F459078

General Info

Members Datasets Scaffolds Average Seq Length
523 266 1046 153

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|644736347|644751340
Length 181
Sequence RYWAAPEPAAAKPVRNEETPMKLQLKINGKRHAVDAERDMPLLWVLRDYLGYTGTKFGCGAGLCGACTVHVDGKAVRACITPVGTVARADITTIEGLSVDNSHPVQRAWIAEQVPQCGYCQPGMIMAACAFLKDNPMPRPEDVRAGITNLCRCGTYPRVERAILRAATALNAGEPKGRASS

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
85 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
86 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
184 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
185 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
186 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
187 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
188 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
265 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
266 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.76
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0.57
Rhizoplane 6.88
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10008344 3300002459 Bacteria 2118
2 Ga0070658_10028759 3300005327 Bacteria 4462
3 Ga0070658_10056818 3300005327 Bacteria 3182
4 Ga0070658_10242715 3300005327 Bacteria 1527
5 Ga0070683_100060646 3300005329 Bacteria 3516
6 Ga0070683_100076390 3300005329 Bacteria 3131
7 Ga0070683_100154338 3300005329 Bacteria 2177
8 Ga0070683_100236987 3300005329 Bacteria 1735
9 Ga0070683_100332970 3300005329 Bacteria 1445
10 Ga0070683_100906757 3300005329 Bacteria 845
11 Ga0070670_100124879 3300005331 Bacteria 2221
12 Ga0070670_100488391 3300005331 Bacteria 1094
13 Ga0070670_100778902 3300005331 Bacteria 863
14 Ga0070666_10177875 3300005335 Bacteria 1491
15 Ga0070680_100426163 3300005336 Bacteria 1132
16 Ga0070682_100144056 3300005337 Bacteria 1627
17 Ga0068868_100041545 3300005338 Bacteria 3583
18 Ga0068868_100382738 3300005338 Bacteria 1211
19 Ga0068868_101005540 3300005338 Bacteria 763
20 Ga0068868_102219673 3300005338 Bacteria 523
21 Ga0070660_100004686 3300005339 Bacteria 9468
22 Ga0070689_100740577 3300005340 Bacteria 861
23 Ga0070691_10001238 3300005341 Bacteria 10761
24 Ga0070661_100014709 3300005344 Bacteria 5518
25 Ga0070661_100153625 3300005344 Bacteria 1741
26 Ga0070661_100251270 3300005344 Bacteria 1364
27 Ga0070692_10022576 3300005345 Bacteria 3074
28 Ga0070668_100638142 3300005347 Bacteria 935
29 Ga0070668_100972083 3300005347 Bacteria 762
30 Ga0070669_100600703 3300005353 Bacteria 922
31 Ga0070675_100070318 3300005354 Bacteria 2900
32 Ga0070675_100135939 3300005354 Bacteria 2098
33 Ga0070675_100576121 3300005354 Bacteria 1019
34 Ga0070671_100164344 3300005355 Bacteria 1877
35 Ga0070674_100024475 3300005356 Bacteria 3918
36 Ga0070674_100592000 3300005356 Bacteria 936
37 Ga0070674_100622569 3300005356 Bacteria 915
38 Ga0070674_100715699 3300005356 Bacteria 857
39 Ga0070673_100018293 3300005364 Bacteria 5001
40 Ga0070673_100052387 3300005364 Bacteria 3202
41 Ga0070673_100767481 3300005364 Bacteria 889
42 Ga0070673_101101753 3300005364 Bacteria 742
43 Ga0070688_100479810 3300005365 Bacteria 934
44 Ga0070659_100054025 3300005366 Bacteria 3163
45 Ga0070659_100621271 3300005366 Bacteria 930
46 Ga0070667_100290859 3300005367 Bacteria 1469
47 Ga0070667_100545753 3300005367 Bacteria 1065
48 Ga0070701_10003360 3300005438 Bacteria 6318
49 Ga0070705_100148375 3300005440 Bacteria 1552
50 Ga0070700_100762404 3300005441 Bacteria 775
51 Ga0070694_100251963 3300005444 Bacteria 1336
52 Ga0070663_100144391 3300005455 Bacteria 1820
53 Ga0070678_100043118 3300005456 Bacteria 3212
54 Ga0070678_100258575 3300005456 Bacteria 1463
55 Ga0070678_101131627 3300005456 Bacteria 724
56 Ga0070662_100053334 3300005457 Bacteria 2926
57 Ga0070662_100183820 3300005457 Bacteria 1649
58 Ga0070681_10154466 3300005458 Bacteria 2221
59 Ga0068867_100043815 3300005459 Bacteria 3276
60 Ga0068867_100910650 3300005459 Bacteria 792
61 Ga0070685_10083614 3300005466 Bacteria 1918
62 Ga0070685_10476747 3300005466 Bacteria 879
63 Ga0070706_101564790 3300005467 Bacteria 602
64 Ga0070706_101742852 3300005467 Bacteria 567
65 Ga0070699_100975459 3300005518 Bacteria 777
66 Ga0070679_100221790 3300005530 Bacteria 1851
67 Ga0070684_100058245 3300005535 Bacteria 3376
68 Ga0070684_100166083 3300005535 Bacteria 2003
69 Ga0070684_100195568 3300005535 Bacteria 1841
70 Ga0070697_100250641 3300005536 Bacteria 1514
71 Ga0068853_100018683 3300005539 Bacteria 5740
72 Ga0068853_100106303 3300005539 Bacteria 2487
73 Ga0070672_100051648 3300005543 Bacteria 3207
74 Ga0070672_100303136 3300005543 Bacteria 1355
75 Ga0070672_100710233 3300005543 Bacteria 880
76 Ga0070686_100033362 3300005544 Bacteria 3163
77 Ga0070686_100425093 3300005544 Bacteria 1016
78 Ga0070696_100023307 3300005546 Bacteria 4207
79 Ga0070696_100787633 3300005546 Bacteria 782
80 Ga0070693_100028511 3300005547 Bacteria 3036
81 Ga0070665_100092614 3300005548 Bacteria 3027
82 Ga0070665_100417489 3300005548 Bacteria 1350
83 Ga0070704_100016961 3300005549 Bacteria 4618
84 Ga0070704_100106164 3300005549 Bacteria 2128
85 Ga0068855_100140921 3300005563 Bacteria 2749
86 Ga0070664_100126373 3300005564 Bacteria 2243
87 Ga0070664_100205771 3300005564 Bacteria 1757
88 Ga0070664_101546718 3300005564 Bacteria 628
89 Ga0068857_100071647 3300005577 Bacteria 3088
90 Ga0068857_100236872 3300005577 Bacteria 1670
91 Ga0068857_100747237 3300005577 Bacteria 932
92 Ga0068854_100027354 3300005578 Bacteria 3930
93 Ga0068856_100547063 3300005614 Bacteria 1179
94 Ga0070702_100044645 3300005615 Bacteria 2503
95 Ga0070702_100185281 3300005615 Bacteria 1365
96 Ga0070702_100397558 3300005615 Bacteria 985
97 Ga0068852_100041156 3300005616 Bacteria 3903
98 Ga0068852_100332174 3300005616 Bacteria 1479
99 Ga0068859_100074199 3300005617 Bacteria 3440
100 Ga0068864_100015387 3300005618 Bacteria 6361
101 Ga0068864_100141749 3300005618 Bacteria 2169
102 Ga0068864_100296911 3300005618 Bacteria 1512
103 Ga0068861_100058556 3300005719 Bacteria 2946
104 Ga0068851_10098871 3300005834 Bacteria 1545
105 Ga0068870_10035545 3300005840 Bacteria 2557
106 Ga0068863_100203462 3300005841 Bacteria 1905
107 Ga0068863_100874659 3300005841 Bacteria 898
108 Ga0068858_100763109 3300005842 Bacteria 943
109 Ga0068860_100197903 3300005843 Bacteria 1946
110 Ga0068860_100391872 3300005843 Bacteria 1373
111 Ga0068862_100319069 3300005844 Bacteria 1434
112 Ga0081455_10069535 3300005937 Bacteria 2927
113 Ga0081455_10134702 3300005937 Bacteria 1927
114 Ga0075365_10117500 3300006038 Bacteria 1832
115 Ga0075432_10079549 3300006058 Bacteria 1187
116 Ga0068871_100028349 3300006358 Bacteria 4389
117 Ga0068871_100040104 3300006358 Bacteria 3750
118 Ga0075428_100023563 3300006844 Bacteria 6814
119 Ga0075428_101313782 3300006844 Bacteria 760
120 Ga0075431_100166010 3300006847 Bacteria 2269
121 Ga0075433_10174705 3300006852 Bacteria 1911
122 Ga0075429_100033517 3300006880 Bacteria 4463
123 Ga0075429_100033971 3300006880 Bacteria 4431
124 Ga0068865_100021316 3300006881 Bacteria 4212
125 Ga0068865_100322120 3300006881 Bacteria 1244
126 Ga0068865_100657220 3300006881 Bacteria 891
127 Ga0075436_100658139 3300006914 Bacteria 774
128 Ga0097620_100074199 3300006931 Bacteria 3440
129 Ga0105240_10051692 3300009093 Bacteria 5169
130 Ga0105240_10161322 3300009093 Bacteria 2662
131 Ga0105240_10447125 3300009093 Bacteria 1447
132 Ga0105245_10023925 3300009098 Bacteria 5361
133 Ga0105245_10084735 3300009098 Bacteria 2904
134 Ga0105245_10111204 3300009098 Bacteria 2547
135 Ga0105245_10202847 3300009098 Bacteria 1905
136 Ga0105245_10347847 3300009098 Bacteria 1468
137 Ga0105245_11107388 3300009098 Bacteria 838
138 Ga0105245_11799602 3300009098 Bacteria 665
139 Ga0105247_10016412 3300009101 Bacteria 4437
140 Ga0105247_10156390 3300009101 Bacteria 1506
141 Ga0114129_10044878 3300009147 Bacteria 6216
142 Ga0114129_10303666 3300009147 Bacteria 2126
143 Ga0114129_10708755 3300009147 Bacteria 1293
144 Ga0114129_10731778 3300009147 Bacteria 1268
145 Ga0114129_11396741 3300009147 Bacteria 864
146 Ga0105243_10016636 3300009148 Bacteria 5562
147 Ga0105243_10017347 3300009148 Bacteria 5442
148 Ga0105243_10133513 3300009148 Bacteria 2109
149 Ga0105243_10348826 3300009148 Bacteria 1358
150 Ga0105243_11830913 3300009148 Bacteria 639
151 Ga0105241_11515381 3300009174 Bacteria 646
152 Ga0105242_10055837 3300009176 Bacteria 3231
153 Ga0105242_10058043 3300009176 Bacteria 3171
154 Ga0105242_10079888 3300009176 Bacteria 2732
155 Ga0105242_10371992 3300009176 Bacteria 1326
156 Ga0105242_10554574 3300009176 Bacteria 1102
157 Ga0105248_10020955 3300009177 Bacteria 7246
158 Ga0105248_10594208 3300009177 Bacteria 1249
159 Ga0105248_10794119 3300009177 Bacteria 1068
160 Ga0105237_10081750 3300009545 Bacteria 3222
161 Ga0105237_10565393 3300009545 Bacteria 1144
162 Ga0105237_11559023 3300009545 Bacteria 667
163 Ga0105238_10013503 3300009551 Bacteria 8246
164 Ga0105238_10922905 3300009551 Bacteria 892
165 Ga0105238_11321362 3300009551 Bacteria 747
166 Ga0105239_10123050 3300010375 Bacteria 2883
167 Ga0105239_10232038 3300010375 Bacteria 2070
168 Ga0105239_10467448 3300010375 Bacteria 1432
169 Ga0105239_11267783 3300010375 Bacteria 850
170 Ga0105246_10056040 3300011119 Bacteria 2723
171 Ga0105246_10350794 3300011119 Bacteria 1209
172 Ga0105246_10555413 3300011119 Bacteria 985
173 Ga0105246_10614043 3300011119 Bacteria 941
174 Ga0157320_1008564 3300012481 Bacteria 756
175 Ga0157321_1011304 3300012487 Bacteria 695
176 Ga0157342_1004253 3300012507 Bacteria 1262
177 Ga0157371_10041681 3300013102 Bacteria 3275
178 Ga0157371_10099569 3300013102 Bacteria 2061
179 Ga0157370_10251529 3300013104 Bacteria 1634
180 Ga0157370_10255148 3300013104 Bacteria 1622
181 Ga0157369_10087965 3300013105 Bacteria 3316
182 Ga0157378_10802196 3300013297 Bacteria 967
183 Ga0157378_13076052 3300013297 Bacteria 518
184 Ga0163162_10625545 3300013306 Bacteria 1201
185 Ga0163162_10969331 3300013306 Bacteria 961
186 Ga0163162_11911477 3300013306 Bacteria 679
187 Ga0157372_10009445 3300013307 Bacteria 10376
188 Ga0157372_10105468 3300013307 Bacteria 3223
189 Ga0157375_10029312 3300013308 Bacteria 5173
190 Ga0157375_10041884 3300013308 Bacteria 4427
191 Ga0163163_10007040 3300014325 Bacteria 9883
192 Ga0163163_10116296 3300014325 Bacteria 2705
193 Ga0163163_10760342 3300014325 Bacteria 1032
194 Ga0157380_10341302 3300014326 Bacteria 1397
195 Ga0157380_12058810 3300014326 Bacteria 633
196 Ga0157377_10032618 3300014745 Bacteria 2837
197 Ga0157377_10033970 3300014745 Bacteria 2788
198 Ga0157379_10032751 3300014968 Bacteria 4635
199 Ga0157379_10153273 3300014968 Bacteria 2079
200 Ga0157376_10018213 3300014969 Bacteria 5377
201 Ga0157376_10111123 3300014969 Bacteria 2412
202 Ga0157376_10695677 3300014969 Bacteria 1021
203 Ga0163161_10017266 3300017792 Bacteria 5049
204 Ga0197907_11185842 3300020069 Bacteria 563
205 Ga0206356_10423462 3300020070 Bacteria 3473
206 Ga0206356_11649714 3300020070 Bacteria 646
207 Ga0206353_10010347 3300020082 Bacteria 1029
208 Ga0207656_10063602 3300025321 Bacteria 1624
209 Ga0207656_10183953 3300025321 Bacteria 1004
210 Ga0207653_10009216 3300025885 Bacteria 3076
211 Ga0207682_10192220 3300025893 Bacteria 936
212 Ga0207710_10376965 3300025900 Bacteria 726
213 Ga0207688_10197087 3300025901 Bacteria 1206
214 Ga0207680_10134445 3300025903 Bacteria 1633
215 Ga0207680_10557364 3300025903 Bacteria 818
216 Ga0207647_10109262 3300025904 Bacteria 1636
217 Ga0207645_10226488 3300025907 Bacteria 1233
218 Ga0207643_10298640 3300025908 Bacteria 1002
219 Ga0207705_10071706 3300025909 Bacteria 2511
220 Ga0207684_10915995 3300025910 Bacteria 736
221 Ga0207654_10394219 3300025911 Bacteria 961
222 Ga0207654_10836704 3300025911 Bacteria 666
223 Ga0207707_10054831 3300025912 Bacteria 3469
224 Ga0207695_10102914 3300025913 Bacteria 2848
225 Ga0207660_10117696 3300025917 Bacteria 2009
226 Ga0207660_10392519 3300025917 Bacteria 1117
227 Ga0207657_10003899 3300025919 Bacteria 15830
228 Ga0207657_10096050 3300025919 Bacteria 2465
229 Ga0207657_10100723 3300025919 Bacteria 2398
230 Ga0207649_10006520 3300025920 Bacteria 6341
231 Ga0207649_10304552 3300025920 Bacteria 1166
232 Ga0207649_10590606 3300025920 Bacteria 853
233 Ga0207652_10037736 3300025921 Bacteria 4090
234 Ga0207681_10099449 3300025923 Bacteria 2095
235 Ga0207681_11275960 3300025923 Bacteria 617
236 Ga0207694_10380618 3300025924 Bacteria 1171
237 Ga0207694_10430491 3300025924 Bacteria 1100
238 Ga0207694_11096938 3300025924 Bacteria 674
239 Ga0207659_10092959 3300025926 Bacteria 2256
240 Ga0207687_10013736 3300025927 Bacteria 5288
241 Ga0207687_10016661 3300025927 Bacteria 4829
242 Ga0207687_10142698 3300025927 Bacteria 1819
243 Ga0207687_10212582 3300025927 Bacteria 1518
244 Ga0207644_10066346 3300025931 Bacteria 2628
245 Ga0207644_11544993 3300025931 Bacteria 557
246 Ga0207690_10335931 3300025932 Bacteria 1191
247 Ga0207706_10025020 3300025933 Bacteria 5353
248 Ga0207709_10073411 3300025935 Bacteria 2180
249 Ga0207670_10034221 3300025936 Bacteria 3281
250 Ga0207669_10149972 3300025937 Bacteria 1632
251 Ga0207669_10599572 3300025937 Bacteria 895
252 Ga0207669_10602795 3300025937 Bacteria 893
253 Ga0207669_11603503 3300025937 Bacteria 555
254 Ga0207704_10208415 3300025938 Bacteria 1436
255 Ga0207691_10012064 3300025940 Bacteria 8290
256 Ga0207691_10107668 3300025940 Bacteria 2481
257 Ga0207711_10184292 3300025941 Bacteria 1900
258 Ga0207711_10312454 3300025941 Bacteria 1451
259 Ga0207711_10352632 3300025941 Bacteria 1362
260 Ga0207689_10286399 3300025942 Bacteria 1364
261 Ga0207661_10000612 3300025944 Bacteria 22876
262 Ga0207661_10036867 3300025944 Bacteria 3820
263 Ga0207661_10112769 3300025944 Bacteria 2302
264 Ga0207661_10192037 3300025944 Bacteria 1791
265 Ga0207679_10032672 3300025945 Bacteria 3656
266 Ga0207667_10112125 3300025949 Bacteria 2813
267 Ga0207651_10034406 3300025960 Bacteria 3281
268 Ga0207668_10748690 3300025972 Bacteria 862
269 Ga0207668_10796851 3300025972 Bacteria 836
270 Ga0207668_11647449 3300025972 Bacteria 579
271 Ga0207640_10029860 3300025981 Bacteria 3351
272 Ga0207640_10090400 3300025981 Bacteria 2119
273 Ga0207658_10171285 3300025986 Bacteria 1789
274 Ga0207658_10332570 3300025986 Bacteria 1318
275 Ga0207658_10884541 3300025986 Bacteria 813
276 Ga0207677_10063520 3300026023 Bacteria 2567
277 Ga0207677_10180059 3300026023 Bacteria 1662
278 Ga0207677_10385422 3300026023 Bacteria 1184
279 Ga0207677_10943416 3300026023 Bacteria 780
280 Ga0207677_11658810 3300026023 Bacteria 592
281 Ga0207703_10209426 3300026035 Bacteria 1737
282 Ga0207639_10043499 3300026041 Bacteria 3372
283 Ga0207639_10623234 3300026041 Bacteria 996
284 Ga0207678_10023034 3300026067 Bacteria 5450
285 Ga0207678_10252108 3300026067 Bacteria 1512
286 Ga0207678_10799359 3300026067 Bacteria 833
287 Ga0207708_10018168 3300026075 Bacteria 5293
288 Ga0207702_10257448 3300026078 Bacteria 1642
289 Ga0207641_10281253 3300026088 Bacteria 1565
290 Ga0207641_10557397 3300026088 Bacteria 1118
291 Ga0207648_10051981 3300026089 Bacteria 3582
292 Ga0207648_10117585 3300026089 Bacteria 2336
293 Ga0207648_10136343 3300026089 Bacteria 2162
294 Ga0207648_10284913 3300026089 Bacteria 1478
295 Ga0207676_10130427 3300026095 Bacteria 2136
296 Ga0207676_11485750 3300026095 Bacteria 674
297 Ga0207674_10031518 3300026116 Bacteria 5569
298 Ga0207674_10051257 3300026116 Bacteria 4212
299 Ga0207674_10150529 3300026116 Bacteria 2284
300 Ga0207675_100080618 3300026118 Bacteria 3051
301 Ga0207675_100447890 3300026118 Bacteria 1279
302 Ga0207683_10004422 3300026121 Bacteria 12149
303 Ga0207683_10148772 3300026121 Bacteria 2113
304 Ga0207683_10295919 3300026121 Bacteria 1481
305 Ga0207683_11130678 3300026121 Bacteria 726
306 Ga0207698_10003410 3300026142 Bacteria 9566
307 Ga0207698_10923958 3300026142 Bacteria 881
308 Ga0207698_10937676 3300026142 Bacteria 874
309 Ga0207428_10192889 3300027907 Bacteria 1535
310 Ga0268266_10013084 3300028379 Bacteria 7155
311 Ga0268266_10443083 3300028379 Bacteria 1234
312 Ga0268266_10513609 3300028379 Bacteria 1145
313 Ga0268264_10074484 3300028381 Bacteria 2884
314 Ga0268264_10366227 3300028381 Bacteria 1376
315 Ga0268264_10574287 3300028381 Bacteria 1108
316 Ga0268256_1038324 3300030500 Bacteria 1091
317 Ga0265325_10002730 3300031241 Bacteria 11787
318 Ga0265339_10386699 3300031249 Bacteria 655
319 Ga0265331_10087071 3300031250 Bacteria 1447
320 Ga0265314_10301065 3300031711 Bacteria 900
321 Ga0307406_10412973 3300031901 Bacteria 1073
322 Ga0307409_100507249 3300031995 Bacteria 1176
323 Ga0307416_101087250 3300032002 Bacteria 904
324 Ga0373948_0117426 3300034817 Bacteria 640
325 Ga0373952_0053518 3300035092 Bacteria 969
326 Ga0373954_0468802 3300035118 Bacteria 624
327 Ga0373955_0322230 3300035172 Bacteria 934
328 Ga0373924_0207974 3300035410 Bacteria 864
329 Ga0373947_0431025 3300035725 Bacteria 892
330 Ga0373937_1183005 3300036401 Bacteria 713
331 Ga0373925_0167162 3300037068 Bacteria 1735
332 Ga0395899_0077938 3300037312 Bacteria 2416
333 Ga0395900_0028676 3300037418 Bacteria 5705
334 Ga0395900_0096561 3300037418 Bacteria 3036
335 Ga0395898_0195827 3300037466 Bacteria 1930
336 Ga0395901_0625807 3300038443 Bacteria 1082
337 Ga0242420_022267 3300038996 Bacteria 1139
338 Ga0451802_0780308 3300041460 Bacteria 2533
339 Ga0451806_598508 3300041462 Bacteria 3344
340 Ga0451804_0405045 3300041463 Bacteria 1586
341 Ga0451807_2427642 3300041486 Bacteria 1318
342 Ga0451835_0134562 3300041492 Bacteria 1092
343 Ga0450914_007942 3300042118 Bacteria 970
344 Ga0450920_002200 3300042122 Bacteria 3301
345 Ga0450920_011995 3300042122 Bacteria 1621
346 Ga0450903_038151 3300042138 Bacteria 714
347 Ga0450889_022828 3300042144 Bacteria 703
348 Ga0450906_011271 3300042145 Bacteria 1674
349 Ga0450908_086376 3300042184 Bacteria 566
350 Ga0466967_0392406 3300045976 Bacteria 1349
351 Ga0495629_0505546 3300046459 Bacteria 815
352 Ga0495653_0111342 3300046463 Bacteria 1967
353 Ga0495605_0167380 3300046474 Bacteria 973
354 Ga0495585_0177134 3300046492 Bacteria 1098
355 Ga0495594_0237099 3300046499 Bacteria 1040
356 Ga0495596_0155507 3300046500 Bacteria 888
357 Ga0495630_0355195 3300046517 Bacteria 1122
358 Ga0495637_0195970 3300046520 Bacteria 744
359 Ga0495644_0077450 3300046523 Bacteria 1253
360 Ga0495633_0136397 3300046558 Bacteria 1135
361 Ga0495635_0269920 3300046663 Bacteria 1144
362 Ga0495658_0139862 3300046683 Bacteria 1480
363 Ga0495613_0171116 3300046689 Bacteria 1542
364 Ga0495670_0242750 3300046691 Bacteria 959
365 Ga0495670_0256573 3300046691 Bacteria 933
366 Ga0495670_0339276 3300046691 Bacteria 808
367 Ga0495589_0289274 3300046794 Bacteria 761
368 Ga0495600_0518898 3300046809 Bacteria 731
369 Ga0495683_0167571 3300047323 Bacteria 1012
370 Ga0495684_0477198 3300047471 Bacteria 862
371 Ga0496101_0135694 3300048904 Bacteria 1872
372 Ga0496101_0171055 3300048904 Bacteria 1670
373 Ga0496101_1122356 3300048904 Bacteria 617
374 Ga0496101_1339070 3300048904 Bacteria 559
375 Ga0496102_0191596 3300048905 Bacteria 1927
376 Ga0496104_0091178 3300048907 Bacteria 2913
377 Ga0496104_0472593 3300048907 Bacteria 1165
378 Ga0496104_0661702 3300048907 Bacteria 953
379 Ga0496105_0052455 3300048908 Bacteria 3369
380 Ga0496105_0081155 3300048908 Bacteria 2679
381 Ga0496106_0454296 3300048909 Bacteria 1029
382 Ga0496106_1194684 3300048909 Bacteria 593
383 Ga0496107_0518884 3300048910 Bacteria 883
384 Ga0496108_0019446 3300048911 Bacteria 5578
385 Ga0496109_0002689 3300048912 Bacteria 14909
386 Ga0496109_0090253 3300048912 Bacteria 2834
387 Ga0496109_0090877 3300048912 Bacteria 2824
388 Ga0496109_0180292 3300048912 Bacteria 1983
389 Ga0496109_1778717 3300048912 Bacteria 549
390 Ga0496110_0220142 3300048913 Bacteria 1726
391 Ga0496111_0003152 3300048914 Bacteria 10149
392 Ga0496111_0171064 3300048914 Bacteria 1614
393 Ga0496111_0765033 3300048914 Bacteria 700
394 Ga0496112_0795999 3300048915 Bacteria 870
395 Ga0496113_0150395 3300048916 Bacteria 1836
396 Ga0496113_0539975 3300048916 Bacteria 935
397 Ga0496114_0048670 3300048917 Bacteria 3526
398 Ga0496114_0068122 3300048917 Bacteria 2987
399 Ga0496114_0172327 3300048917 Bacteria 1886
400 Ga0496114_0342865 3300048917 Bacteria 1321
401 Ga0496114_1466348 3300048917 Bacteria 570
402 Ga0496115_0072007 3300048918 Bacteria 2804
403 Ga0496124_0086918 3300048927 Bacteria 2558
404 Ga0501031_0015630 3300049568 Bacteria 4927
405 Ga0501031_0029334 3300049568 Bacteria 3589
406 Ga0501032_0099603 3300049569 Bacteria 1925
407 Ga0501033_0048185 3300049570 Bacteria 3165
408 Ga0501034_1362656 3300049571 Bacteria 585
409 Ga0501036_0029538 3300049572 Bacteria 4630
410 Ga0501036_0038625 3300049572 Bacteria 4040
411 Ga0501036_0718318 3300049572 Bacteria 825
412 Ga0501037_0025296 3300049573 Bacteria 4385
413 Ga0501037_0681712 3300049573 Bacteria 685
414 Ga0501038_0002057 3300049574 Bacteria 18626
415 Ga0501038_0085943 3300049574 Bacteria 2644
416 Ga0501039_0016341 3300049575 Bacteria 5687
417 Ga0501039_0166079 3300049575 Bacteria 1735
418 Ga0501040_0026574 3300049576 Bacteria 3893
419 Ga0501040_0062134 3300049576 Bacteria 2570
420 Ga0501040_0164912 3300049576 Bacteria 1567
421 Ga0501040_0291525 3300049576 Bacteria 1166
422 Ga0501040_0365713 3300049576 Bacteria 1034
423 Ga0501041_0010597 3300049577 Bacteria 5434
424 Ga0501041_0030300 3300049577 Bacteria 3266
425 Ga0501041_0192717 3300049577 Bacteria 1277
426 Ga0501041_0370357 3300049577 Bacteria 906
427 Ga0501042_0009155 3300049578 Bacteria 6585
428 Ga0501042_0115592 3300049578 Bacteria 1932
429 Ga0501042_0139413 3300049578 Bacteria 1748
430 Ga0501042_0538960 3300049578 Bacteria 848
431 Ga0501043_0010538 3300049579 Bacteria 7237
432 Ga0501043_1093732 3300049579 Bacteria 564
433 Ga0501046_0266074 3300049580 Bacteria 1258
434 Ga0501046_0534920 3300049580 Bacteria 837
435 Ga0501046_1140576 3300049580 Bacteria 537
436 Ga0501048_0012115 3300049582 Bacteria 6426
437 Ga0501048_0074741 3300049582 Bacteria 2391
438 Ga0501048_1125091 3300049582 Bacteria 565
439 Ga0501068_0009535 3300049584 Bacteria 5435
440 Ga0501069_0018992 3300049585 Bacteria 3712
441 Ga0501069_0391283 3300049585 Bacteria 822
442 Ga0501070_0014080 3300049586 Bacteria 6733
443 Ga0501071_0009102 3300049587 Bacteria 6593
444 Ga0501071_0057452 3300049587 Bacteria 2812
445 Ga0501071_0070959 3300049587 Bacteria 2539
446 Ga0501071_0119589 3300049587 Bacteria 1952
447 Ga0501071_0166559 3300049587 Bacteria 1649
448 Ga0501071_0310384 3300049587 Bacteria 1197
449 Ga0501071_0489051 3300049587 Bacteria 943
450 Ga0501072_0023714 3300049588 Bacteria 4767
451 Ga0501072_0062147 3300049588 Bacteria 2946
452 Ga0501072_0130038 3300049588 Bacteria 2006
453 Ga0501072_0407090 3300049588 Bacteria 1079
454 Ga0501072_0587924 3300049588 Bacteria 878
455 Ga0501073_0056873 3300049589 Bacteria 2735
456 Ga0501073_0384861 3300049589 Bacteria 969
457 Ga0501074_0043103 3300049590 Bacteria 3265
458 Ga0501074_0058249 3300049590 Bacteria 2783
459 Ga0501075_0014619 3300049591 Bacteria 5625
460 Ga0501075_0039365 3300049591 Bacteria 3539
461 Ga0501075_0271972 3300049591 Bacteria 1291
462 Ga0501075_0350695 3300049591 Bacteria 1124
463 Ga0501075_0358243 3300049591 Bacteria 1112
464 Ga0501076_0038684 3300049592 Bacteria 3745
465 Ga0501076_0041475 3300049592 Bacteria 3621
466 Ga0501076_0092256 3300049592 Bacteria 2436
467 Ga0501076_0112120 3300049592 Bacteria 2206
468 Ga0501076_0353967 3300049592 Bacteria 1206
469 Ga0501076_0683455 3300049592 Bacteria 847
470 Ga0501076_0821297 3300049592 Bacteria 767
471 Ga0501077_0127135 3300049593 Bacteria 1615
472 Ga0501077_0498060 3300049593 Bacteria 781
473 Ga0501079_0014596 3300049741 Bacteria 5990
474 Ga0501079_0064351 3300049741 Bacteria 2829
475 Ga0501079_0143702 3300049741 Bacteria 1859
476 Ga0501079_0215928 3300049741 Bacteria 1498
477 Ga0501079_0358664 3300049741 Bacteria 1142
478 Ga0501079_0798585 3300049741 Bacteria 743
479 Ga0501080_0029553 3300049742 Bacteria 5102
480 Ga0501080_0370348 3300049742 Bacteria 1292
481 Ga0501080_0653620 3300049742 Bacteria 930
482 Ga0501081_0007368 3300049743 Bacteria 7141
483 Ga0501081_0017118 3300049743 Bacteria 4795
484 Ga0501081_0107584 3300049743 Bacteria 1977
485 Ga0501081_0577330 3300049743 Bacteria 841
486 Ga0501083_0006865 3300049744 Bacteria 8081
487 Ga0501083_0126702 3300049744 Bacteria 1674
488 Ga0501035_0001451 3300049822 Bacteria 24293
489 Ga0501035_0511204 3300049822 Bacteria 988
490 Ga0501035_0674057 3300049822 Bacteria 836
491 Ga0501044_0207323 3300049823 Bacteria 1916
492 Ga0501045_0016072 3300049824 Bacteria 5310
493 Ga0501045_0023232 3300049824 Bacteria 4443
494 Ga0501045_0038712 3300049824 Bacteria 3469
495 nmdc:mga0yw44_100924_c1 3300050492 Bacteria 1838
496 nmdc:mga05p37_169125_c1 3300050507 Bacteria 1447
497 nmdc:mga05p37_286231_c1 3300050507 Bacteria 1963
498 nmdc:mga05p37_989323_c1 3300050507 Bacteria 895
499 nmdc:mga09592_261880_c1 3300050508 Bacteria 1500
500 nmdc:mga0qj67_167532_c1 3300050509 Bacteria 1784
501 nmdc:mga06r32_112753_c1 3300050510 Bacteria 2676
502 nmdc:mga06r32_1429420_c1 3300050510 Bacteria 633
503 nmdc:mga08y16_114200_c1 3300050511 Bacteria 2811
504 Ga0501084_0028648 3300054114 Bacteria 4656
505 Ga0501084_0081533 3300054114 Bacteria 2714
506 Ga0501084_0108456 3300054114 Bacteria 2332
507 Ga0501084_0343205 3300054114 Bacteria 1261
508 Ga0501084_0412356 3300054114 Bacteria 1142
509 Ga0501084_0638693 3300054114 Bacteria 899
510 Ga0501084_0957740 3300054114 Bacteria 719
511 Ga0501082_0072498 3300060353 Bacteria 2967
512 Ga0501082_0105271 3300060353 Bacteria 2440
513 Ga0501082_0186292 3300060353 Bacteria 1806
514 Ga0501082_0272937 3300060353 Bacteria 1472
515 Ga0501082_0390689 3300060353 Bacteria 1214
516 Ga0501082_0609197 3300060353 Bacteria 956
517 Ga0530510_0020335 3300061734 Bacteria 4720
518 Ga0530510_0070530 3300061734 Bacteria 2536
519 Ga0530510_0167903 3300061734 Bacteria 1625
520 Ga0530510_0621019 3300061734 Bacteria 822
521 644751340 644736347 Bacteria 6476522
522 2513955634 2513237150 Bacteria 6553639
523 2514041945 2513237165 Bacteria 6771773
524 JGI24751J29686_10008344
525 Ga0070658_10028759
526 Ga0070658_10056818
527 Ga0070658_10242715
528 Ga0070683_100060646
529 Ga0070683_100076390
530 Ga0070683_100154338
531 Ga0070683_100236987
532 Ga0070683_100332970
533 Ga0070683_100906757
534 Ga0070670_100124879
535 Ga0070670_100488391
536 Ga0070670_100778902
537 Ga0070666_10177875
538 Ga0070680_100426163
539 Ga0070682_100144056
540 Ga0068868_100041545
541 Ga0068868_100382738
542 Ga0068868_101005540
543 Ga0068868_102219673
544 Ga0070660_100004686
545 Ga0070689_100740577
546 Ga0070691_10001238
547 Ga0070661_100014709
548 Ga0070661_100153625
549 Ga0070661_100251270
550 Ga0070692_10022576
551 Ga0070668_100638142
552 Ga0070668_100972083
553 Ga0070669_100600703
554 Ga0070675_100070318
555 Ga0070675_100135939
556 Ga0070675_100576121
557 Ga0070671_100164344
558 Ga0070674_100024475
559 Ga0070674_100592000
560 Ga0070674_100622569
561 Ga0070674_100715699
562 Ga0070673_100018293
563 Ga0070673_100052387
564 Ga0070673_100767481
565 Ga0070673_101101753
566 Ga0070688_100479810
567 Ga0070659_100054025
568 Ga0070659_100621271
569 Ga0070667_100290859
570 Ga0070667_100545753
571 Ga0070701_10003360
572 Ga0070705_100148375
573 Ga0070700_100762404
574 Ga0070694_100251963
575 Ga0070663_100144391
576 Ga0070678_100043118
577 Ga0070678_100258575
578 Ga0070678_101131627
579 Ga0070662_100053334
580 Ga0070662_100183820
581 Ga0070681_10154466
582 Ga0068867_100043815
583 Ga0068867_100910650
584 Ga0070685_10083614
585 Ga0070685_10476747
586 Ga0070706_101564790
587 Ga0070706_101742852
588 Ga0070699_100975459
589 Ga0070679_100221790
590 Ga0070684_100058245
591 Ga0070684_100166083
592 Ga0070684_100195568
593 Ga0070697_100250641
594 Ga0068853_100018683
595 Ga0068853_100106303
596 Ga0070672_100051648
597 Ga0070672_100303136
598 Ga0070672_100710233
599 Ga0070686_100033362
600 Ga0070686_100425093
601 Ga0070696_100023307
602 Ga0070696_100787633
603 Ga0070693_100028511
604 Ga0070665_100092614
605 Ga0070665_100417489
606 Ga0070704_100016961
607 Ga0070704_100106164
608 Ga0068855_100140921
609 Ga0070664_100126373
610 Ga0070664_100205771
611 Ga0070664_101546718
612 Ga0068857_100071647
613 Ga0068857_100236872
614 Ga0068857_100747237
615 Ga0068854_100027354
616 Ga0068856_100547063
617 Ga0070702_100044645
618 Ga0070702_100185281
619 Ga0070702_100397558
620 Ga0068852_100041156
621 Ga0068852_100332174
622 Ga0068859_100074199
623 Ga0068864_100015387
624 Ga0068864_100141749
625 Ga0068864_100296911
626 Ga0068861_100058556
627 Ga0068851_10098871
628 Ga0068870_10035545
629 Ga0068863_100203462
630 Ga0068863_100874659
631 Ga0068858_100763109
632 Ga0068860_100197903
633 Ga0068860_100391872
634 Ga0068862_100319069
635 Ga0081455_10069535
636 Ga0081455_10134702
637 Ga0075365_10117500
638 Ga0075432_10079549
639 Ga0068871_100028349
640 Ga0068871_100040104
641 Ga0075428_100023563
642 Ga0075428_101313782
643 Ga0075431_100166010
644 Ga0075433_10174705
645 Ga0075429_100033517
646 Ga0075429_100033971
647 Ga0068865_100021316
648 Ga0068865_100322120
649 Ga0068865_100657220
650 Ga0075436_100658139
651 Ga0097620_100074199
652 Ga0105240_10051692
653 Ga0105240_10161322
654 Ga0105240_10447125
655 Ga0105245_10023925
656 Ga0105245_10084735
657 Ga0105245_10111204
658 Ga0105245_10202847
659 Ga0105245_10347847
660 Ga0105245_11107388
661 Ga0105245_11799602
662 Ga0105247_10016412
663 Ga0105247_10156390
664 Ga0114129_10044878
665 Ga0114129_10303666
666 Ga0114129_10708755
667 Ga0114129_10731778
668 Ga0114129_11396741
669 Ga0105243_10016636
670 Ga0105243_10017347
671 Ga0105243_10133513
672 Ga0105243_10348826
673 Ga0105243_11830913
674 Ga0105241_11515381
675 Ga0105242_10055837
676 Ga0105242_10058043
677 Ga0105242_10079888
678 Ga0105242_10371992
679 Ga0105242_10554574
680 Ga0105248_10020955
681 Ga0105248_10594208
682 Ga0105248_10794119
683 Ga0105237_10081750
684 Ga0105237_10565393
685 Ga0105237_11559023
686 Ga0105238_10013503
687 Ga0105238_10922905
688 Ga0105238_11321362
689 Ga0105239_10123050
690 Ga0105239_10232038
691 Ga0105239_10467448
692 Ga0105239_11267783
693 Ga0105246_10056040
694 Ga0105246_10350794
695 Ga0105246_10555413
696 Ga0105246_10614043
697 Ga0157320_1008564
698 Ga0157321_1011304
699 Ga0157342_1004253
700 Ga0157371_10041681
701 Ga0157371_10099569
702 Ga0157370_10251529
703 Ga0157370_10255148
704 Ga0157369_10087965
705 Ga0157378_10802196
706 Ga0157378_13076052
707 Ga0163162_10625545
708 Ga0163162_10969331
709 Ga0163162_11911477
710 Ga0157372_10009445
711 Ga0157372_10105468
712 Ga0157375_10029312
713 Ga0157375_10041884
714 Ga0163163_10007040
715 Ga0163163_10116296
716 Ga0163163_10760342
717 Ga0157380_10341302
718 Ga0157380_12058810
719 Ga0157377_10032618
720 Ga0157377_10033970
721 Ga0157379_10032751
722 Ga0157379_10153273
723 Ga0157376_10018213
724 Ga0157376_10111123
725 Ga0157376_10695677
726 Ga0163161_10017266
727 Ga0197907_11185842
728 Ga0206356_10423462
729 Ga0206356_11649714
730 Ga0206353_10010347
731 Ga0207656_10063602
732 Ga0207656_10183953
733 Ga0207653_10009216
734 Ga0207682_10192220
735 Ga0207710_10376965
736 Ga0207688_10197087
737 Ga0207680_10134445
738 Ga0207680_10557364
739 Ga0207647_10109262
740 Ga0207645_10226488
741 Ga0207643_10298640
742 Ga0207705_10071706
743 Ga0207684_10915995
744 Ga0207654_10394219
745 Ga0207654_10836704
746 Ga0207707_10054831
747 Ga0207695_10102914
748 Ga0207660_10117696
749 Ga0207660_10392519
750 Ga0207657_10003899
751 Ga0207657_10096050
752 Ga0207657_10100723
753 Ga0207649_10006520
754 Ga0207649_10304552
755 Ga0207649_10590606
756 Ga0207652_10037736
757 Ga0207681_10099449
758 Ga0207681_11275960
759 Ga0207694_10380618
760 Ga0207694_10430491
761 Ga0207694_11096938
762 Ga0207659_10092959
763 Ga0207687_10013736
764 Ga0207687_10016661
765 Ga0207687_10142698
766 Ga0207687_10212582
767 Ga0207644_10066346
768 Ga0207644_11544993
769 Ga0207690_10335931
770 Ga0207706_10025020
771 Ga0207709_10073411
772 Ga0207670_10034221
773 Ga0207669_10149972
774 Ga0207669_10599572
775 Ga0207669_10602795
776 Ga0207669_11603503
777 Ga0207704_10208415
778 Ga0207691_10012064
779 Ga0207691_10107668
780 Ga0207711_10184292
781 Ga0207711_10312454
782 Ga0207711_10352632
783 Ga0207689_10286399
784 Ga0207661_10000612
785 Ga0207661_10036867
786 Ga0207661_10112769
787 Ga0207661_10192037
788 Ga0207679_10032672
789 Ga0207667_10112125
790 Ga0207651_10034406
791 Ga0207668_10748690
792 Ga0207668_10796851
793 Ga0207668_11647449
794 Ga0207640_10029860
795 Ga0207640_10090400
796 Ga0207658_10171285
797 Ga0207658_10332570
798 Ga0207658_10884541
799 Ga0207677_10063520
800 Ga0207677_10180059
801 Ga0207677_10385422
802 Ga0207677_10943416
803 Ga0207677_11658810
804 Ga0207703_10209426
805 Ga0207639_10043499
806 Ga0207639_10623234
807 Ga0207678_10023034
808 Ga0207678_10252108
809 Ga0207678_10799359
810 Ga0207708_10018168
811 Ga0207702_10257448
812 Ga0207641_10281253
813 Ga0207641_10557397
814 Ga0207648_10051981
815 Ga0207648_10117585
816 Ga0207648_10136343
817 Ga0207648_10284913
818 Ga0207676_10130427
819 Ga0207676_11485750
820 Ga0207674_10031518
821 Ga0207674_10051257
822 Ga0207674_10150529
823 Ga0207675_100080618
824 Ga0207675_100447890
825 Ga0207683_10004422
826 Ga0207683_10148772
827 Ga0207683_10295919
828 Ga0207683_11130678
829 Ga0207698_10003410
830 Ga0207698_10923958
831 Ga0207698_10937676
832 Ga0207428_10192889
833 Ga0268266_10013084
834 Ga0268266_10443083
835 Ga0268266_10513609
836 Ga0268264_10074484
837 Ga0268264_10366227
838 Ga0268264_10574287
839 Ga0268256_1038324
840 Ga0265325_10002730
841 Ga0265339_10386699
842 Ga0265331_10087071
843 Ga0265314_10301065
844 Ga0307406_10412973
845 Ga0307409_100507249
846 Ga0307416_101087250
847 Ga0373948_0117426
848 Ga0373952_0053518
849 Ga0373954_0468802
850 Ga0373955_0322230
851 Ga0373924_0207974
852 Ga0373947_0431025
853 Ga0373937_1183005
854 Ga0373925_0167162
855 Ga0395899_0077938
856 Ga0395900_0028676
857 Ga0395900_0096561
858 Ga0395898_0195827
859 Ga0395901_0625807
860 Ga0242420_022267
861 Ga0451802_0780308
862 Ga0451806_598508
863 Ga0451804_0405045
864 Ga0451807_2427642
865 Ga0451835_0134562
866 Ga0450914_007942
867 Ga0450920_002200
868 Ga0450920_011995
869 Ga0450903_038151
870 Ga0450889_022828
871 Ga0450906_011271
872 Ga0450908_086376
873 Ga0466967_0392406
874 Ga0495629_0505546
875 Ga0495653_0111342
876 Ga0495605_0167380
877 Ga0495585_0177134
878 Ga0495594_0237099
879 Ga0495596_0155507
880 Ga0495630_0355195
881 Ga0495637_0195970
882 Ga0495644_0077450
883 Ga0495633_0136397
884 Ga0495635_0269920
885 Ga0495658_0139862
886 Ga0495613_0171116
887 Ga0495670_0242750
888 Ga0495670_0256573
889 Ga0495670_0339276
890 Ga0495589_0289274
891 Ga0495600_0518898
892 Ga0495683_0167571
893 Ga0495684_0477198
894 Ga0496101_0135694
895 Ga0496101_0171055
896 Ga0496101_1122356
897 Ga0496101_1339070
898 Ga0496102_0191596
899 Ga0496104_0091178
900 Ga0496104_0472593
901 Ga0496104_0661702
902 Ga0496105_0052455
903 Ga0496105_0081155
904 Ga0496106_0454296
905 Ga0496106_1194684
906 Ga0496107_0518884
907 Ga0496108_0019446
908 Ga0496109_0002689
909 Ga0496109_0090253
910 Ga0496109_0090877
911 Ga0496109_0180292
912 Ga0496109_1778717
913 Ga0496110_0220142
914 Ga0496111_0003152
915 Ga0496111_0171064
916 Ga0496111_0765033
917 Ga0496112_0795999
918 Ga0496113_0150395
919 Ga0496113_0539975
920 Ga0496114_0048670
921 Ga0496114_0068122
922 Ga0496114_0172327
923 Ga0496114_0342865
924 Ga0496114_1466348
925 Ga0496115_0072007
926 Ga0496124_0086918
927 Ga0501031_0015630
928 Ga0501031_0029334
929 Ga0501032_0099603
930 Ga0501033_0048185
931 Ga0501034_1362656
932 Ga0501036_0029538
933 Ga0501036_0038625
934 Ga0501036_0718318
935 Ga0501037_0025296
936 Ga0501037_0681712
937 Ga0501038_0002057
938 Ga0501038_0085943
939 Ga0501039_0016341
940 Ga0501039_0166079
941 Ga0501040_0026574
942 Ga0501040_0062134
943 Ga0501040_0164912
944 Ga0501040_0291525
945 Ga0501040_0365713
946 Ga0501041_0010597
947 Ga0501041_0030300
948 Ga0501041_0192717
949 Ga0501041_0370357
950 Ga0501042_0009155
951 Ga0501042_0115592
952 Ga0501042_0139413
953 Ga0501042_0538960
954 Ga0501043_0010538
955 Ga0501043_1093732
956 Ga0501046_0266074
957 Ga0501046_0534920
958 Ga0501046_1140576
959 Ga0501048_0012115
960 Ga0501048_0074741
961 Ga0501048_1125091
962 Ga0501068_0009535
963 Ga0501069_0018992
964 Ga0501069_0391283
965 Ga0501070_0014080
966 Ga0501071_0009102
967 Ga0501071_0057452
968 Ga0501071_0070959
969 Ga0501071_0119589
970 Ga0501071_0166559
971 Ga0501071_0310384
972 Ga0501071_0489051
973 Ga0501072_0023714
974 Ga0501072_0062147
975 Ga0501072_0130038
976 Ga0501072_0407090
977 Ga0501072_0587924
978 Ga0501073_0056873
979 Ga0501073_0384861
980 Ga0501074_0043103
981 Ga0501074_0058249
982 Ga0501075_0014619
983 Ga0501075_0039365
984 Ga0501075_0271972
985 Ga0501075_0350695
986 Ga0501075_0358243
987 Ga0501076_0038684
988 Ga0501076_0041475
989 Ga0501076_0092256
990 Ga0501076_0112120
991 Ga0501076_0353967
992 Ga0501076_0683455
993 Ga0501076_0821297
994 Ga0501077_0127135
995 Ga0501077_0498060
996 Ga0501079_0014596
997 Ga0501079_0064351
998 Ga0501079_0143702
999 Ga0501079_0215928
1000 Ga0501079_0358664
1001 Ga0501079_0798585
1002 Ga0501080_0029553
1003 Ga0501080_0370348
1004 Ga0501080_0653620
1005 Ga0501081_0007368
1006 Ga0501081_0017118
1007 Ga0501081_0107584
1008 Ga0501081_0577330
1009 Ga0501083_0006865
1010 Ga0501083_0126702
1011 Ga0501035_0001451
1012 Ga0501035_0511204
1013 Ga0501035_0674057
1014 Ga0501044_0207323
1015 Ga0501045_0016072
1016 Ga0501045_0023232
1017 Ga0501045_0038712
1018 nmdc:mga0yw44_100924_c1
1019 nmdc:mga05p37_169125_c1
1020 nmdc:mga05p37_286231_c1
1021 nmdc:mga05p37_989323_c1
1022 nmdc:mga09592_261880_c1
1023 nmdc:mga0qj67_167532_c1
1024 nmdc:mga06r32_112753_c1
1025 nmdc:mga06r32_1429420_c1
1026 nmdc:mga08y16_114200_c1
1027 Ga0501084_0028648
1028 Ga0501084_0081533
1029 Ga0501084_0108456
1030 Ga0501084_0343205
1031 Ga0501084_0412356
1032 Ga0501084_0638693
1033 Ga0501084_0957740
1034 Ga0501082_0072498
1035 Ga0501082_0105271
1036 Ga0501082_0186292
1037 Ga0501082_0272937
1038 Ga0501082_0390689
1039 Ga0501082_0609197
1040 Ga0530510_0020335
1041 Ga0530510_0070530
1042 Ga0530510_0167903
1043 Ga0530510_0621019
1044 644751340
1045 2513955634
1046 2514041945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

93

164

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

25

90

0.87

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

24

115

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9539 1 150
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.95 2 154
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9493 2 150
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9488 1 154
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.943 2 155
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9537 2 76 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9532 2 75 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9433 1 73 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9403 1 76 3.10.20.30
af_P22985_1_94_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9379 3 81 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A538PHS1-F1-model_v4 (2Fe-2S)-binding protein 0.9847 2 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V8M2P3-F1-model_v4 (2Fe-2S)-binding protein 0.9845 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V9DAT7-F1-model_v4 (2Fe-2S)-binding protein 0.983 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A1F2SC53-F1-model_v4 (2Fe-2S)-binding protein 0.9807 1 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A1W6ZC29-F1-model_v4 (2Fe-2S)-binding protein 0.9796 2 152 GO:0016491
GO:0046872
GO:0051537

Map