Ga0209256_1000142 3300025299 Bacteria 152245
145 Ga0209256_1001315 3300025299 Bacteria 26578
146 Ga0209256_1005917 3300025299 Bacteria 6758
147 Ga0209051_1020895 3300025303 Bacteria 2803
148 Ga0209257_1000054 3300025304 Bacteria 416957
149 Ga0209257_1018450 3300025304 Bacteria 2683
150 Ga0207656_10004110 3300025321 Bacteria 5054
151 Ga0207647_10001649 3300025904 Bacteria 17170
152 Ga0207647_10001945 3300025904 Bacteria 15801
153 Ga0207647_10016518 3300025904 Bacteria 5036
154 Ga0207705_10036367 3300025909 Bacteria 3524
155 Ga0207695_10000014 3300025913 Bacteria 812599
156 Ga0207695_10001034 3300025913 Bacteria 48892
157 Ga0207695_10019698 3300025913 Bacteria 7759
158 Ga0207695_10054393 3300025913 Bacteria 4180
159 Ga0207695_10173664 3300025913 Bacteria 2079
160 Ga0207671_10008637 3300025914 Bacteria 8606
161 Ga0207657_10000003 3300025919 Bacteria 263148
162 Ga0207657_10023961 3300025919 Bacteria 5667
163 Ga0207649_10121934 3300025920 Bacteria 1758
164 Ga0207650_10009708 3300025925 Bacteria 6580
165 Ga0207690_10000007 3300025932 Bacteria 388533
166 Ga0207690_10048221 3300025932 Bacteria 2831
167 Ga0207706_10006847 3300025933 Bacteria 10535
168 Ga0207670_10006038 3300025936 Bacteria 6695
169 Ga0207667_10041981 3300025949 Bacteria 4864
170 Ga0207667_10072743 3300025949 Bacteria 3573
171 Ga0207667_10271817 3300025949 Bacteria 1733
172 Ga0207712_10000390 3300025961 Bacteria 38119
173 Ga0207640_10016782 3300025981 Bacteria 4268
174 Ga0207658_10113301 3300025986 Bacteria 2148
175 Ga0207703_10002672 3300026035 Bacteria 15322
176 Ga0207639_10003799 3300026041 Bacteria 10168
177 Ga0207678_10001379 3300026067 Bacteria 22367
178 Ga0207678_10006736 3300026067 Bacteria 10187
179 Ga0207641_10062707 3300026088 Bacteria 3174
180 Ga0207648_10067415 3300026089 Bacteria 3120
181 Ga0207698_10011379 3300026142 Bacteria 5767
182 Ga0209371_1000255 3300027312 Bacteria 64538
183 Ga0268266_10000007 3300028379 Bacteria 1372921
184 Ga0268264_10261418 3300028381 Bacteria 1612
185 Ga0265337_1004474 3300028556 Bacteria 5793
186 Ga0265338_10000713 3300028800 Bacteria 56791
187 Ga0265338_10001292 3300028800 Bacteria 41039
188 Ga0268256_1000210 3300030500 Bacteria 65841
189 Ga0316182_1008330 3300030745 Bacteria 1931
190 Ga0265327_10000005 3300031251 Bacteria 790146
191 Ga0307408_100000491 3300031548 Bacteria 34515
192 Ga0307408_100000525 3300031548 Bacteria 33056
193 Ga0307408_100001430 3300031548 Bacteria 17754
194 Ga0307408_100047166 3300031548 Bacteria 3084
195 Ga0307408_100102050 3300031548 Bacteria 2187
196 Ga0307406_10294415 3300031901 Bacteria 1244
197 Ga0307412_10150224 3300031911 Bacteria 1718
198 Ga0307416_100018769 3300032002 Bacteria 4883
199 Ga0373942_0016341 3300035207 Bacteria 1819
200 Ga0395899_0000003 3300037312 Bacteria 1232684
201 Ga0395899_0000019 3300037312 Bacteria 411777
202 Ga0395899_0000193 3300037312 Bacteria 90238
203 Ga0395899_0023701 3300037312 Bacteria 4645
204 Ga0395899_0023807 3300037312 Bacteria 4633
205 Ga0395899_0108960 3300037312 Bacteria 1993
206 Ga0395899_0113212 3300037312 Bacteria 1949
207 Ga0395900_0000219 3300037418 Bacteria 90231
208 Ga0395900_0001739 3300037418 Bacteria 25087
209 Ga0395900_0005065 3300037418 Bacteria 13828
210 Ga0395900_0048379 3300037418 Bacteria 4380
211 Ga0395900_0052200 3300037418 Bacteria 4209
212 Ga0395900_0164758 3300037418 Bacteria 2259
213 Ga0395898_0000469 3300037466 Bacteria 80881
214 Ga0395898_0000950 3300037466 Bacteria 46158
215 Ga0395898_0003107 3300037466 Bacteria 18768
216 Ga0395898_0071830 3300037466 Bacteria 3344
217 Ga0395901_0000148 3300038443 Bacteria 91208
218 Ga0395901_0000175 3300038443 Bacteria 83175
219 Ga0395901_0010201 3300038443 Bacteria 9517
220 Ga0395901_0041241 3300038443 Bacteria 4782
221 Ga0395901_0054925 3300038443 Bacteria 4141
222 Ga0395901_0063980 3300038443 Bacteria 3828
223 Ga0395901_0212085 3300038443 Bacteria 2026
224 Ga0395901_0215447 3300038443 Bacteria 2008
225 Ga0436361_0538088 3300039447 Bacteria 13380
226 Ga0436361_0992955 3300039447 Bacteria 5015
227 Ga0466969_0005791 3300044656 Bacteria 6565
228 Ga0466969_0015455 3300044656 Bacteria 4001
229 Ga0466972_0000191 3300044658 Bacteria 47087
230 Ga0466972_0031888 3300044658 Bacteria 2590
231 Ga0466978_0068917 3300044671 Bacteria 2207
232 Ga0466966_0000246 3300044684 Bacteria 35956
233 Ga0466966_0001670 3300044684 Bacteria 14309
234 Ga0466966_0022419 3300044684 Bacteria 4143
235 Ga0466966_0034387 3300044684 Bacteria 3277
236 Ga0466961_0000128 3300044693 Bacteria 50467
237 Ga0466961_0000207 3300044693 Bacteria 39646
238 Ga0466961_0000521 3300044693 Bacteria 24467
239 Ga0466961_0000913 3300044693 Bacteria 18285
240 Ga0466961_0003535 3300044693 Bacteria 9752
241 Ga0466961_0008104 3300044693 Bacteria 6690
242 Ga0466961_0080378 3300044693 Bacteria 2064
243 Ga0466961_0101580 3300044693 Bacteria 1811
244 Ga0466963_0002350 3300044694 Bacteria 10557
245 Ga0466963_0010478 3300044694 Bacteria 5612
246 Ga0466963_0015650 3300044694 Bacteria 4704
247 Ga0466964_0005398 3300044706 Bacteria 4748
248 Ga0466971_0002822 3300044719 Bacteria 7358
249 Ga0466971_0003822 3300044719 Bacteria 6446
250 Ga0466971_0008961 3300044719 Bacteria 4373
251 Ga0466971_0021620 3300044719 Bacteria 2863
252 Ga0466970_0002948 3300044765 Bacteria 8250
253 Ga0466970_0015380 3300044765 Bacteria 3934
254 Ga0466970_0054939 3300044765 Bacteria 2126
255 Ga0466957_0001168 3300044842 Bacteria 13617
256 Ga0466957_0031330 3300044842 Bacteria 3178
257 Ga0466957_0037490 3300044842 Bacteria 2919
258 Ga0466957_0104339 3300044842 Bacteria 1790
259 Ga0466960_0001904 3300044901 Bacteria 7686
260 Ga0466959_0024752 3300045049 Bacteria 4446
261 Ga0466959_0072195 3300045049 Bacteria 2498
262 Ga0466959_0084166 3300045049 Bacteria 2289
263 Ga0466959_0125165 3300045049 Bacteria 1824
264 Ga0451576_0089084 3300045051 Bacteria 3209
265 Ga0466958_0001123 3300045836 Bacteria 12364
266 Ga0466967_0048267 3300045976 Bacteria 3716
267 Ga0495617_001315 3300046452 Bacteria 11051
268 Ga0495617_002434 3300046452 Bacteria 7400
269 Ga0495617_023163 3300046452 Bacteria 2098
270 Ga0495603_0028339 3300046455 Bacteria 3377
271 Ga0495590_0000014 3300046457 Bacteria 258314
272 Ga0495590_0017152 3300046457 Bacteria 2609
273 Ga0495590_0023417 3300046457 Bacteria 2180
274 Ga0495629_0005208 3300046459 Bacteria 9737
275 Ga0495629_0016916 3300046459 Bacteria 5234
276 Ga0495638_0000064 3300046460 Bacteria 180807
277 Ga0495638_0003897 3300046460 Bacteria 11547
278 Ga0495638_0042171 3300046460 Bacteria 2883
279 Ga0495653_0001718 3300046463 Bacteria 17248
280 Ga0495650_0003545 3300046471 Bacteria 11302
281 Ga0495580_0000910 3300046472 Bacteria 25805
282 Ga0495580_0102581 3300046472 Bacteria 1989
283 Ga0495605_0006865 3300046474 Bacteria 6501
284 Ga0495584_0000081 3300046491 Bacteria 67551
285 Ga0495584_0001216 3300046491 Bacteria 15722
286 Ga0495584_0019190 3300046491 Bacteria 3473
287 Ga0495584_0020465 3300046491 Bacteria 3361
288 Ga0495584_0089728 3300046491 Bacteria 1550
289 Ga0495585_0000043 3300046492 Bacteria 125158
290 Ga0495585_0020045 3300046492 Bacteria 3847
291 Ga0495585_0024092 3300046492 Bacteria 3491
292 Ga0495585_0026531 3300046492 Bacteria 3309
293 Ga0495585_0061006 3300046492 Bacteria 2074
294 Ga0495585_0085497 3300046492 Bacteria 1704
295 Ga0495585_0102616 3300046492 Bacteria 1528
296 Ga0495594_0045931 3300046499 Bacteria 2398
297 Ga0495596_0000134 3300046500 Bacteria 51163
298 Ga0495596_0001260 3300046500 Bacteria 14667
299 Ga0495607_0001880 3300046501 Bacteria 17817
300 Ga0495607_0002602 3300046501 Bacteria 14512
301 Ga0495607_0019103 3300046501 Bacteria 4357
302 Ga0495607_0036067 3300046501 Bacteria 2984
303 Ga0495583_0000044 3300046506 Bacteria 226264
304 Ga0495583_0000091 3300046506 Bacteria 158961
305 Ga0495583_0000285 3300046506 Bacteria 80736
306 Ga0495583_0000550 3300046506 Bacteria 52418
307 Ga0495583_0010471 3300046506 Bacteria 5403
308 Ga0495583_0021097 3300046506 Bacteria 3356
309 Ga0495583_0071954 3300046506 Bacteria 1518
310 Ga0495583_0090022 3300046506 Bacteria 1322
311 Ga0495606_0000480 3300046507 Bacteria 65473
312 Ga0495606_0001718 3300046507 Bacteria 28163
313 Ga0495606_0003673 3300046507 Bacteria 16070
314 Ga0495606_0006901 3300046507 Bacteria 10334
315 Ga0495606_0013298 3300046507 Bacteria 6518
316 Ga0495606_0074064 3300046507 Bacteria 2134
317 Ga0495606_0102802 3300046507 Bacteria 1737
318 Ga0495610_0013400 3300046512 Bacteria 4874
319 Ga0495616_0001905 3300046513 Bacteria 14068
320 Ga0495616_0002592 3300046513 Bacteria 11893
321 Ga0495616_0004950 3300046513 Bacteria 8317
322 Ga0495616_0007747 3300046513 Bacteria 6415
323 Ga0495628_0041780 3300046516 Bacteria 3660
324 Ga0495628_0042137 3300046516 Bacteria 3642
325 Ga0495630_0000001 3300046517 Bacteria 1687293
326 Ga0495630_0054611 3300046517 Bacteria 2992
327 Ga0495630_0247697 3300046517 Bacteria 1361
328 Ga0495643_0000365 3300046522 Bacteria 61592
329 Ga0495644_0001279 3300046523 Bacteria 10310
330 Ga0495644_0001566 3300046523 Bacteria 9320
331 Ga0495648_0000006 3300046524 Bacteria 361208
332 Ga0495648_0000073 3300046524 Bacteria 130626
333 Ga0495648_0001777 3300046524 Bacteria 20744
334 Ga0495648_0051681 3300046524 Bacteria 2502
335 Ga0495663_0010133 3300046525 Bacteria 2617
336 Ga0495666_0032394 3300046526 Bacteria 2558
337 Ga0495666_0079131 3300046526 Bacteria 1556
338 Ga0495642_0001621 3300046528 Bacteria 9809
339 Ga0495642_0006966 3300046528 Bacteria 4337
340 Ga0495642_0007595 3300046528 Bacteria 4154
341 Ga0495652_0071034 3300046529 Bacteria 2908
342 Ga0495652_0187663 3300046529 Bacteria 1580
343 Ga0495654_0071163 3300046530 Bacteria 1648
344 Ga0495665_0023259 3300046531 Bacteria 3327
345 Ga0495665_0165673 3300046531 Bacteria 1151
346 Ga0495586_0017525 3300046535 Bacteria 3807
347 Ga0495586_0039073 3300046535 Bacteria 2550
348 Ga0495586_0062819 3300046535 Bacteria 2022
349 Ga0495609_0000071 3300046538 Bacteria 126994
350 Ga0495609_0003878 3300046538 Bacteria 8392
351 Ga0495609_0010790 3300046538 Bacteria 4369
352 Ga0495609_0024819 3300046538 Bacteria 2748
353 Ga0495609_0046764 3300046538 Bacteria 1937
354 Ga0495597_0003453 3300046542 Bacteria 9212
355 Ga0495597_0024943 3300046542 Bacteria 2756
356 Ga0495597_0034291 3300046542 Bacteria 2293
357 Ga0495597_0080545 3300046542 Bacteria 1393
358 Ga0495622_0000013 3300046557 Bacteria 186778
359 Ga0495622_0000951 3300046557 Bacteria 15517
360 Ga0495622_0004768 3300046557 Bacteria 6280
361 Ga0495622_0064190 3300046557 Bacteria 1698
362 Ga0495633_0000158 3300046558 Bacteria 88850
363 Ga0495633_0005686 3300046558 Bacteria 7546
364 Ga0495633_0017239 3300046558 Bacteria 3699
365 Ga0495633_0041382 3300046558 Bacteria 2191
366 Ga0495668_0000599 3300046616 Bacteria 43861
367 Ga0495668_0004664 3300046616 Bacteria 9621
368 Ga0495668_0032853 3300046616 Bacteria 2917
369 Ga0495668_0092185 3300046616 Bacteria 1659
370 Ga0495611_0005416 3300046648 Bacteria 5458
371 Ga0495611_0009285 3300046648 Bacteria 4152
372 Ga0495611_0038671 3300046648 Bacteria 2122
373 Ga0495625_0000455 3300046660 Bacteria 61315
374 Ga0495625_0009656 3300046660 Bacteria 8042
375 Ga0495625_0012997 3300046660 Bacteria 6718
376 Ga0495625_0045780 3300046660 Bacteria 3160
377 Ga0495625_0075182 3300046660 Bacteria 2364
378 Ga0495659_0000844 3300046664 Bacteria 10887
379 Ga0495661_0006829 3300046665 Bacteria 7991
380 Ga0495661_0108598 3300046665 Bacteria 1550
381 Ga0495661_0113699 3300046665 Bacteria 1505
382 Ga0495661_0146160 3300046665 Bacteria 1281
383 Ga0495588_0006470 3300046674 Bacteria 5279
384 Ga0495588_0034745 3300046674 Bacteria 2551
385 Ga0495588_0074139 3300046674 Bacteria 1772
386 Ga0495599_0052045 3300046678 Bacteria 2565
387 Ga0495623_0040563 3300046679 Bacteria 2973
388 Ga0495623_0190981 3300046679 Bacteria 1183
389 Ga0495669_0026808 3300046684 Bacteria 2518
390 Ga0495613_0003033 3300046689 Bacteria 12563
391 Ga0495613_0049658 3300046689 Bacteria 3095
392 Ga0495613_0149106 3300046689 Bacteria 1669
393 Ga0495624_0000147 3300046690 Bacteria 51251
394 Ga0495670_0007425 3300046691 Bacteria 5380
395 Ga0495670_0016479 3300046691 Bacteria 3632
396 Ga0495670_0025526 3300046691 Bacteria 2923
397 Ga0495670_0040699 3300046691 Bacteria 2318
398 Ga0495670_0045354 3300046691 Bacteria 2194
399 Ga0495670_0075078 3300046691 Bacteria 1715
400 Ga0495670_0078154 3300046691 Bacteria 1683
401 Ga0495671_0040932 3300046692 Bacteria 2335
402 Ga0495671_0053108 3300046692 Bacteria 2012
403 Ga0495649_0033355 3300046694 Bacteria 2834
404 Ga0495649_0071915 3300046694 Bacteria 1854
405 Ga0495649_0073483 3300046694 Bacteria 1832
406 Ga0495649_0171106 3300046694 Bacteria 1136
407 Ga0495589_0077678 3300046794 Bacteria 1617
408 Ga0495660_0024041 3300046810 Bacteria 3472
409 Ga0495581_0007614 3300047315 Bacteria 6263
410 Ga0495604_0047021 3300047317 Bacteria 3362
411 Ga0495604_0058472 3300047317 Bacteria 2960
412 Ga0495636_0001112 3300047318 Bacteria 10118
413 Ga0495636_0003877 3300047318 Bacteria 5835
414 Ga0495674_0122865 3300047319 Bacteria 2192
415 Ga0495672_0006157 3300047320 Bacteria 9360
416 Ga0495672_0012332 3300047320 Bacteria 5970
417 Ga0495672_0046692 3300047320 Bacteria 2581
418 Ga0495676_0004487 3300047321 Bacteria 12757
419 Ga0495676_0110379 3300047321 Bacteria 2019
420 Ga0495683_0000969 3300047323 Bacteria 20094
421 Ga0495683_0049520 3300047323 Bacteria 2104
422 Ga0495683_0063291 3300047323 Bacteria 1828
423 Ga0495687_000042 3300047443 Bacteria 218868
424 Ga0495677_0001766 3300047445 Bacteria 8658
425 Ga0495677_0002095 3300047445 Bacteria 7936
426 Ga0495677_0016724 3300047445 Bacteria 2660
427 Ga0495679_010943 3300047446 Bacteria 3531
428 Ga0495685_000341 3300047447 Bacteria 14973
429 Ga0495673_0010318 3300047469 Bacteria 5090
430 Ga0495681_0008026 3300047470 Bacteria 6658
431 Ga0495681_0012102 3300047470 Bacteria 5085
432 Ga0495686_0000580 3300047472 Bacteria 51823
433 Ga0495593_0004594 3300047673 Bacteria 8209
434 Ga0495602_0086180 3300048088 Bacteria 2622
435 Ga0495615_0017104 3300048090 Bacteria 1575
436 Ga0495626_0006668 3300048091 Bacteria 6545
437 Ga0495626_0013581 3300048091 Bacteria 4229
438 Ga0496104_0159979 3300048907 Bacteria 2160
439 Ga0496115_0036861 3300048918 Bacteria 3873
440 Ga0496115_0192942 3300048918 Bacteria 1683
441 Ga0496121_0020505 3300048924 Bacteria 6537
442 Ga0496124_0225590 3300048927 Bacteria 1405
443 Ga0496126_0000073 3300048929 Bacteria 236027
444 Ga0495678_008175 3300049459 Bacteria 5315
445 Ga0495682_0000485 3300049460 Bacteria 27422
446 Ga0495682_0002581 3300049460 Bacteria 8509
447 Ga0495682_0055116 3300049460 Bacteria 1442
448 Ga0501033_0115066 3300049570 Bacteria 1955
449 Ga0501034_0318326 3300049571 Bacteria 1489
450 Ga0501043_0219118 3300049579 Bacteria 1473
451 Ga0501227_011348 3300049665 Bacteria 1940
452 Ga0501257_000110 3300049686 Bacteria 19204
453 Ga0501269_000443 3300049766 Bacteria 9201
454 Ga0501279_003883 3300049775 Bacteria 1955
455 Ga0501280_001970 3300049776 Bacteria 3575
456 Ga0501044_0312321 3300049823 Bacteria 1498
457 nmdc:mga03n38_10251_c1 3300050490 Bacteria 3439
458 Ga0500643_000153 3300053087 Bacteria 69793
459 Ga0500592_000707 3300053116 Bacteria 5486
460 Ga0500604_0041385 3300053151 Bacteria 1393
461 Ga0500627_0000092 3300053158 Bacteria 30073
462 Ga0500637_0060650 3300053178 Bacteria 2166
463 Ga0466962_0000920 3300061719 Bacteria 13348
464 2501076077 2501025501 Bacteria 7768574
465 2501085208 2501025502 Bacteria 9641094
466 2501409609 2501025504 Bacteria 8008976
467 2511090634 2510917013 Bacteria 9951648
468 2511099139 2510917014 Bacteria 8296963
469 2511108757 2510917015 Bacteria 7950052
470 2512346666 2512047030 Bacteria 9031815
471 2513553768 2513237082 Bacteria 8640282
472 2513560445 2513237083 Bacteria 8410967
473 2514051327 2513237166 Bacteria 10373764
474 2515681447 2515154122 Bacteria 8609520
475 2515690260 2515154123 Bacteria 6387382
476 2516019071 2515154189 Bacteria 9629850
477 2519460376 2519103095 Bacteria 6629912
478 2527077544 2526164713 Bacteria 6780608
479 2554816367 2554235132 Bacteria 6772433
480 2585292679 2582581311 Bacteria 6763856
481 2599741446 2599185239 Bacteria 8686614
482 2599748761 2599185240 Bacteria 7968121
483 2600210694 2599185355 Bacteria 7968906
484 2600811365 2600255067 Bacteria 6795583
485 2608382584 2606217733 Bacteria 6360972
486 2643792797 2643221554 Bacteria 6603920
487 2644212412 2643221638 Bacteria 6579467
488 2644254947 2643221645 Bacteria 7207331
489 2676746921 2675903129 Bacteria 7964495
490 2746088363 2744054900 Bacteria 8399525
491 2746096742 2744054901 Bacteria 8397047
492 2792836662 2791355137 Bacteria 9654227
493 2817257832 2816332253 Bacteria 6764532
494 2817281776 2816332256 Bacteria 6891714
495 2817455967 2816332286 Bacteria 6853759
496 2819635115 2818991452 Bacteria 8442785
497 2834643949 2834641062 Bacteria 5559922
498 2863427170 2863421361 Bacteria 7300805
499 2870073629 2870068957 Bacteria 8925310
500 2883087695 2883087390 Bacteria 9532701
501 2891636519 2891633521 Bacteria 4602265
502 2902686105 2902682994 Bacteria 8951596
503 2904427997 2904424332 Bacteria 7633521
504 2904570928 2904564687 Bacteria 7609577
505 2904578118 2904571731 Bacteria 7608790
506 2928158306 2928157003 Bacteria 7522202
507 2928167486 2928163908 Bacteria 7561269
508 2928178337 2928170801 Bacteria 8785406
509 2928543022 2928536128 Bacteria 7657547
510 2981991768 2981990288 Bacteria 7590678
511 639787453 639633007 Bacteria 4376040
512 642414567 641736154 Bacteria 7689995
513 8003958072 8003955200 Bacteria 8601927
514 8011351940 8011350971 Bacteria 6158957
515 8018852514 8018845410 Bacteria 8933938
516 8020810965 8020807995 Bacteria 6801506
517 8020943366 8020938398 Bacteria 7472757
518 8020952732 8020945358 Bacteria 8467355
519 8020954557 8020953355 Bacteria 7439080
520 8021123792 8021120328 Bacteria 8782274
521 8039100628 8039098773 Bacteria 6602928
522 8040170790 8040167225 Bacteria 6542727
523 8040176995 8040173305 Bacteria 6827067
524 8055269862 8055266321 Bacteria 7999742
525 Ga0105251_10067045
526 JGI25154J39366_1000780
527 JGI25158J39367_1000365
528 JGI25158J39367_1006645
529 JGI25152J39213_1000014
530 JGI25150J39212_1008119
531 JGI25159J45721_1005352
532 JGI25153J46596_10006726
533 rootH1_10013178
534 rootL2_10212688
535 JGI25161J50226_1000418
536 JGI25161J50226_1001426
537 Ga0055532_1000422
538 Ga0055532_1000548
539 Ga0055532_1001192
540 Ga0055527_1000288
541 Ga0055527_1000354
542 Ga0055535_1000604
543 Ga0055535_1000803
544 Ga0055542_1000633
545 Ga0055542_1001342
546 Ga0055529_1000568
547 Ga0055526_1000088
548 Ga0055526_1001131
549 Ga0055526_1001138
550 Ga0055526_1009410
551 Ga0055526_1026197
552 Ga0055537_1000065
553 Ga0055537_1002611
554 Ga0055537_1003612
555 Ga0055524_1000998
556 Ga0055524_1001292
557 Ga0055524_1002090
558 Ga0055534_1000357
559 Ga0055534_1000753
560 Ga0055534_1005156
561 Ga0055528_1000565
562 Ga0055528_1001220
563 Ga0055528_1004229
564 Ga0055530_10001057
565 Ga0055530_10006848
566 Ga0055530_10017920
567 Ga0055531_10000831
568 Ga0055531_10017529
569 Ga0055543_1003938
570 Ga0065165_1005365
571 Ga0070658_10002676
572 Ga0070658_10103686
573 Ga0070670_100019210
574 Ga0070666_10012291
575 Ga0070660_100000006
576 Ga0070660_100009449
577 Ga0070689_100001219
578 Ga0070661_100021258
579 Ga0070659_100001370
580 Ga0070659_100071098
581 Ga0070667_100040927
582 Ga0070663_100001153
583 Ga0070663_100044813
584 Ga0068867_100239771
585 Ga0070685_10002632
586 Ga0070686_100192041
587 Ga0070665_100000469
588 Ga0070665_100352134
589 Ga0068855_100026533
590 Ga0068854_100201992
591 Ga0068852_100070632
592 Ga0068851_10002957
593 Ga0068863_100040972
594 Ga0068863_100348204
595 Ga0068858_100000371
596 Ga0075363_100037726
597 Ga0075428_100541800
598 Ga0079104_1004547
599 Ga0105244_10004369
600 Ga0105250_10007094
601 Ga0105240_10002065
602 Ga0105240_10002853
603 Ga0105240_10046548
604 Ga0105237_10013238
605 Ga0105237_10026569
606 Ga0105237_10077832
607 Ga0105249_10123238
608 Ga0105239_10016039
609 Ga0157373_10016396
610 Ga0157371_10006292
611 Ga0157370_10013487
612 Ga0157369_10000790
613 Ga0157369_10006130
614 Ga0157369_10088454
615 Ga0157369_10138239
616 Ga0157374_10000099
617 Ga0157376_10210054
618 Ga0182006_1000059
619 Ga0182007_10001843
620 Ga0182005_1000006
621 Ga0206356_11229641
622 Ga0206354_10593810
623 Ga0206354_11266040
624 Ga0213872_10004913
625 Ga0224712_10006020
626 Ga0209436_100078
627 Ga0209436_100612
628 Ga0209566_102678
629 Ga0209672_100020
630 Ga0209672_100066
631 Ga0209672_100618
632 Ga0209147_100024
633 Ga0209147_100084
634 Ga0209147_100562
635 Ga0209258_100084
636 Ga0209258_100117
637 Ga0207425_1000009
638 Ga0207425_1000068
639 Ga0207425_1018176
640 Ga0209026_1003655
641 Ga0209148_1000442
642 Ga0209148_1000644
643 Ga0209129_1000061
644 Ga0209129_1001146
645 Ga0209233_1002786
646 Ga0209565_1000032
647 Ga0209565_1000342
648 Ga0209565_1000669
649 Ga0209565_1002472
650 Ga0209455_1000110
651 Ga0209455_1001559
652 Ga0209673_1000029
653 Ga0209673_1000057
654 Ga0209673_1015553
655 Ga0209130_1000721
656 Ga0209675_1000019
657 Ga0209675_1000519
658 Ga0209675_1000974
659 Ga0209564_1000067
660 Ga0209564_1000115
661 Ga0209564_1001163
662 Ga0209564_1012651
663 Ga0209758_1000101
664 Ga0209050_1000040
665 Ga0209050_1000123
666 Ga0209050_1000573
667 Ga0209256_1000058
668 Ga0209256_1000142
669 Ga0209256_1001315
670 Ga0209256_1005917
671 Ga0209051_1020895
672 Ga0209257_1000054
673 Ga0209257_1018450
674 Ga0207656_10004110
675 Ga0207647_10001649
676 Ga0207647_10001945
677 Ga0207647_10016518
678 Ga0207705_10036367
679 Ga0207695_10000014
680 Ga0207695_10001034
681 Ga0207695_10019698
682 Ga0207695_10054393
683 Ga0207695_10173664
684 Ga0207671_10008637
685 Ga0207657_10000003
686 Ga0207657_10023961
687 Ga0207649_10121934
688 Ga0207650_10009708
689 Ga0207690_10000007
690 Ga0207690_10048221
691 Ga0207706_10006847
692 Ga0207670_10006038
693 Ga0207667_10041981
694 Ga0207667_10072743
695 Ga0207667_10271817
696 Ga0207712_10000390
697 Ga0207640_10016782
698 Ga0207658_10113301
699 Ga0207703_10002672
700 Ga0207639_10003799
701 Ga0207678_10001379
702 Ga0207678_10006736
703 Ga0207641_10062707
704 Ga0207648_10067415
705 Ga0207698_10011379
706 Ga0209371_1000255
707 Ga0268266_10000007
708 Ga0268264_10261418
709 Ga0265337_1004474
710 Ga0265338_10000713
711 Ga0265338_10001292
712 Ga0268256_1000210
713 Ga0316182_1008330
714 Ga0265327_10000005
715 Ga0307408_100000491
716 Ga0307408_100000525
717 Ga0307408_100001430
718 Ga0307408_100047166
719 Ga0307408_100102050
720 Ga0307406_10294415
721 Ga0307412_10150224
722 Ga0307416_100018769
723 Ga0373942_0016341
724 Ga0395899_0000003
725 Ga0395899_0000019
726 Ga0395899_0000193
727 Ga0395899_0023701
728 Ga0395899_0023807
729 Ga0395899_0108960
730 Ga0395899_0113212
731 Ga0395900_0000219
732 Ga0395900_0001739
733 Ga0395900_0005065
734 Ga0395900_0048379
735 Ga0395900_0052200
736 Ga0395900_0164758
737 Ga0395898_0000469
738 Ga0395898_0000950
739 Ga0395898_0003107
740 Ga0395898_0071830
741 Ga0395901_0000148
742 Ga0395901_0000175
743 Ga0395901_0010201
744 Ga0395901_0041241
745 Ga0395901_0054925
746 Ga0395901_0063980
747 Ga0395901_0212085
748 Ga0395901_0215447
749 Ga0436361_0538088
750 Ga0436361_0992955
751 Ga0466969_0005791
752 Ga0466969_0015455
753 Ga0466972_0000191
754 Ga0466972_0031888
755 Ga0466978_0068917
756 Ga0466966_0000246
757 Ga0466966_0001670
758 Ga0466966_0022419
759 Ga0466966_0034387
760 Ga0466961_0000128
761 Ga0466961_0000207
762 Ga0466961_0000521
763 Ga0466961_0000913
764 Ga0466961_0003535
765 Ga0466961_0008104
766 Ga0466961_0080378
767 Ga0466961_0101580
768 Ga0466963_0002350
769 Ga0466963_0010478
770 Ga0466963_0015650
771 Ga0466964_0005398
772 Ga0466971_0002822
773 Ga0466971_0003822
774 Ga0466971_0008961
775 Ga0466971_0021620
776 Ga0466970_0002948
777 Ga0466970_0015380
778 Ga0466970_0054939
779 Ga0466957_0001168
780 Ga0466957_0031330
781 Ga0466957_0037490
782 Ga0466957_0104339
783 Ga0466960_0001904
784 Ga0466959_0024752
785 Ga0466959_0072195
786 Ga0466959_0084166
787 Ga0466959_0125165
788 Ga0451576_0089084
789 Ga0466958_0001123
790 Ga0466967_0048267
791 Ga0495617_001315
792 Ga0495617_002434
793 Ga0495617_023163
794 Ga0495603_0028339
795 Ga0495590_0000014
796 Ga0495590_0017152
797 Ga0495590_0023417
798 Ga0495629_0005208
799 Ga0495629_0016916
800 Ga0495638_0000064
801 Ga0495638_0003897
802 Ga0495638_0042171
803 Ga0495653_0001718
804 Ga0495650_0003545
805 Ga0495580_0000910
806 Ga0495580_0102581
807 Ga0495605_0006865
808 Ga0495584_0000081
809 Ga0495584_0001216
810 Ga0495584_0019190
811 Ga0495584_0020465
812 Ga0495584_0089728
813 Ga0495585_0000043
814 Ga0495585_0020045
815 Ga0495585_0024092
816 Ga0495585_0026531
817 Ga0495585_0061006
818 Ga0495585_0085497
819 Ga0495585_0102616
820 Ga0495594_0045931
821 Ga0495596_0000134
822 Ga0495596_0001260
823 Ga0495607_0001880
824 Ga0495607_0002602
825 Ga0495607_0019103
826 Ga0495607_0036067
827 Ga0495583_0000044
828 Ga0495583_0000091
829 Ga0495583_0000285
830 Ga0495583_0000550
831 Ga0495583_0010471
832 Ga0495583_0021097
833 Ga0495583_0071954
834 Ga0495583_0090022
835 Ga0495606_0000480
836 Ga0495606_0001718
837 Ga0495606_0003673
838 Ga0495606_0006901
839 Ga0495606_0013298
840 Ga0495606_0074064
841 Ga0495606_0102802
842 Ga0495610_0013400
843 Ga0495616_0001905
844 Ga0495616_0002592
845 Ga0495616_0004950
846 Ga0495616_0007747
847 Ga0495628_0041780
848 Ga0495628_0042137
849 Ga0495630_0000001
850 Ga0495630_0054611
851 Ga0495630_0247697
852 Ga0495643_0000365
853 Ga0495644_0001279
854 Ga0495644_0001566
855 Ga0495648_0000006
856 Ga0495648_0000073
857 Ga0495648_0001777
858 Ga0495648_0051681
859 Ga0495663_0010133
860 Ga0495666_0032394
861 Ga0495666_0079131
862 Ga0495642_0001621
863 Ga0495642_0006966
864 Ga0495642_0007595
865 Ga0495652_0071034
866 Ga0495652_0187663
867 Ga0495654_0071163
868 Ga0495665_0023259
869 Ga0495665_0165673
870 Ga0495586_0017525
871 Ga0495586_0039073
872 Ga0495586_0062819
873 Ga0495609_0000071
874 Ga0495609_0003878
875 Ga0495609_0010790
876 Ga0495609_0024819
877 Ga0495609_0046764
878 Ga0495597_0003453
879 Ga0495597_0024943
880 Ga0495597_0034291
881 Ga0495597_0080545
882 Ga0495622_0000013
883 Ga0495622_0000951
884 Ga0495622_0004768
885 Ga0495622_0064190
886 Ga0495633_0000158
887 Ga0495633_0005686
888 Ga0495633_0017239
889 Ga0495633_0041382
890 Ga0495668_0000599
891 Ga0495668_0004664
892 Ga0495668_0032853
893 Ga0495668_0092185
894 Ga0495611_0005416
895 Ga0495611_0009285
896 Ga0495611_0038671
897 Ga0495625_0000455
898 Ga0495625_0009656
899 Ga0495625_0012997
900 Ga0495625_0045780
901 Ga0495625_0075182
902 Ga0495659_0000844
903 Ga0495661_0006829
904 Ga0495661_0108598
905 Ga0495661_0113699
906 Ga0495661_0146160
907 Ga0495588_0006470
908 Ga0495588_0034745
909 Ga0495588_0074139
910 Ga0495599_0052045
911 Ga0495623_0040563
912 Ga0495623_0190981
913 Ga0495669_0026808
914 Ga0495613_0003033
915 Ga0495613_0049658
916 Ga0495613_0149106
917 Ga0495624_0000147
918 Ga0495670_0007425
919 Ga0495670_0016479
920 Ga0495670_0025526
921 Ga0495670_0040699
922 Ga0495670_0045354
923 Ga0495670_0075078
924 Ga0495670_0078154
925 Ga0495671_0040932
926 Ga0495671_0053108
927 Ga0495649_0033355
928 Ga0495649_0071915
929 Ga0495649_0073483
930 Ga0495649_0171106
931 Ga0495589_0077678
932 Ga0495660_0024041
933 Ga0495581_0007614
934 Ga0495604_0047021
935 Ga0495604_0058472
936 Ga0495636_0001112
937 Ga0495636_0003877
938 Ga0495674_0122865
939 Ga0495672_0006157
940 Ga0495672_0012332
941 Ga0495672_0046692
942 Ga0495676_0004487
943 Ga0495676_0110379
944 Ga0495683_0000969
945 Ga0495683_0049520
946 Ga0495683_0063291
947 Ga0495687_000042
948 Ga0495677_0001766
949 Ga0495677_0002095
950 Ga0495677_0016724
951 Ga0495679_010943
952 Ga0495685_000341
953 Ga0495673_0010318
954 Ga0495681_0008026
955 Ga0495681_0012102
956 Ga0495686_0000580
957 Ga0495593_0004594
958 Ga0495602_0086180
959 Ga0495615_0017104
960 Ga0495626_0006668
961 Ga0495626_0013581
962 Ga0496104_0159979
963 Ga0496115_0036861
964 Ga0496115_0192942
965 Ga0496121_0020505
966 Ga0496124_0225590
967 Ga0496126_0000073
968 Ga0495678_008175
969 Ga0495682_0000485
970 Ga0495682_0002581
971 Ga0495682_0055116
972 Ga0501033_0115066
973 Ga0501034_0318326
974 Ga0501043_0219118
975 Ga0501227_011348
976 Ga0501257_000110
977 Ga0501269_000443
978 Ga0501279_003883
979 Ga0501280_001970
980 Ga0501044_0312321
981 nmdc:mga03n38_10251_c1
982 Ga0500643_000153
983 Ga0500592_000707
984 Ga0500604_0041385
985 Ga0500627_0000092
986 Ga0500637_0060650
987 Ga0466962_0000920
988 2501076077
989 2501085208
990 2501409609
991 2511090634
992 2511099139
993 2511108757
994 2512346666
995 2513553768
996 2513560445
997 2514051327
998 2515681447
999 2515690260
1000 2516019071
1001 2519460376
1002 2527077544
1003 2554816367
1004 2585292679
1005 2599741446
1006 2599748761
1007 2600210694
1008 2600811365
1009 2608382584
1010 2643792797
1011 2644212412
1012 2644254947
1013 2676746921
1014 2746088363
1015 2746096742
1016 2792836662
1017 2817257832
1018 2817281776
1019 2817455967
1020 2819635115
1021 2834643949
1022 2863427170
1023 2870073629
1024 2883087695
1025 2891636519
1026 2902686105
1027 2904427997
1028 2904570928
1029 2904578118
1030 2928158306
1031 2928167486
1032 2928178337
1033 2928543022
1034 2981991768
1035 639787453
1036 642414567
1037 8003958072
1038 8011351940
1039 8018852514
1040 8020810965
1041 8020943366
1042 8020952732
1043 8020954557
1044 8021123792
1045 8039100628
1046 8040170790
1047 8040176995
1048 8055269862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9029 1 359
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.8932 1 359
7bid-assembly1.cif.gz_A crystal structure of v31wrap-t, a 7-bladed designer protein 0.8054 4 361
6r5z-assembly2.cif.gz_E 9-bladed beta-propeller formed by three 3-bladed fragments 0.7988 214 350
7bid-assembly1.cif.gz_A crystal structure of v31wrap-t, a 7-bladed designer protein 0.7926 4 361
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8769 1 359 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8558 1 359 2.130.10.10
af_B7F947_251_373_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8141 96 178 2.130.10.10
af_Q09150_1_302_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.78 33 362 2.130.10.10
1gxrB00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7799 32 358 2.130.10.10
ID Description Score Start End GO Terms
AF-W7WVM7-F1-model_v4 deleted 0.9946 288 362
AF-A0A7W1AJI8-F1-model_v4 Exo-alpha-sialidase 0.9893 175 362 GO:0000272
GO:0016798
AF-U2H512-F1-model_v4 Exo-alpha-sialidase 0.9883 111 362 GO:0000272
GO:0010411
GO:0016798
AF-A0A847ZS93-F1-model_v4 Exo-alpha-sialidase 0.9871 1 167 GO:0000272
GO:0010411
GO:0016798
AF-A0A536WV05-F1-model_v4 Exo-alpha-sialidase 0.987 48 362 GO:0000272
GO:0010411
GO:0016798

Map