F459097

General Info

Members Datasets Scaffolds Average Seq Length
524 231 1048 252

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100001486|Ga0070689_1000014868
Length 284
Sequence VSSIDPKTFRYALDAGVATITLTRPERLNSLTFAVYEELADTIAALDAHDEVRAVVITGEGRAFCSGGDVEDIIGELFARDMQGLVAFTRVTGRLIANLRKVRRPIVAAVNGVAVGAGAVIALACDFRVAADTAKFGFIFPKVGLCGADMGAAYLLPRVVGLARASELLFLGDVIGAEEAQRIGLVTRVVPAAECVAQAEGLAARLASGPAFAHAMTKQMLESEHTMALDAAIEAEAQAQAICMQHPDFRTAYDAWVAKKPIHFAGASTPFQTQTASPPLGRPK

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.96
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 1.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100001486 3300005340 Bacteria 14958
2 Ga0070658_10143573 3300005327 Bacteria 1995
3 Ga0070676_10038379 3300005328 Bacteria 2766
4 Ga0070683_100093633 3300005329 Bacteria 2823
5 Ga0070683_100205799 3300005329 Bacteria 1869
6 Ga0068869_100077770 3300005334 Bacteria 2469
7 Ga0070680_100122852 3300005336 Bacteria 2168
8 Ga0070680_100221570 3300005336 Bacteria 1597
9 Ga0070680_100428249 3300005336 Bacteria 1129
10 Ga0070689_100000065 3300005340 Bacteria 62971
11 Ga0070689_100013536 3300005340 Bacteria 5905
12 Ga0070689_100067215 3300005340 Bacteria 2794
13 Ga0070689_100104961 3300005340 Bacteria 2241
14 Ga0070689_100107327 3300005340 Bacteria 2217
15 Ga0070691_10047186 3300005341 Bacteria 2048
16 Ga0070687_100063892 3300005343 Bacteria 1954
17 Ga0070668_100108980 3300005347 Bacteria 2203
18 Ga0070669_100039084 3300005353 Bacteria 3446
19 Ga0070669_100170878 3300005353 Bacteria 1694
20 Ga0070669_100347348 3300005353 Bacteria 1203
21 Ga0070675_100187849 3300005354 Bacteria 1789
22 Ga0070671_100005807 3300005355 Bacteria 9832
23 Ga0070674_100051074 3300005356 Bacteria 2848
24 Ga0070673_100105690 3300005364 Bacteria 2326
25 Ga0070673_100289438 3300005364 Unclassified 1439
26 Ga0070688_100000001 3300005365 Bacteria 106331
27 Ga0070688_100001057 3300005365 Bacteria 13847
28 Ga0070688_100016852 3300005365 Bacteria 4184
29 Ga0070688_100055687 3300005365 Bacteria 2481
30 Ga0070688_100091054 3300005365 Bacteria 1993
31 Ga0070659_100115273 3300005366 Bacteria 2172
32 Ga0070703_10002297 3300005406 Bacteria 5529
33 Ga0070703_10043886 3300005406 Bacteria 1404
34 Ga0070701_10044221 3300005438 Bacteria 2281
35 Ga0070711_100575279 3300005439 Bacteria 937
36 Ga0070700_100020750 3300005441 Bacteria 3812
37 Ga0070700_100093905 3300005441 Bacteria 1963
38 Ga0070700_100155130 3300005441 Bacteria 1570
39 Ga0070694_100020607 3300005444 Bacteria 4206
40 Ga0070694_100101796 3300005444 Bacteria 2033
41 Ga0070708_100063587 3300005445 Bacteria 3304
42 Ga0070708_100086506 3300005445 Bacteria 2847
43 Ga0070708_100210047 3300005445 Bacteria 1824
44 Ga0070708_100293944 3300005445 Bacteria 1529
45 Ga0070708_100301127 3300005445 Bacteria 1510
46 Ga0070708_100602189 3300005445 Bacteria 1036
47 Ga0070662_100000379 3300005457 Bacteria 26621
48 Ga0070662_100272838 3300005457 Bacteria 1366
49 Ga0070681_10156251 3300005458 Bacteria 2205
50 Ga0068867_100027767 3300005459 Bacteria 4071
51 Ga0068867_100076297 3300005459 Bacteria 2516
52 Ga0068867_100188448 3300005459 Bacteria 1644
53 Ga0070685_10002120 3300005466 Bacteria 10247
54 Ga0070706_100364876 3300005467 Bacteria 1345
55 Ga0070706_100418607 3300005467 Bacteria 1247
56 Ga0070706_100467261 3300005467 Unclassified 1174
57 Ga0070707_100065134 3300005468 Bacteria 3500
58 Ga0070707_100175677 3300005468 Bacteria 2087
59 Ga0070707_100185239 3300005468 Bacteria 2030
60 Ga0070707_100197132 3300005468 Bacteria 1963
61 Ga0070698_100028675 3300005471 Bacteria 5779
62 Ga0070698_100072591 3300005471 Bacteria 3450
63 Ga0070698_100110509 3300005471 Bacteria 2714
64 Ga0070699_100005049 3300005518 Bacteria 11615
65 Ga0070699_100082991 3300005518 Bacteria 2794
66 Ga0070699_100084184 3300005518 Bacteria 2775
67 Ga0070699_100151897 3300005518 Bacteria 2049
68 Ga0070699_100211739 3300005518 Bacteria 1725
69 Ga0070699_100428799 3300005518 Bacteria 1197
70 Ga0070679_100064157 3300005530 Bacteria 3661
71 Ga0070679_100190416 3300005530 Bacteria 2021
72 Ga0070684_100106069 3300005535 Bacteria 2515
73 Ga0070697_100001243 3300005536 Bacteria 19278
74 Ga0070697_100111062 3300005536 Bacteria 2285
75 Ga0070672_100226450 3300005543 Bacteria 1569
76 Ga0070686_100079753 3300005544 Bacteria 2164
77 Ga0070686_100169093 3300005544 Bacteria 1545
78 Ga0070686_100339548 3300005544 Bacteria 1125
79 Ga0070695_100099990 3300005545 Bacteria 1952
80 Ga0070696_100000408 3300005546 Bacteria 26747
81 Ga0070696_100150431 3300005546 Bacteria 1708
82 Ga0070693_100046852 3300005547 Bacteria 2457
83 Ga0070693_100082389 3300005547 Bacteria 1921
84 Ga0070693_100223194 3300005547 Bacteria 1236
85 Ga0070704_100020602 3300005549 Bacteria 4256
86 Ga0070704_100021497 3300005549 Bacteria 4184
87 Ga0070704_100035173 3300005549 Bacteria 3404
88 Ga0070704_100064400 3300005549 Bacteria 2635
89 Ga0070704_100289574 3300005549 Bacteria 1360
90 Ga0068855_100510011 3300005563 Bacteria 1306
91 Ga0068855_100514066 3300005563 Bacteria 1300
92 Ga0068855_100771474 3300005563 Bacteria 1024
93 Ga0070664_100150195 3300005564 Bacteria 2056
94 Ga0070664_100256766 3300005564 Bacteria 1572
95 Ga0068857_100029797 3300005577 Bacteria 4816
96 Ga0068854_100005043 3300005578 Bacteria 8319
97 Ga0068856_100059165 3300005614 Bacteria 3784
98 Ga0068856_100326845 3300005614 Bacteria 1551
99 Ga0070702_100008720 3300005615 Bacteria 4927
100 Ga0068859_100001677 3300005617 Bacteria 22553
101 Ga0068859_100046955 3300005617 Bacteria 4337
102 Ga0068864_100026867 3300005618 Bacteria 4854
103 Ga0068864_100040968 3300005618 Bacteria 3961
104 Ga0068864_100127007 3300005618 Bacteria 2286
105 Ga0068864_100133205 3300005618 Bacteria 2235
106 Ga0068861_100187453 3300005719 Bacteria 1726
107 Ga0068861_100561105 3300005719 Bacteria 1042
108 Ga0068863_100193262 3300005841 Bacteria 1956
109 Ga0068858_100015651 3300005842 Bacteria 7133
110 Ga0068858_100349819 3300005842 Bacteria 1416
111 Ga0068858_100358630 3300005842 Bacteria 1397
112 Ga0068860_100051001 3300005843 Bacteria 3938
113 Ga0068862_100033273 3300005844 Bacteria 4357
114 Ga0068862_100039798 3300005844 Bacteria 3994
115 Ga0081539_10000063 3300005985 Bacteria 248201
116 Ga0068871_100063916 3300006358 Bacteria 3011
117 Ga0075428_100150637 3300006844 Bacteria 2527
118 Ga0075428_100214958 3300006844 Bacteria 2077
119 Ga0075428_100306945 3300006844 Bacteria 1706
120 Ga0075428_100567968 3300006844 Bacteria 1212
121 Ga0075428_100608222 3300006844 Bacteria 1167
122 Ga0075430_100185646 3300006846 Bacteria 1729
123 Ga0075430_100207824 3300006846 Bacteria 1625
124 Ga0075430_100615801 3300006846 Bacteria 896
125 Ga0075431_100005891 3300006847 Bacteria 12127
126 Ga0075431_100233764 3300006847 Bacteria 1872
127 Ga0075431_100242335 3300006847 Bacteria 1834
128 Ga0075433_10000091 3300006852 Bacteria 42110
129 Ga0075433_10000099 3300006852 Bacteria 41634
130 Ga0075433_10024168 3300006852 Bacteria 5125
131 Ga0075433_10085168 3300006852 Bacteria 2790
132 Ga0075433_10085938 3300006852 Bacteria 2778
133 Ga0075433_10097287 3300006852 Bacteria 2605
134 Ga0075433_10123193 3300006852 Bacteria 2303
135 Ga0075433_10325278 3300006852 Bacteria 1360
136 Ga0075433_10443707 3300006852 Bacteria 1144
137 Ga0075433_10507647 3300006852 Bacteria 1061
138 Ga0075434_100000883 3300006871 Bacteria 23997
139 Ga0075434_100001827 3300006871 Bacteria 18379
140 Ga0075434_100003252 3300006871 Bacteria 14513
141 Ga0075434_100026495 3300006871 Bacteria 5680
142 Ga0075434_100090584 3300006871 Bacteria 3060
143 Ga0075434_100397899 3300006871 Bacteria 1398
144 Ga0075434_100411209 3300006871 Bacteria 1374
145 Ga0075434_100514046 3300006871 Bacteria 1218
146 Ga0075434_100662250 3300006871 Bacteria 1062
147 Ga0075429_100014188 3300006880 Bacteria 6906
148 Ga0075429_100018928 3300006880 Bacteria 5965
149 Ga0075429_100059303 3300006880 Bacteria 3333
150 Ga0075429_100087841 3300006880 Bacteria 2710
151 Ga0075429_100147598 3300006880 Bacteria 2058
152 Ga0075429_100533317 3300006880 Bacteria 1029
153 Ga0068865_100015123 3300006881 Bacteria 4916
154 Ga0075436_100002039 3300006914 Bacteria 13928
155 Ga0075436_100080065 3300006914 Bacteria 2263
156 Ga0075436_100089402 3300006914 Bacteria 2140
157 Ga0075436_100095925 3300006914 Bacteria 2063
158 Ga0097620_100001677 3300006931 Bacteria 22553
159 Ga0097620_100046955 3300006931 Bacteria 4337
160 Ga0097620_100065737 3300006931 Bacteria 3660
161 Ga0075435_100012858 3300007076 Bacteria 6207
162 Ga0075435_100155028 3300007076 Bacteria 1927
163 Ga0075435_100215972 3300007076 Bacteria 1628
164 Ga0075435_100404581 3300007076 Bacteria 1174
165 Ga0075435_100651027 3300007076 Bacteria 915
166 Ga0105240_10011734 3300009093 Bacteria 12173
167 Ga0111539_10021195 3300009094 Bacteria 8003
168 Ga0111539_10088213 3300009094 Bacteria 3645
169 Ga0111539_10147441 3300009094 Bacteria 2755
170 Ga0111539_10205454 3300009094 Bacteria 2296
171 Ga0111539_11094092 3300009094 Bacteria 926
172 Ga0105245_10000072 3300009098 Bacteria 105617
173 Ga0105245_10519897 3300009098 Bacteria 1209
174 Ga0105247_10003480 3300009101 Bacteria 10264
175 Ga0114129_10066265 3300009147 Bacteria 5038
176 Ga0114129_10077860 3300009147 Bacteria 4612
177 Ga0114129_10190236 3300009147 Bacteria 2787
178 Ga0114129_10217162 3300009147 Bacteria 2582
179 Ga0114129_10348328 3300009147 Bacteria 1963
180 Ga0114129_11010190 3300009147 Bacteria 1047
181 Ga0114129_11014680 3300009147 Bacteria 1044
182 Ga0105243_10052509 3300009148 Bacteria 3229
183 Ga0105241_10085960 3300009174 Bacteria 2473
184 Ga0105242_10043487 3300009176 Bacteria 3634
185 Ga0105242_10115687 3300009176 Bacteria 2293
186 Ga0105242_10200920 3300009176 Bacteria 1770
187 Ga0105248_10000791 3300009177 Bacteria 35518
188 Ga0105248_10006951 3300009177 Bacteria 12399
189 Ga0105248_10183259 3300009177 Bacteria 2359
190 Ga0105248_10183334 3300009177 Bacteria 2359
191 Ga0105249_10060565 3300009553 Bacteria 3473
192 Ga0105249_10090783 3300009553 Bacteria 2856
193 Ga0105239_10036370 3300010375 Bacteria 5406
194 Ga0105246_10216606 3300011119 Bacteria 1498
195 Ga0157378_10001449 3300013297 Bacteria 21378
196 Ga0163162_10229696 3300013306 Bacteria 1986
197 Ga0163162_10339489 3300013306 Bacteria 1635
198 Ga0163162_10561131 3300013306 Bacteria 1269
199 Ga0163163_10022239 3300014325 Bacteria 5999
200 Ga0163163_10076205 3300014325 Bacteria 3348
201 Ga0157380_10273833 3300014326 Bacteria 1540
202 Ga0157380_10416590 3300014326 Bacteria 1280
203 Ga0157377_10063639 3300014745 Bacteria 2113
204 Ga0157379_10010159 3300014968 Bacteria 8202
205 Ga0157379_10049257 3300014968 Bacteria 3761
206 Ga0157379_10079060 3300014968 Bacteria 2946
207 Ga0157376_10281424 3300014969 Bacteria 1566
208 Ga0157376_10628732 3300014969 Unclassified 1071
209 Ga0207653_10001903 3300025885 Bacteria 6680
210 Ga0207653_10020472 3300025885 Bacteria 2094
211 Ga0207653_10029884 3300025885 Bacteria 1756
212 Ga0207642_10032100 3300025899 Bacteria 2207
213 Ga0207710_10001825 3300025900 Bacteria 10270
214 Ga0207645_10007567 3300025907 Bacteria 7658
215 Ga0207643_10009719 3300025908 Bacteria 5161
216 Ga0207705_10134667 3300025909 Bacteria 1841
217 Ga0207684_10239347 3300025910 Bacteria 1566
218 Ga0207684_10479987 3300025910 Unclassified 1066
219 Ga0207654_10059529 3300025911 Bacteria 2228
220 Ga0207654_10114012 3300025911 Bacteria 1686
221 Ga0207707_10038195 3300025912 Bacteria 4196
222 Ga0207707_10254233 3300025912 Bacteria 1526
223 Ga0207695_10184048 3300025913 Bacteria 2009
224 Ga0207663_10278545 3300025916 Bacteria 1241
225 Ga0207663_10482283 3300025916 Bacteria 961
226 Ga0207660_10118760 3300025917 Bacteria 2000
227 Ga0207662_10000462 3300025918 Bacteria 18090
228 Ga0207652_10058678 3300025921 Bacteria 3316
229 Ga0207652_10145015 3300025921 Bacteria 2124
230 Ga0207652_10323434 3300025921 Bacteria 1392
231 Ga0207646_10010123 3300025922 Bacteria 9242
232 Ga0207646_10054934 3300025922 Bacteria 3562
233 Ga0207646_10098436 3300025922 Bacteria 2621
234 Ga0207646_10240894 3300025922 Bacteria 1634
235 Ga0207646_10263157 3300025922 Bacteria 1559
236 Ga0207681_10247528 3300025923 Bacteria 1390
237 Ga0207681_10333953 3300025923 Bacteria 1209
238 Ga0207650_10536907 3300025925 Bacteria 980
239 Ga0207659_10089030 3300025926 Bacteria 2301
240 Ga0207687_10002588 3300025927 Bacteria 12277
241 Ga0207687_10242126 3300025927 Bacteria 1430
242 Ga0207706_10001452 3300025933 Bacteria 23712
243 Ga0207706_10125781 3300025933 Bacteria 2255
244 Ga0207686_10044029 3300025934 Bacteria 2738
245 Ga0207709_10374158 3300025935 Bacteria 1082
246 Ga0207670_10000012 3300025936 Bacteria 246808
247 Ga0207670_10001835 3300025936 Bacteria 11080
248 Ga0207670_10031654 3300025936 Bacteria 3393
249 Ga0207670_10150088 3300025936 Bacteria 1728
250 Ga0207670_10155344 3300025936 Bacteria 1702
251 Ga0207669_10180280 3300025937 Bacteria 1513
252 Ga0207704_10144695 3300025938 Bacteria 1668
253 Ga0207691_10104909 3300025940 Bacteria 2518
254 Ga0207711_10050943 3300025941 Bacteria 3545
255 Ga0207711_10149549 3300025941 Bacteria 2106
256 Ga0207689_10169288 3300025942 Bacteria 1800
257 Ga0207689_10289103 3300025942 Bacteria 1358
258 Ga0207661_10086234 3300025944 Bacteria 2605
259 Ga0207661_10108698 3300025944 Bacteria 2342
260 Ga0207679_10188635 3300025945 Bacteria 1712
261 Ga0207667_10546929 3300025949 Bacteria 1171
262 Ga0207712_10003261 3300025961 Bacteria 10297
263 Ga0207712_10140070 3300025961 Bacteria 1855
264 Ga0207703_10000603 3300026035 Bacteria 36484
265 Ga0207703_10368642 3300026035 Unclassified 1326
266 Ga0207703_10548794 3300026035 Bacteria 1089
267 Ga0207678_10486535 3300026067 Bacteria 1075
268 Ga0207708_10024012 3300026075 Bacteria 4611
269 Ga0207708_10037409 3300026075 Bacteria 3697
270 Ga0207708_10196549 3300026075 Bacteria 1607
271 Ga0207641_10032046 3300026088 Bacteria 4363
272 Ga0207641_10252922 3300026088 Bacteria 1646
273 Ga0207648_10026226 3300026089 Bacteria 5180
274 Ga0207648_10028218 3300026089 Bacteria 4978
275 Ga0207648_10116633 3300026089 Bacteria 2347
276 Ga0207676_10036039 3300026095 Bacteria 3760
277 Ga0207676_10110951 3300026095 Bacteria 2295
278 Ga0207674_10033432 3300026116 Bacteria 5384
279 Ga0207674_10227830 3300026116 Bacteria 1812
280 Ga0207674_10536424 3300026116 Bacteria 1130
281 Ga0207675_100159110 3300026118 Bacteria 2154
282 Ga0207675_100161995 3300026118 Bacteria 2134
283 Ga0207683_10162930 3300026121 Bacteria 2017
284 Ga0207428_10034395 3300027907 Bacteria 4153
285 Ga0207428_10069470 3300027907 Bacteria 2770
286 Ga0268265_10037357 3300028380 Bacteria 3564
287 Ga0268265_10223388 3300028380 Bacteria 1650
288 Ga0268264_10063295 3300028381 Bacteria 3109
289 Ga0268264_10211836 3300028381 Bacteria 1779
290 Ga0307517_10076409 3300028786 Bacteria 2925
291 Ga0265338_10011648 3300028800 Bacteria 10129
292 Ga0307513_10002706 3300031456 Bacteria 24392
293 Ga0307513_10155568 3300031456 Bacteria 2187
294 Ga0307509_10013144 3300031507 Bacteria 9826
295 Ga0307408_100034058 3300031548 Bacteria 3564
296 Ga0307408_100201053 3300031548 Bacteria 1613
297 Ga0307514_10130633 3300031649 Bacteria 1730
298 Ga0316576_10272159 3300031727 Bacteria 1269
299 Ga0307413_10012535 3300031824 Bacteria 4223
300 Ga0307413_10239051 3300031824 Bacteria 1340
301 Ga0307410_10058609 3300031852 Bacteria 2626
302 Ga0307410_10083354 3300031852 Bacteria 2251
303 Ga0307410_10243708 3300031852 Bacteria 1394
304 Ga0307407_10133748 3300031903 Bacteria 1590
305 Ga0307407_10334108 3300031903 Bacteria 1068
306 Ga0307414_10010661 3300032004 Bacteria 5348
307 Ga0307411_10032954 3300032005 Bacteria 3208
308 Ga0307411_10059733 3300032005 Bacteria 2529
309 Ga0307415_100153904 3300032126 Bacteria 1773
310 Ga0307507_10008232 3300033179 Bacteria 14572
311 Ga0373929_0019116 3300035085 Unclassified 1368
312 Ga0373934_0059966 3300035086 Bacteria 1515
313 Ga0373940_0005118 3300035088 Bacteria 2822
314 Ga0373940_0058284 3300035088 Bacteria 1099
315 Ga0373939_0041763 3300035114 Bacteria 1384
316 Ga0316574_0321158 3300035398 Bacteria 983
317 Ga0373931_0029667 3300035691 Bacteria 2810
318 Ga0373931_0053706 3300035691 Bacteria 2151
319 Ga0373927_0013554 3300035695 Bacteria 5414
320 Ga0373937_0085541 3300036401 Bacteria 2918
321 Ga0316584_0241015 3300036712 Bacteria 1323
322 Ga0373925_0008583 3300037068 Bacteria 7446
323 Ga0395905_0014362 3300037471 Bacteria 7567
324 Ga0395905_0062218 3300037471 Bacteria 3491
325 Ga0395905_0382725 3300037471 Bacteria 1301
326 Ga0436365_0198252 3300039437 Bacteria 179679
327 Ga0436365_0280278 3300039437 Bacteria 102177
328 Ga0439455_0013885 3300042012 Bacteria 1832
329 Ga0439460_0047236 3300042461 Bacteria 1281
330 Ga0451577_0102059 3300042876 Bacteria 2563
331 Ga0453683_0021050 3300044673 Bacteria 4164
332 Ga0453683_0037191 3300044673 Bacteria 3063
333 Ga0453683_0173069 3300044673 Bacteria 1368
334 Ga0453683_0357535 3300044673 Bacteria 939
335 Ga0453684_0130585 3300044712 Bacteria 3015
336 Ga0466959_0178450 3300045049 Bacteria 1487
337 Ga0451576_0043640 3300045051 Bacteria 4730
338 Ga0451576_0122982 3300045051 Bacteria 2702
339 Ga0451576_0138604 3300045051 Bacteria 2537
340 Ga0451576_0227496 3300045051 Bacteria 1947
341 Ga0451576_0438079 3300045051 Bacteria 1371
342 Ga0466967_0367903 3300045976 Bacteria 1394
343 Ga0495603_0052427 3300046455 Bacteria 2422
344 Ga0495650_0025122 3300046471 Bacteria 2799
345 Ga0495639_0100519 3300046475 Unclassified 1365
346 Ga0495639_0200957 3300046475 Bacteria 975
347 Ga0495594_0039846 3300046499 Bacteria 2569
348 Ga0495618_0096698 3300046514 Bacteria 1888
349 Ga0495640_0394670 3300046533 Bacteria 850
350 Ga0495659_0005771 3300046664 Bacteria 3904
351 Ga0495647_0019374 3300046681 Bacteria 2432
352 Ga0495647_0086776 3300046681 Bacteria 1277
353 Ga0495670_0248383 3300046691 Unclassified 948
354 Ga0495676_0076225 3300047321 Bacteria 2561
355 Ga0495676_0138669 3300047321 Bacteria 1745
356 Ga0496102_0014902 3300048905 Bacteria 6764
357 Ga0496102_0052032 3300048905 Bacteria 3731
358 Ga0496103_0135491 3300048906 Bacteria 1574
359 Ga0496104_0056120 3300048907 Bacteria 3724
360 Ga0496105_0065984 3300048908 Bacteria 2987
361 Ga0496105_0122483 3300048908 Bacteria 2144
362 Ga0496105_0164078 3300048908 Bacteria 1823
363 Ga0496106_0044806 3300048909 Bacteria 3322
364 Ga0496106_0052426 3300048909 Bacteria 3078
365 Ga0496106_0117817 3300048909 Bacteria 2073
366 Ga0496107_0028055 3300048910 Bacteria 4000
367 Ga0496107_0265527 3300048910 Bacteria 1277
368 Ga0496108_0000933 3300048911 Bacteria 22816
369 Ga0496108_0003276 3300048911 Bacteria 13011
370 Ga0496109_0001102 3300048912 Bacteria 22388
371 Ga0496109_0001599 3300048912 Bacteria 18891
372 Ga0496109_0001963 3300048912 Bacteria 17059
373 Ga0496110_0018430 3300048913 Bacteria 5853
374 Ga0496111_0015911 3300048914 Bacteria 5174
375 Ga0496111_0279373 3300048914 Bacteria 1238
376 Ga0496112_0000255 3300048915 Bacteria 34059
377 Ga0496112_0002389 3300048915 Bacteria 15096
378 Ga0496113_0007476 3300048916 Bacteria 7036
379 Ga0496113_0017294 3300048916 Bacteria 5001
380 Ga0496114_0308755 3300048917 Bacteria 1397
381 Ga0496115_0286910 3300048918 Bacteria 1351
382 Ga0501291_010033 3300049514 Bacteria 1340
383 Ga0501298_001138 3300049521 Bacteria 3842
384 Ga0501299_019615 3300049522 Bacteria 1225
385 Ga0501031_0088273 3300049568 Bacteria 2022
386 Ga0501031_0206107 3300049568 Bacteria 1282
387 Ga0501032_0088424 3300049569 Bacteria 2057
388 Ga0501033_0084991 3300049570 Bacteria 2319
389 Ga0501033_0101604 3300049570 Bacteria 2098
390 Ga0501034_0105620 3300049571 Bacteria 2809
391 Ga0501034_0259219 3300049571 Bacteria 1682
392 Ga0501036_0005368 3300049572 Bacteria 10378
393 Ga0501036_0038785 3300049572 Bacteria 4033
394 Ga0501036_0362447 3300049572 Bacteria 1210
395 Ga0501037_0081022 3300049573 Bacteria 2354
396 Ga0501038_0003131 3300049574 Bacteria 15433
397 Ga0501039_0012361 3300049575 Bacteria 6515
398 Ga0501039_0196616 3300049575 Bacteria 1585
399 Ga0501039_0284949 3300049575 Bacteria 1299
400 Ga0501040_0011069 3300049576 Bacteria 5897
401 Ga0501040_0032271 3300049576 Bacteria 3544
402 Ga0501040_0035419 3300049576 Bacteria 3385
403 Ga0501040_0047874 3300049576 Bacteria 2920
404 Ga0501041_0057470 3300049577 Bacteria 2379
405 Ga0501041_0175878 3300049577 Bacteria 1340
406 Ga0501042_0073932 3300049578 Bacteria 2438
407 Ga0501042_0394877 3300049578 Bacteria 1002
408 Ga0501046_0053984 3300049580 Bacteria 3163
409 Ga0501046_0077779 3300049580 Bacteria 2568
410 Ga0501047_0012216 3300049581 Bacteria 8131
411 Ga0501047_0045130 3300049581 Bacteria 4260
412 Ga0501048_0017863 3300049582 Bacteria 5218
413 Ga0501048_0067438 3300049582 Bacteria 2529
414 Ga0501067_0038522 3300049583 Bacteria 2654
415 Ga0501070_0051083 3300049586 Bacteria 3432
416 Ga0501071_0014558 3300049587 Bacteria 5381
417 Ga0501071_0250919 3300049587 Bacteria 1336
418 Ga0501071_0367525 3300049587 Bacteria 1096
419 Ga0501072_0057458 3300049588 Bacteria 3066
420 Ga0501072_0216909 3300049588 Bacteria 1525
421 Ga0501074_0032697 3300049590 Bacteria 3768
422 Ga0501074_0090599 3300049590 Bacteria 2190
423 Ga0501075_0007926 3300049591 Bacteria 7378
424 Ga0501075_0014728 3300049591 Bacteria 5603
425 Ga0501075_0016254 3300049591 Bacteria 5358
426 Ga0501075_0165049 3300049591 Bacteria 1690
427 Ga0501076_0006343 3300049592 Bacteria 8574
428 Ga0501076_0042959 3300049592 Bacteria 3561
429 Ga0501076_0086367 3300049592 Bacteria 2521
430 Ga0501076_0154012 3300049592 Bacteria 1870
431 Ga0501076_0201079 3300049592 Bacteria 1627
432 Ga0501076_0327671 3300049592 Bacteria 1256
433 Ga0501077_0000751 3300049593 Bacteria 19631
434 Ga0501077_0021200 3300049593 Bacteria 4112
435 Ga0501077_0053675 3300049593 Bacteria 2559
436 Ga0501077_0155746 3300049593 Bacteria 1450
437 Ga0501227_016110 3300049665 Unclassified 1677
438 Ga0501235_015142 3300049669 Bacteria 1701
439 Ga0501079_0014516 3300049741 Bacteria 6008
440 Ga0501079_0026804 3300049741 Bacteria 4418
441 Ga0501079_0043623 3300049741 Bacteria 3462
442 Ga0501079_0050314 3300049741 Bacteria 3217
443 Ga0501079_0132966 3300049741 Bacteria 1936
444 Ga0501079_0281706 3300049741 Bacteria 1300
445 Ga0501080_0026096 3300049742 Bacteria 5428
446 Ga0501080_0184666 3300049742 Bacteria 1918
447 Ga0501080_0297082 3300049742 Bacteria 1466
448 Ga0501080_0557526 3300049742 Bacteria 1020
449 Ga0501081_0018165 3300049743 Bacteria 4667
450 Ga0501081_0028877 3300049743 Bacteria 3746
451 Ga0501081_0045794 3300049743 Bacteria 3004
452 Ga0501081_0046645 3300049743 Bacteria 2979
453 Ga0501081_0119059 3300049743 Bacteria 1879
454 Ga0501081_0152887 3300049743 Bacteria 1659
455 Ga0501081_0182665 3300049743 Bacteria 1517
456 Ga0501083_0044875 3300049744 Bacteria 2992
457 Ga0501083_0207689 3300049744 Bacteria 1277
458 Ga0501083_0299370 3300049744 Bacteria 1046
459 Ga0501035_0211497 3300049822 Bacteria 1659
460 Ga0501035_0452413 3300049822 Bacteria 1062
461 Ga0501045_0013348 3300049824 Bacteria 5801
462 Ga0501045_0015004 3300049824 Bacteria 5498
463 Ga0501045_0025507 3300049824 Bacteria 4250
464 Ga0501045_0105947 3300049824 Bacteria 2083
465 nmdc:mga05p37_170888_c1 3300050507 Bacteria 2651
466 nmdc:mga05p37_233151_c1 3300050507 Bacteria 2217
467 nmdc:mga05p37_324393_c1 3300050507 Bacteria 1821
468 nmdc:mga05p37_77158_c1 3300050507 Bacteria 4102
469 nmdc:mga05p37_95547_c1 3300050507 Bacteria 3661
470 nmdc:mga09592_138497_c1 3300050508 Bacteria 2097
471 nmdc:mga09592_174200_c1 3300050508 Bacteria 1861
472 nmdc:mga09592_28467_c1 3300050508 Bacteria 4642
473 nmdc:mga09592_3157_c1 3300050508 Bacteria 13383
474 nmdc:mga09592_438098_c1 3300050508 Unclassified 1128
475 nmdc:mga09592_8781_c1 3300050508 Bacteria 8223
476 nmdc:mga0qj67_545081_c1 3300050509 Bacteria 930
477 nmdc:mga0qj67_78079_c1 3300050509 Bacteria 2649
478 nmdc:mga06r32_140843_c1 3300050510 Bacteria 2388
479 nmdc:mga06r32_149368_c1 3300050510 Bacteria 2314
480 nmdc:mga06r32_191102_c1 3300050510 Bacteria 2035
481 nmdc:mga06r32_231132_c1 3300050510 Bacteria 1837
482 nmdc:mga06r32_782907_c1 3300050510 Bacteria 915
483 nmdc:mga06r32_83828_c1 3300050510 Bacteria 3106
484 nmdc:mga08y16_116152_c1 3300050511 Bacteria 2786
485 nmdc:mga08y16_21378_c1 3300050511 Bacteria 6834
486 nmdc:mga08y16_71513_c1 3300050511 Bacteria 3615
487 nmdc:mga0n895_1997_c1 3300050512 Bacteria 15659
488 nmdc:mga0n895_200681_c1 3300050512 Bacteria 2025
489 nmdc:mga0n895_227431_c1 3300050512 Bacteria 1894
490 nmdc:mga0n895_236_c1 3300050512 Bacteria 35107
491 nmdc:mga0n895_4285_c1 3300050512 Bacteria 11681
492 nmdc:mga0n895_675508_c1 3300050512 Bacteria 1030
493 nmdc:mga0n895_909836_c1 3300050512 Bacteria 865
494 nmdc:mga0n895_982_c1 3300050512 Bacteria 20646
495 nmdc:mga0rr50_102133_c1 3300050513 Bacteria 2255
496 nmdc:mga0rr50_121096_c1 3300050513 Bacteria 2083
497 nmdc:mga0rr50_147632_c1 3300050513 Bacteria 1897
498 nmdc:mga0rr50_16912_c1 3300050513 Bacteria 4857
499 nmdc:mga0rr50_439569_c1 3300050513 Bacteria 1105
500 nmdc:mga0rr50_493454_c1 3300050513 Bacteria 1041
501 nmdc:mga0rr50_638_c1 3300050513 Bacteria 18840
502 nmdc:mga0rr50_74143_c1 3300050513 Bacteria 2604
503 nmdc:mga08x19_141030_c1 3300050514 Bacteria 1628
504 nmdc:mga08x19_46140_c1 3300050514 Bacteria 2786
505 nmdc:mga08x19_5409_c1 3300050514 Bacteria 7552
506 nmdc:mga0a205_14277_c1 3300050515 Bacteria 7406
507 nmdc:mga0a205_144748_c1 3300050515 Bacteria 2277
508 nmdc:mga0a205_18_c2 3300050515 Bacteria 96859
509 nmdc:mga0a205_219833_c1 3300050515 Bacteria 1425
510 nmdc:mga0a205_365055_c1 3300050515 Bacteria 1310
511 nmdc:mga0a205_511_c1 3300050515 Bacteria 30432
512 nmdc:mga0a205_517755_c1 3300050515 Bacteria 1049
513 nmdc:mga0a205_74876_c1 3300050515 Bacteria 3271
514 Ga0501084_0014488 3300054114 Bacteria 6536
515 Ga0501084_0161826 3300054114 Bacteria 1888
516 Ga0501084_0280535 3300054114 Bacteria 1407
517 Ga0590071_010304 3300059421 Bacteria 2190
518 Ga0501082_0017066 3300060353 Bacteria 6254
519 Ga0501082_0018901 3300060353 Bacteria 5937
520 Ga0501082_0025717 3300060353 Bacteria 5072
521 Ga0501082_0102304 3300060353 Bacteria 2478
522 Ga0501082_0210044 3300060353 Bacteria 1694
523 Ga0501082_0222366 3300060353 Bacteria 1643
524 Ga0530510_0030083 3300061734 Bacteria 3899
525 Ga0070689_100001486
526 Ga0070658_10143573
527 Ga0070676_10038379
528 Ga0070683_100093633
529 Ga0070683_100205799
530 Ga0068869_100077770
531 Ga0070680_100122852
532 Ga0070680_100221570
533 Ga0070680_100428249
534 Ga0070689_100000065
535 Ga0070689_100013536
536 Ga0070689_100067215
537 Ga0070689_100104961
538 Ga0070689_100107327
539 Ga0070691_10047186
540 Ga0070687_100063892
541 Ga0070668_100108980
542 Ga0070669_100039084
543 Ga0070669_100170878
544 Ga0070669_100347348
545 Ga0070675_100187849
546 Ga0070671_100005807
547 Ga0070674_100051074
548 Ga0070673_100105690
549 Ga0070673_100289438
550 Ga0070688_100000001
551 Ga0070688_100001057
552 Ga0070688_100016852
553 Ga0070688_100055687
554 Ga0070688_100091054
555 Ga0070659_100115273
556 Ga0070703_10002297
557 Ga0070703_10043886
558 Ga0070701_10044221
559 Ga0070711_100575279
560 Ga0070700_100020750
561 Ga0070700_100093905
562 Ga0070700_100155130
563 Ga0070694_100020607
564 Ga0070694_100101796
565 Ga0070708_100063587
566 Ga0070708_100086506
567 Ga0070708_100210047
568 Ga0070708_100293944
569 Ga0070708_100301127
570 Ga0070708_100602189
571 Ga0070662_100000379
572 Ga0070662_100272838
573 Ga0070681_10156251
574 Ga0068867_100027767
575 Ga0068867_100076297
576 Ga0068867_100188448
577 Ga0070685_10002120
578 Ga0070706_100364876
579 Ga0070706_100418607
580 Ga0070706_100467261
581 Ga0070707_100065134
582 Ga0070707_100175677
583 Ga0070707_100185239
584 Ga0070707_100197132
585 Ga0070698_100028675
586 Ga0070698_100072591
587 Ga0070698_100110509
588 Ga0070699_100005049
589 Ga0070699_100082991
590 Ga0070699_100084184
591 Ga0070699_100151897
592 Ga0070699_100211739
593 Ga0070699_100428799
594 Ga0070679_100064157
595 Ga0070679_100190416
596 Ga0070684_100106069
597 Ga0070697_100001243
598 Ga0070697_100111062
599 Ga0070672_100226450
600 Ga0070686_100079753
601 Ga0070686_100169093
602 Ga0070686_100339548
603 Ga0070695_100099990
604 Ga0070696_100000408
605 Ga0070696_100150431
606 Ga0070693_100046852
607 Ga0070693_100082389
608 Ga0070693_100223194
609 Ga0070704_100020602
610 Ga0070704_100021497
611 Ga0070704_100035173
612 Ga0070704_100064400
613 Ga0070704_100289574
614 Ga0068855_100510011
615 Ga0068855_100514066
616 Ga0068855_100771474
617 Ga0070664_100150195
618 Ga0070664_100256766
619 Ga0068857_100029797
620 Ga0068854_100005043
621 Ga0068856_100059165
622 Ga0068856_100326845
623 Ga0070702_100008720
624 Ga0068859_100001677
625 Ga0068859_100046955
626 Ga0068864_100026867
627 Ga0068864_100040968
628 Ga0068864_100127007
629 Ga0068864_100133205
630 Ga0068861_100187453
631 Ga0068861_100561105
632 Ga0068863_100193262
633 Ga0068858_100015651
634 Ga0068858_100349819
635 Ga0068858_100358630
636 Ga0068860_100051001
637 Ga0068862_100033273
638 Ga0068862_100039798
639 Ga0081539_10000063
640 Ga0068871_100063916
641 Ga0075428_100150637
642 Ga0075428_100214958
643 Ga0075428_100306945
644 Ga0075428_100567968
645 Ga0075428_100608222
646 Ga0075430_100185646
647 Ga0075430_100207824
648 Ga0075430_100615801
649 Ga0075431_100005891
650 Ga0075431_100233764
651 Ga0075431_100242335
652 Ga0075433_10000091
653 Ga0075433_10000099
654 Ga0075433_10024168
655 Ga0075433_10085168
656 Ga0075433_10085938
657 Ga0075433_10097287
658 Ga0075433_10123193
659 Ga0075433_10325278
660 Ga0075433_10443707
661 Ga0075433_10507647
662 Ga0075434_100000883
663 Ga0075434_100001827
664 Ga0075434_100003252
665 Ga0075434_100026495
666 Ga0075434_100090584
667 Ga0075434_100397899
668 Ga0075434_100411209
669 Ga0075434_100514046
670 Ga0075434_100662250
671 Ga0075429_100014188
672 Ga0075429_100018928
673 Ga0075429_100059303
674 Ga0075429_100087841
675 Ga0075429_100147598
676 Ga0075429_100533317
677 Ga0068865_100015123
678 Ga0075436_100002039
679 Ga0075436_100080065
680 Ga0075436_100089402
681 Ga0075436_100095925
682 Ga0097620_100001677
683 Ga0097620_100046955
684 Ga0097620_100065737
685 Ga0075435_100012858
686 Ga0075435_100155028
687 Ga0075435_100215972
688 Ga0075435_100404581
689 Ga0075435_100651027
690 Ga0105240_10011734
691 Ga0111539_10021195
692 Ga0111539_10088213
693 Ga0111539_10147441
694 Ga0111539_10205454
695 Ga0111539_11094092
696 Ga0105245_10000072
697 Ga0105245_10519897
698 Ga0105247_10003480
699 Ga0114129_10066265
700 Ga0114129_10077860
701 Ga0114129_10190236
702 Ga0114129_10217162
703 Ga0114129_10348328
704 Ga0114129_11010190
705 Ga0114129_11014680
706 Ga0105243_10052509
707 Ga0105241_10085960
708 Ga0105242_10043487
709 Ga0105242_10115687
710 Ga0105242_10200920
711 Ga0105248_10000791
712 Ga0105248_10006951
713 Ga0105248_10183259
714 Ga0105248_10183334
715 Ga0105249_10060565
716 Ga0105249_10090783
717 Ga0105239_10036370
718 Ga0105246_10216606
719 Ga0157378_10001449
720 Ga0163162_10229696
721 Ga0163162_10339489
722 Ga0163162_10561131
723 Ga0163163_10022239
724 Ga0163163_10076205
725 Ga0157380_10273833
726 Ga0157380_10416590
727 Ga0157377_10063639
728 Ga0157379_10010159
729 Ga0157379_10049257
730 Ga0157379_10079060
731 Ga0157376_10281424
732 Ga0157376_10628732
733 Ga0207653_10001903
734 Ga0207653_10020472
735 Ga0207653_10029884
736 Ga0207642_10032100
737 Ga0207710_10001825
738 Ga0207645_10007567
739 Ga0207643_10009719
740 Ga0207705_10134667
741 Ga0207684_10239347
742 Ga0207684_10479987
743 Ga0207654_10059529
744 Ga0207654_10114012
745 Ga0207707_10038195
746 Ga0207707_10254233
747 Ga0207695_10184048
748 Ga0207663_10278545
749 Ga0207663_10482283
750 Ga0207660_10118760
751 Ga0207662_10000462
752 Ga0207652_10058678
753 Ga0207652_10145015
754 Ga0207652_10323434
755 Ga0207646_10010123
756 Ga0207646_10054934
757 Ga0207646_10098436
758 Ga0207646_10240894
759 Ga0207646_10263157
760 Ga0207681_10247528
761 Ga0207681_10333953
762 Ga0207650_10536907
763 Ga0207659_10089030
764 Ga0207687_10002588
765 Ga0207687_10242126
766 Ga0207706_10001452
767 Ga0207706_10125781
768 Ga0207686_10044029
769 Ga0207709_10374158
770 Ga0207670_10000012
771 Ga0207670_10001835
772 Ga0207670_10031654
773 Ga0207670_10150088
774 Ga0207670_10155344
775 Ga0207669_10180280
776 Ga0207704_10144695
777 Ga0207691_10104909
778 Ga0207711_10050943
779 Ga0207711_10149549
780 Ga0207689_10169288
781 Ga0207689_10289103
782 Ga0207661_10086234
783 Ga0207661_10108698
784 Ga0207679_10188635
785 Ga0207667_10546929
786 Ga0207712_10003261
787 Ga0207712_10140070
788 Ga0207703_10000603
789 Ga0207703_10368642
790 Ga0207703_10548794
791 Ga0207678_10486535
792 Ga0207708_10024012
793 Ga0207708_10037409
794 Ga0207708_10196549
795 Ga0207641_10032046
796 Ga0207641_10252922
797 Ga0207648_10026226
798 Ga0207648_10028218
799 Ga0207648_10116633
800 Ga0207676_10036039
801 Ga0207676_10110951
802 Ga0207674_10033432
803 Ga0207674_10227830
804 Ga0207674_10536424
805 Ga0207675_100159110
806 Ga0207675_100161995
807 Ga0207683_10162930
808 Ga0207428_10034395
809 Ga0207428_10069470
810 Ga0268265_10037357
811 Ga0268265_10223388
812 Ga0268264_10063295
813 Ga0268264_10211836
814 Ga0307517_10076409
815 Ga0265338_10011648
816 Ga0307513_10002706
817 Ga0307513_10155568
818 Ga0307509_10013144
819 Ga0307408_100034058
820 Ga0307408_100201053
821 Ga0307514_10130633
822 Ga0316576_10272159
823 Ga0307413_10012535
824 Ga0307413_10239051
825 Ga0307410_10058609
826 Ga0307410_10083354
827 Ga0307410_10243708
828 Ga0307407_10133748
829 Ga0307407_10334108
830 Ga0307414_10010661
831 Ga0307411_10032954
832 Ga0307411_10059733
833 Ga0307415_100153904
834 Ga0307507_10008232
835 Ga0373929_0019116
836 Ga0373934_0059966
837 Ga0373940_0005118
838 Ga0373940_0058284
839 Ga0373939_0041763
840 Ga0316574_0321158
841 Ga0373931_0029667
842 Ga0373931_0053706
843 Ga0373927_0013554
844 Ga0373937_0085541
845 Ga0316584_0241015
846 Ga0373925_0008583
847 Ga0395905_0014362
848 Ga0395905_0062218
849 Ga0395905_0382725
850 Ga0436365_0198252
851 Ga0436365_0280278
852 Ga0439455_0013885
853 Ga0439460_0047236
854 Ga0451577_0102059
855 Ga0453683_0021050
856 Ga0453683_0037191
857 Ga0453683_0173069
858 Ga0453683_0357535
859 Ga0453684_0130585
860 Ga0466959_0178450
861 Ga0451576_0043640
862 Ga0451576_0122982
863 Ga0451576_0138604
864 Ga0451576_0227496
865 Ga0451576_0438079
866 Ga0466967_0367903
867 Ga0495603_0052427
868 Ga0495650_0025122
869 Ga0495639_0100519
870 Ga0495639_0200957
871 Ga0495594_0039846
872 Ga0495618_0096698
873 Ga0495640_0394670
874 Ga0495659_0005771
875 Ga0495647_0019374
876 Ga0495647_0086776
877 Ga0495670_0248383
878 Ga0495676_0076225
879 Ga0495676_0138669
880 Ga0496102_0014902
881 Ga0496102_0052032
882 Ga0496103_0135491
883 Ga0496104_0056120
884 Ga0496105_0065984
885 Ga0496105_0122483
886 Ga0496105_0164078
887 Ga0496106_0044806
888 Ga0496106_0052426
889 Ga0496106_0117817
890 Ga0496107_0028055
891 Ga0496107_0265527
892 Ga0496108_0000933
893 Ga0496108_0003276
894 Ga0496109_0001102
895 Ga0496109_0001599
896 Ga0496109_0001963
897 Ga0496110_0018430
898 Ga0496111_0015911
899 Ga0496111_0279373
900 Ga0496112_0000255
901 Ga0496112_0002389
902 Ga0496113_0007476
903 Ga0496113_0017294
904 Ga0496114_0308755
905 Ga0496115_0286910
906 Ga0501291_010033
907 Ga0501298_001138
908 Ga0501299_019615
909 Ga0501031_0088273
910 Ga0501031_0206107
911 Ga0501032_0088424
912 Ga0501033_0084991
913 Ga0501033_0101604
914 Ga0501034_0105620
915 Ga0501034_0259219
916 Ga0501036_0005368
917 Ga0501036_0038785
918 Ga0501036_0362447
919 Ga0501037_0081022
920 Ga0501038_0003131
921 Ga0501039_0012361
922 Ga0501039_0196616
923 Ga0501039_0284949
924 Ga0501040_0011069
925 Ga0501040_0032271
926 Ga0501040_0035419
927 Ga0501040_0047874
928 Ga0501041_0057470
929 Ga0501041_0175878
930 Ga0501042_0073932
931 Ga0501042_0394877
932 Ga0501046_0053984
933 Ga0501046_0077779
934 Ga0501047_0012216
935 Ga0501047_0045130
936 Ga0501048_0017863
937 Ga0501048_0067438
938 Ga0501067_0038522
939 Ga0501070_0051083
940 Ga0501071_0014558
941 Ga0501071_0250919
942 Ga0501071_0367525
943 Ga0501072_0057458
944 Ga0501072_0216909
945 Ga0501074_0032697
946 Ga0501074_0090599
947 Ga0501075_0007926
948 Ga0501075_0014728
949 Ga0501075_0016254
950 Ga0501075_0165049
951 Ga0501076_0006343
952 Ga0501076_0042959
953 Ga0501076_0086367
954 Ga0501076_0154012
955 Ga0501076_0201079
956 Ga0501076_0327671
957 Ga0501077_0000751
958 Ga0501077_0021200
959 Ga0501077_0053675
960 Ga0501077_0155746
961 Ga0501227_016110
962 Ga0501235_015142
963 Ga0501079_0014516
964 Ga0501079_0026804
965 Ga0501079_0043623
966 Ga0501079_0050314
967 Ga0501079_0132966
968 Ga0501079_0281706
969 Ga0501080_0026096
970 Ga0501080_0184666
971 Ga0501080_0297082
972 Ga0501080_0557526
973 Ga0501081_0018165
974 Ga0501081_0028877
975 Ga0501081_0045794
976 Ga0501081_0046645
977 Ga0501081_0119059
978 Ga0501081_0152887
979 Ga0501081_0182665
980 Ga0501083_0044875
981 Ga0501083_0207689
982 Ga0501083_0299370
983 Ga0501035_0211497
984 Ga0501035_0452413
985 Ga0501045_0013348
986 Ga0501045_0015004
987 Ga0501045_0025507
988 Ga0501045_0105947
989 nmdc:mga05p37_170888_c1
990 nmdc:mga05p37_233151_c1
991 nmdc:mga05p37_324393_c1
992 nmdc:mga05p37_77158_c1
993 nmdc:mga05p37_95547_c1
994 nmdc:mga09592_138497_c1
995 nmdc:mga09592_174200_c1
996 nmdc:mga09592_28467_c1
997 nmdc:mga09592_3157_c1
998 nmdc:mga09592_438098_c1
999 nmdc:mga09592_8781_c1
1000 nmdc:mga0qj67_545081_c1
1001 nmdc:mga0qj67_78079_c1
1002 nmdc:mga06r32_140843_c1
1003 nmdc:mga06r32_149368_c1
1004 nmdc:mga06r32_191102_c1
1005 nmdc:mga06r32_231132_c1
1006 nmdc:mga06r32_782907_c1
1007 nmdc:mga06r32_83828_c1
1008 nmdc:mga08y16_116152_c1
1009 nmdc:mga08y16_21378_c1
1010 nmdc:mga08y16_71513_c1
1011 nmdc:mga0n895_1997_c1
1012 nmdc:mga0n895_200681_c1
1013 nmdc:mga0n895_227431_c1
1014 nmdc:mga0n895_236_c1
1015 nmdc:mga0n895_4285_c1
1016 nmdc:mga0n895_675508_c1
1017 nmdc:mga0n895_909836_c1
1018 nmdc:mga0n895_982_c1
1019 nmdc:mga0rr50_102133_c1
1020 nmdc:mga0rr50_121096_c1
1021 nmdc:mga0rr50_147632_c1
1022 nmdc:mga0rr50_16912_c1
1023 nmdc:mga0rr50_439569_c1
1024 nmdc:mga0rr50_493454_c1
1025 nmdc:mga0rr50_638_c1
1026 nmdc:mga0rr50_74143_c1
1027 nmdc:mga08x19_141030_c1
1028 nmdc:mga08x19_46140_c1
1029 nmdc:mga08x19_5409_c1
1030 nmdc:mga0a205_14277_c1
1031 nmdc:mga0a205_144748_c1
1032 nmdc:mga0a205_18_c2
1033 nmdc:mga0a205_219833_c1
1034 nmdc:mga0a205_365055_c1
1035 nmdc:mga0a205_511_c1
1036 nmdc:mga0a205_517755_c1
1037 nmdc:mga0a205_74876_c1
1038 Ga0501084_0014488
1039 Ga0501084_0161826
1040 Ga0501084_0280535
1041 Ga0590071_010304
1042 Ga0501082_0017066
1043 Ga0501082_0018901
1044 Ga0501082_0025717
1045 Ga0501082_0102304
1046 Ga0501082_0210044
1047 Ga0501082_0222366
1048 Ga0530510_0030083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

12

267

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

17

208

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g64-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from streptomyces coelicolor a3(2) 0.9776 1 266
6sla-assembly2.cif.gz_FFF crystal structure of isomerase paag mutant - d136n with oxepin-coa 0.9602 8 264
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9567 8 266
3hrx-assembly2.cif.gz_F crystal structure of phenylacetic acid degradation protein paag 0.9566 8 266
5zai-assembly1.cif.gz_D crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula 0.9545 4 265
ID Description Score Start End Superfamily
3g64C01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9786 6 207 3.90.226.10
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.972 7 191 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9665 8 209 3.90.226.10
3g64B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9663 209 266 1.10.12.10
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9656 104 206 3.90.226.20
ID Description Score Start End GO Terms
AF-A0A2V7ZHM5-F1-model_v4 Enoyl-CoA hydratase family protein 0.998 5 264 GO:0003824
AF-A0A518EQ07-F1-model_v4 1,2-epoxyphenylacetyl-CoA isomerase (EC 5.3.3.18) 0.9974 3 264 GO:0016853
AF-A0A7W0JTS3-F1-model_v4 Enoyl-CoA hydratase family protein 0.9971 5 265 GO:0003824
AF-A0A6B0XR06-F1-model_v4 Enoyl-CoA hydratase family protein 0.9965 1 264 GO:0003824
AF-A0A1E4EJ40-F1-model_v4 Enoyl-CoA hydratase 0.9964 2 265 GO:0003824

Map