F459054

General Info

Members Datasets Scaffolds Average Seq Length
523 403 357 351

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0031107|Ga0501033_0031107_1682_2860
Length 392
Sequence MSQQPALPPGRSTAYFRNPTHQRVTHDGEMDMTAKAIRTTNGRGRLFDSVLDTIGDTPAIRVNHIGIDGVTMYVKAEYFNPASSVKDRLAIGIIEEAERSGALKPGQTVVEATSGNTGIGLAMVCAQKGYPLVVTMADSFSIERRRLMRMLGAKVVLTPRAEKGFGMYRKAVELAEKHGWFLAHQFEAAANAAIHEATTGREIINDFAGGRLDYFVTGYGTGGTMVGVSRVLRKERPETKIILSEPANAQLIGSGTPQQRTADGEPAAGHPAFEPHPIQGWTPDFIPKVLQEAIDKQYYDELIPIAGPKAIEWAKALAQREGIFTGISGGATFGVARQIAEKASAGSVILCMLPDTGERYLSTPLFDAIPADMDDAEVALSRSTPGYQMPAG

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2512875024 Mesorhizobium loti R88b Isolate Nodule
5 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
6 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
7 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
8 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
9 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
10 2643221557 Ensifer sp. Root558 Isolate Unclassified
11 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
12 2643221610 Ensifer sp. Root74 Isolate Unclassified
13 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
14 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
15 2643221668 Ensifer sp. Root423 Isolate Unclassified
16 2643221675 Ensifer sp. Root1298 Isolate Unclassified
17 2643221680 Ensifer sp. Root1312 Isolate Unclassified
18 2643221726 Ensifer sp. Root954 Isolate Unclassified
19 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
20 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
21 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
23 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
24 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
25 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
26 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
27 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
28 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
29 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
30 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
31 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
32 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
33 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
34 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
35 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
36 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
37 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
38 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
39 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
40 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
41 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
42 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
43 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
44 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
45 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
46 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
47 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
48 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
49 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
50 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
51 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
52 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
53 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
54 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
55 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
56 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
57 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
58 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
59 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
60 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
61 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
62 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
63 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
64 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
65 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
66 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
67 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
68 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
69 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
70 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
71 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
72 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
73 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
74 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
75 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
76 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
77 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
78 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
79 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
80 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
81 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
82 2909042592 Labrys sp. LIt4 Isolate Nodule
83 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
84 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
85 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
86 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
87 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
88 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
89 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
90 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
91 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
92 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
93 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
94 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
95 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
96 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
97 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
98 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
99 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
100 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
101 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
102 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
103 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
104 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
105 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
106 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
107 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
108 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
109 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
110 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
111 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
112 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
113 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
114 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
115 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
116 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
117 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
118 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
119 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
120 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
121 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
122 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
123 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
124 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
125 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
126 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
127 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
128 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
129 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
130 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
131 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
132 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
133 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
134 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
135 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
136 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
137 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
138 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
139 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
140 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
141 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
142 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
143 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
144 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
145 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
146 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
147 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
148 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
149 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
150 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
151 3004167301 Mesorhizobium loti 582 Isolate Unclassified
152 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
153 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
154 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
155 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
156 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
157 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
158 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
159 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
160 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
161 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
162 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
163 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
164 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
165 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
166 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
167 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
168 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
169 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
170 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
171 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
172 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
173 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
174 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
175 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
176 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
177 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
178 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
183 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
184 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
185 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
186 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
187 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
188 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
189 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
190 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
191 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
192 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
193 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
194 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
195 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
196 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
197 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
198 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
199 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
200 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
201 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
202 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
203 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
204 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
205 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
206 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
207 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
208 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
209 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
210 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
211 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
212 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
213 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
214 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
215 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
216 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
217 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
218 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
219 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
220 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
221 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
222 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
223 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
224 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
225 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
226 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
227 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
228 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
229 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
230 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
231 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
232 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
233 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
234 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
235 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
236 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
237 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
238 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
239 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
240 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
241 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
242 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
243 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
245 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
246 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
296 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
297 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
298 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
299 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
300 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
301 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
302 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
303 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
304 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
305 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
306 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
307 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
308 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
309 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
310 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
311 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
312 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
313 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
314 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
315 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
316 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
317 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
318 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
319 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
320 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
321 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
327 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
329 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
336 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
337 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
346 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
381 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
382 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
386 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
387 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
388 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
389 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
390 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
393 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
394 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
395 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
396 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
397 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
398 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
399 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
400 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
401 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
402 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
403 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.07
Metatranscriptomes 0.19
Isolates 31.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 26.2
Rhizoplane 1.91
Rhizosphere 60.23
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000320 3300001915 Bacteria 14354
2 JGI24740J21852_10006522 3300001979 Bacteria 4822
3 JGI24740J21852_10011038 3300001979 Bacteria 3454
4 JGI24739J22299_10008028 3300001989 Unclassified 3946
5 JGI24737J22298_10005828 3300001990 Bacteria 4243
6 JGI24737J22298_10016764 3300001990 Bacteria 2364
7 JGI24735J21928_10003322 3300002067 Bacteria 5487
8 JGI24735J21928_10008208 3300002067 Bacteria 3386
9 JGI24744J21845_10000310 3300002077 Bacteria 8186
10 JGI25157J39369_1000368 3300002741 Bacteria 30978
11 JGI25165J46597_1000006 3300003214 Bacteria 529784
12 rootH1_10136782 3300003323 Bacteria 2847
13 Ga0055526_1000113 3300003771 Bacteria 71581
14 Ga0055526_1000189 3300003771 Bacteria 53387
15 Ga0055524_1000630 3300003775 Bacteria 25107
16 Ga0065715_10146266 3300005293 Bacteria 1773
17 Ga0070658_10026373 3300005327 Bacteria 4661
18 Ga0070658_10026524 3300005327 Bacteria 4648
19 Ga0070658_10033177 3300005327 Unclassified 4153
20 Ga0070676_10078399 3300005328 Bacteria 1998
21 Ga0070683_100017991 3300005329 Bacteria 6250
22 Ga0070683_100020324 3300005329 Bacteria 5909
23 Ga0070683_100022712 3300005329 Bacteria 5610
24 Ga0070680_100004400 3300005336 Bacteria 10603
25 Ga0070680_100148973 3300005336 Bacteria 1964
26 Ga0070682_100022989 3300005337 Bacteria 3699
27 Ga0070691_10002731 3300005341 Bacteria 7858
28 Ga0070687_100028291 3300005343 Bacteria 2717
29 Ga0070661_100035064 3300005344 Bacteria 3642
30 Ga0070661_100047836 3300005344 Bacteria 3130
31 Ga0070692_10004755 3300005345 Bacteria 5703
32 Ga0070668_100038811 3300005347 Bacteria 3642
33 Ga0070668_100070254 3300005347 Bacteria 2725
34 Ga0070675_100029345 3300005354 Bacteria 4435
35 Ga0070675_100069511 3300005354 Bacteria 2917
36 Ga0070671_100064814 3300005355 Bacteria 3043
37 Ga0070674_100003067 3300005356 Bacteria 9298
38 Ga0070674_100101438 3300005356 Bacteria 2098
39 Ga0070674_100109662 3300005356 Bacteria 2024
40 Ga0070659_100018390 3300005366 Bacteria 5274
41 Ga0070659_100147797 3300005366 Bacteria 1915
42 Ga0070709_10282855 3300005434 Bacteria 1206
43 Ga0070714_100014160 3300005435 Bacteria 6404
44 Ga0070713_100008452 3300005436 Bacteria 7301
45 Ga0070713_100044672 3300005436 Bacteria 3627
46 Ga0070711_100006916 3300005439 Bacteria 6877
47 Ga0070700_100257549 3300005441 Bacteria 1255
48 Ga0070708_100063709 3300005445 Bacteria 3301
49 Ga0070708_100112942 3300005445 Bacteria 2498
50 Ga0070663_100002557 3300005455 Bacteria 10272
51 Ga0070663_100045666 3300005455 Bacteria 3096
52 Ga0070678_100005197 3300005456 Bacteria 7487
53 Ga0070678_100009821 3300005456 Bacteria 5817
54 Ga0070678_100036058 3300005456 Bacteria 3458
55 Ga0070662_100033293 3300005457 Bacteria 3627
56 Ga0068867_100010633 3300005459 Bacteria 6492
57 Ga0068867_100021809 3300005459 Bacteria 4573
58 Ga0070706_100002200 3300005467 Bacteria 19848
59 Ga0070706_100012306 3300005467 Bacteria 7929
60 Ga0070698_100000016 3300005471 Bacteria 110961
61 Ga0070698_100150639 3300005471 Bacteria 2274
62 Ga0070679_100199240 3300005530 Bacteria 1969
63 Ga0070679_100224503 3300005530 Bacteria 1839
64 Ga0070684_100007464 3300005535 Bacteria 8503
65 Ga0070684_100050104 3300005535 Bacteria 3626
66 Ga0070697_100003509 3300005536 Bacteria 12047
67 Ga0068853_100006807 3300005539 Bacteria 9114
68 Ga0068853_100050190 3300005539 Bacteria 3589
69 Ga0068853_100090743 3300005539 Bacteria 2686
70 Ga0070672_100131391 3300005543 Bacteria 2058
71 Ga0070672_100240507 3300005543 Bacteria 1522
72 Ga0070672_100387928 3300005543 Bacteria 1196
73 Ga0070665_100131593 3300005548 Bacteria 2504
74 Ga0070665_100297380 3300005548 Bacteria 1617
75 Ga0070665_100558018 3300005548 Bacteria 1157
76 Ga0068855_100111933 3300005563 Bacteria 3133
77 Ga0068855_100281472 3300005563 Bacteria 1847
78 Ga0070664_100009414 3300005564 Bacteria 7921
79 Ga0070664_100013597 3300005564 Bacteria 6631
80 Ga0070664_100015774 3300005564 Bacteria 6183
81 Ga0068857_100008187 3300005577 Bacteria 9033
82 Ga0068854_100003391 3300005578 Bacteria 9927
83 Ga0068854_100031845 3300005578 Bacteria 3666
84 Ga0068854_100053476 3300005578 Bacteria 2900
85 Ga0068856_100018038 3300005614 Bacteria 6844
86 Ga0068856_100026868 3300005614 Bacteria 5613
87 Ga0068856_100032198 3300005614 Bacteria 5133
88 Ga0068856_100202448 3300005614 Bacteria 2000
89 Ga0068856_100274135 3300005614 Bacteria 1703
90 Ga0068852_100034797 3300005616 Bacteria 4195
91 Ga0068852_100070841 3300005616 Bacteria 3059
92 Ga0068864_100125267 3300005618 Bacteria 2301
93 Ga0068864_100185552 3300005618 Bacteria 1904
94 Ga0068862_100075569 3300005844 Bacteria 2914
95 Ga0081455_10006643 3300005937 Bacteria 12367
96 Ga0070717_10019493 3300006028 Bacteria 5319
97 Ga0075365_10001409 3300006038 Bacteria 10858
98 Ga0075363_100042064 3300006048 Bacteria 2412
99 Ga0075364_10057027 3300006051 Bacteria 2558
100 Ga0070716_100030931 3300006173 Bacteria 2909
101 Ga0070716_100214240 3300006173 Bacteria 1289
102 Ga0070712_100132280 3300006175 Bacteria 1892
103 Ga0075367_10018485 3300006178 Bacteria 3847
104 Ga0075433_10002453 3300006852 Bacteria 14107
105 Ga0075434_100001214 3300006871 Bacteria 21400
106 Ga0075435_100004449 3300007076 Bacteria 9631
107 Ga0075435_100100671 3300007076 Bacteria 2394
108 Ga0105240_10032039 3300009093 Bacteria 6807
109 Ga0111539_10232358 3300009094 Bacteria 2147
110 Ga0105245_10154361 3300009098 Bacteria 2173
111 Ga0114129_10005205 3300009147 Bacteria 18325
112 Ga0105241_10360341 3300009174 Bacteria 1265
113 Ga0105248_10001194 3300009177 Bacteria 29026
114 Ga0105248_10020072 3300009177 Bacteria 7402
115 Ga0105237_10059551 3300009545 Bacteria 3820
116 Ga0105237_10343998 3300009545 Bacteria 1496
117 Ga0105238_10002480 3300009551 Bacteria 18475
118 Ga0105238_10016863 3300009551 Bacteria 7408
119 Ga0105238_10315965 3300009551 Bacteria 1547
120 Ga0105239_10059103 3300010375 Bacteria 4208
121 Ga0105239_10324972 3300010375 Bacteria 1735
122 Ga0105239_10456609 3300010375 Bacteria 1450
123 Ga0157373_10012137 3300013100 Bacteria 6333
124 Ga0157373_10094583 3300013100 Bacteria 2104
125 Ga0157371_10014961 3300013102 Bacteria 5836
126 Ga0157371_10061031 3300013102 Bacteria 2673
127 Ga0157369_10134895 3300013105 Bacteria 2614
128 Ga0157369_10145795 3300013105 Bacteria 2503
129 Ga0157374_10029808 3300013296 Bacteria 4948
130 Ga0157378_10016193 3300013297 Bacteria 6531
131 Ga0157378_10054530 3300013297 Bacteria 3559
132 Ga0163162_10145457 3300013306 Bacteria 2486
133 Ga0157372_10251572 3300013307 Bacteria 2051
134 Ga0163163_10268199 3300014325 Bacteria 1758
135 Ga0157380_10098485 3300014326 Bacteria 2430
136 Ga0157377_10051383 3300014745 Bacteria 2325
137 Ga0206353_11210551 3300020082 Bacteria 1598
138 Ga0214544_1000029 3300021320 Bacteria 153924
139 Ga0214542_1000092 3300021321 Bacteria 117288
140 Ga0214543_1000045 3300021327 Bacteria 152699
141 Ga0209026_1000089 3300025250 Bacteria 175907
142 Ga0209148_1000738 3300025254 Bacteria 25396
143 Ga0209759_1000040 3300025256 Bacteria 254501
144 Ga0209233_1000010 3300025261 Bacteria 1194329
145 Ga0209455_1000638 3300025272 Bacteria 21512
146 Ga0209564_1000017 3300025295 Bacteria 594063
147 Ga0209256_1000089 3300025299 Bacteria 214426
148 Ga0207697_10006980 3300025315 Bacteria 5064
149 Ga0207682_10007417 3300025893 Bacteria 4369
150 Ga0207688_10066302 3300025901 Bacteria 2041
151 Ga0207647_10004002 3300025904 Bacteria 10991
152 Ga0207647_10008715 3300025904 Bacteria 7246
153 Ga0207647_10114139 3300025904 Bacteria 1596
154 Ga0207699_10009626 3300025906 Bacteria 4821
155 Ga0207643_10044734 3300025908 Bacteria 2500
156 Ga0207705_10004960 3300025909 Bacteria 9993
157 Ga0207684_10002191 3300025910 Bacteria 19974
158 Ga0207684_10071088 3300025910 Bacteria 2957
159 Ga0207707_10004841 3300025912 Bacteria 11810
160 Ga0207695_10005231 3300025913 Bacteria 17342
161 Ga0207671_10027555 3300025914 Bacteria 4248
162 Ga0207671_10049202 3300025914 Bacteria 3120
163 Ga0207663_10103178 3300025916 Bacteria 1920
164 Ga0207660_10004828 3300025917 Bacteria 8774
165 Ga0207657_10004234 3300025919 Bacteria 15204
166 Ga0207657_10020620 3300025919 Bacteria 6223
167 Ga0207649_10002339 3300025920 Bacteria 10625
168 Ga0207649_10010209 3300025920 Bacteria 5155
169 Ga0207652_10277675 3300025921 Bacteria 1511
170 Ga0207646_10014653 3300025922 Bacteria 7427
171 Ga0207681_10215022 3300025923 Bacteria 1484
172 Ga0207694_10021922 3300025924 Bacteria 4843
173 Ga0207700_10059882 3300025928 Bacteria 2881
174 Ga0207700_10160897 3300025928 Bacteria 1864
175 Ga0207700_10532531 3300025928 Bacteria 1041
176 Ga0207664_10070122 3300025929 Bacteria 2820
177 Ga0207644_10000548 3300025931 Bacteria 24411
178 Ga0207690_10109734 3300025932 Bacteria 1985
179 Ga0207706_10001668 3300025933 Bacteria 21954
180 Ga0207706_10080112 3300025933 Bacteria 2872
181 Ga0207669_10049928 3300025937 Bacteria 2497
182 Ga0207669_10060594 3300025937 Bacteria 2321
183 Ga0207669_10146624 3300025937 Bacteria 1647
184 Ga0207704_10046708 3300025938 Bacteria 2583
185 Ga0207704_10123067 3300025938 Bacteria 1780
186 Ga0207665_10011677 3300025939 Bacteria 5772
187 Ga0207665_10117369 3300025939 Bacteria 1876
188 Ga0207691_10021446 3300025940 Bacteria 6099
189 Ga0207711_10021479 3300025941 Bacteria 5393
190 Ga0207711_10179664 3300025941 Bacteria 1924
191 Ga0207661_10014566 3300025944 Bacteria 5768
192 Ga0207679_10006438 3300025945 Bacteria 7420
193 Ga0207679_10208254 3300025945 Bacteria 1638
194 Ga0207667_10014964 3300025949 Bacteria 8824
195 Ga0207651_10055165 3300025960 Bacteria 2727
196 Ga0207668_10221458 3300025972 Bacteria 1520
197 Ga0207640_10023335 3300025981 Bacteria 3716
198 Ga0207677_10096486 3300026023 Bacteria 2163
199 Ga0207639_10002939 3300026041 Bacteria 11454
200 Ga0207678_10002277 3300026067 Bacteria 17374
201 Ga0207678_10124888 3300026067 Bacteria 2196
202 Ga0207708_10090495 3300026075 Bacteria 2359
203 Ga0207702_10004166 3300026078 Bacteria 12952
204 Ga0207702_10148038 3300026078 Bacteria 2133
205 Ga0207702_10160253 3300026078 Bacteria 2054
206 Ga0207702_10178994 3300026078 Bacteria 1951
207 Ga0207702_10181559 3300026078 Bacteria 1938
208 Ga0207702_10480755 3300026078 Bacteria 1209
209 Ga0207648_10004785 3300026089 Bacteria 13827
210 Ga0207648_10057515 3300026089 Bacteria 3393
211 Ga0207648_10276737 3300026089 Bacteria 1500
212 Ga0207676_10056327 3300026095 Bacteria 3090
213 Ga0207674_10010013 3300026116 Bacteria 10788
214 Ga0207674_10024513 3300026116 Bacteria 6445
215 Ga0207674_10086038 3300026116 Bacteria 3138
216 Ga0207683_10017813 3300026121 Bacteria 6058
217 Ga0207683_10026890 3300026121 Bacteria 4971
218 Ga0207698_10002323 3300026142 Bacteria 11262
219 Ga0207698_10187509 3300026142 Bacteria 1838
220 Ga0268266_10100215 3300028379 Bacteria 2551
221 Ga0268266_10162151 3300028379 Bacteria 2024
222 Ga0307511_10001052 3300030521 Bacteria 29394
223 Ga0265332_10051868 3300031238 Bacteria 1761
224 Ga0265328_10010998 3300031239 Bacteria 3627
225 Ga0265339_10028172 3300031249 Bacteria 3197
226 Ga0265331_10073399 3300031250 Bacteria 1597
227 Ga0265316_10039325 3300031344 Bacteria 3799
228 Ga0307513_10206985 3300031456 Bacteria 1797
229 Ga0316575_10047370 3300031665 Bacteria 1708
230 Ga0316579_10001843 3300031691 Bacteria 7838
231 Ga0265342_10033437 3300031712 Bacteria 3162
232 Ga0316576_10029361 3300031727 Bacteria 3886
233 Ga0316578_10021357 3300031728 Bacteria 3591
234 Ga0316577_10009894 3300031733 Bacteria 5143
235 Ga0316577_10079278 3300031733 Bacteria 1835
236 Ga0307414_10267489 3300032004 Bacteria 1430
237 Ga0316583_10002501 3300032133 Bacteria 6391
238 Ga0316585_10017024 3300032137 Bacteria 2194
239 Ga0316580_10002035 3300032139 Bacteria 5482
240 Ga0373934_0004494 3300035086 Bacteria 5152
241 Ga0373953_0001644 3300035117 Bacteria 6560
242 Ga0373954_0000313 3300035118 Bacteria 17689
243 Ga0373956_0049320 3300035119 Bacteria 1888
244 Ga0373957_0001531 3300035120 Bacteria 6287
245 Ga0373955_0000495 3300035172 Bacteria 16716
246 Ga0316574_0087246 3300035398 Bacteria 1986
247 Ga0373937_0001044 3300036401 Bacteria 23401
248 Ga0373937_0049624 3300036401 Bacteria 3843
249 Ga0316582_0004006 3300036647 Bacteria 7361
250 Ga0316582_0335636 3300036647 Bacteria 1039
251 Ga0316584_0081555 3300036712 Bacteria 2423
252 Ga0316584_0111148 3300036712 Bacteria 2050
253 Ga0395899_0009434 3300037312 Bacteria 7494
254 Ga0395899_0037434 3300037312 Bacteria 3636
255 Ga0395899_0136997 3300037312 Bacteria 1745
256 Ga0395899_0180672 3300037312 Bacteria 1481
257 Ga0395900_0001861 3300037418 Bacteria 24035
258 Ga0395900_0025630 3300037418 Bacteria 6035
259 Ga0395900_0027782 3300037418 Bacteria 5797
260 Ga0395900_0054936 3300037418 Bacteria 4100
261 Ga0395900_0065929 3300037418 Bacteria 3720
262 Ga0395898_0011471 3300037466 Bacteria 9202
263 Ga0395898_0197112 3300037466 Bacteria 1923
264 Ga0395905_0025930 3300037471 Bacteria 5525
265 Ga0395905_0045007 3300037471 Bacteria 4140
266 Ga0395905_0063571 3300037471 Bacteria 3453
267 Ga0395905_0144871 3300037471 Archaea 2235
268 Ga0316581_0013577 3300037588 Bacteria 2311
269 Ga0436364_0756344 3300037853 Bacteria 5243
270 Ga0436364_1240449 3300037853 Bacteria 4124
271 Ga0395901_0008476 3300038443 Bacteria 10390
272 Ga0395901_0040412 3300038443 Bacteria 4831
273 Ga0395901_0043658 3300038443 Bacteria 4649
274 Ga0395901_0074012 3300038443 Bacteria 3553
275 Ga0395901_0099929 3300038443 Bacteria 3043
276 Ga0439435_0002165 3300042436 Bacteria 3834
277 Ga0466972_0029331 3300044658 Bacteria 2708
278 Ga0466957_0026703 3300044842 Bacteria 3427
279 Ga0466957_0209375 3300044842 Bacteria 1283
280 Ga0466967_0004316 3300045976 Bacteria 9559
281 Ga0466967_0073043 3300045976 Bacteria 3076
282 Ga0495592_0004486 3300046454 Bacteria 10215
283 Ga0495629_0005200 3300046459 Bacteria 9744
284 Ga0495638_0000416 3300046460 Bacteria 51791
285 Ga0495638_0031765 3300046460 Bacteria 3390
286 Ga0495651_0001257 3300046462 Bacteria 19640
287 Ga0495651_0028903 3300046462 Bacteria 4323
288 Ga0495653_0000881 3300046463 Bacteria 23166
289 Ga0495608_0000687 3300046511 Bacteria 23407
290 Ga0495628_0013293 3300046516 Bacteria 6925
291 Ga0495652_0004854 3300046529 Bacteria 12771
292 Ga0495654_0098841 3300046530 Bacteria 1346
293 Ga0495640_0021536 3300046533 Bacteria 4729
294 Ga0495586_0105612 3300046535 Bacteria 1566
295 Ga0495587_0000799 3300046536 Bacteria 20999
296 Ga0495667_0001241 3300046559 Bacteria 16709
297 Ga0495625_0127577 3300046660 Bacteria 1726
298 Ga0495635_0019926 3300046663 Bacteria 4673
299 Ga0495657_0009057 3300046675 Bacteria 7567
300 Ga0495599_0000559 3300046678 Bacteria 21250
301 Ga0495599_0045149 3300046678 Bacteria 2763
302 Ga0495623_0008450 3300046679 Bacteria 6686
303 Ga0495646_0015958 3300046680 Bacteria 4767
304 Ga0495647_0169814 3300046681 Bacteria 944
305 Ga0495600_0000253 3300046809 Bacteria 29204
306 Ga0495604_0001029 3300047317 Bacteria 23248
307 Ga0495674_0239581 3300047319 Bacteria 1495
308 Ga0495680_0001875 3300047322 Bacteria 22125
309 Ga0495675_0000610 3300047444 Bacteria 23039
310 Ga0495675_0054153 3300047444 Bacteria 2547
311 Ga0495684_0001161 3300047471 Bacteria 21170
312 Ga0495593_0030293 3300047673 Bacteria 2962
313 Ga0495602_0009531 3300048088 Bacteria 10091
314 Ga0496102_0073856 3300048905 Bacteria 3134
315 Ga0496102_0168462 3300048905 Bacteria 2062
316 Ga0496102_0266316 3300048905 Bacteria 1616
317 Ga0496106_0272156 3300048909 Bacteria 1356
318 Ga0496107_0105794 3300048910 Bacteria 2066
319 Ga0496109_0381607 3300048912 Bacteria 1331
320 Ga0496110_0292149 3300048913 Bacteria 1485
321 Ga0496114_0302093 3300048917 Bacteria 1413
322 Ga0496118_0172402 3300048921 Bacteria 1320
323 Ga0496120_0001080 3300048923 Bacteria 35851
324 Ga0496120_0008180 3300048923 Bacteria 7666
325 Ga0496125_0120415 3300048928 Bacteria 1874
326 Ga0496125_0181265 3300048928 Bacteria 1403
327 Ga0501032_0104787 3300049569 Bacteria 1874
328 Ga0501033_0031107 3300049570 Bacteria 4013
329 Ga0501034_0001717 3300049571 Bacteria 28196
330 Ga0501038_0070289 3300049574 Bacteria 2973
331 Ga0501068_0019866 3300049584 Bacteria 3907
332 Ga0501072_0181302 3300049588 Bacteria 1680
333 Ga0501073_0085434 3300049589 Bacteria 2195
334 Ga0501080_0085581 3300049742 Bacteria 2929
335 Ga0501080_0148310 3300049742 Bacteria 2169
336 Ga0501083_0031874 3300049744 Bacteria 3616
337 Ga0501044_0207480 3300049823 Bacteria 1915
338 Ga0501044_0272388 3300049823 Bacteria 1628
339 nmdc:mga0yw44_48230_c1 3300050492 Bacteria 2568
340 nmdc:mga0yw44_87865_c1 3300050492 Bacteria 1960
341 nmdc:mga06z11_54661_c1 3300050494 Bacteria 2059
342 nmdc:mga04h51_26638_c1 3300050495 Bacteria 1789
343 nmdc:mga07m45_117713_c1 3300050496 Bacteria 1533
344 nmdc:mga05p37_10892_c1 3300050507 Bacteria 10798
345 nmdc:mga08y16_107112_c1 3300050511 Bacteria 2909
346 nmdc:mga0n895_3048_c1 3300050512 Bacteria 13334
347 nmdc:mga0rr50_12834_c1 3300050513 Bacteria 5430
348 nmdc:mga0rr50_88135_c1 3300050513 Bacteria 2410
349 nmdc:mga0a205_7791_c1 3300050515 Bacteria 9724
350 nmdc:mga0sz30_58864_c1 3300050516 Bacteria 1638
351 Ga0495601_0176451 3300053077 Bacteria 1397
352 Ga0495601_0242604 3300053077 Bacteria 1176
353 Ga0495619_0000685 3300053085 Bacteria 22151
354 Ga0500620_000143 3300053155 Bacteria 14481
355 Ga0500627_0012724 3300053158 Bacteria 3164
356 Ga0500627_0104745 3300053158 Bacteria 1271
357 Ga0500637_0043632 3300053178 Bacteria 2539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046681 Ga0495647_0169814 Ga0495647_0169814_60_923 287
2 3300009551 Ga0105238_10315965 Ga0105238_103159651 310
3 3300005434 Ga0070709_10282855 Ga0070709_102828551 313
4 3300005435 Ga0070714_100014160 Ga0070714_1000141602 313
5 3300005436 Ga0070713_100008452 Ga0070713_1000084522 313
6 3300005614 Ga0068856_100032198 Ga0068856_1000321986 313
7 3300006028 Ga0070717_10019493 Ga0070717_100194938 313
8 3300006173 Ga0070716_100030931 Ga0070716_1000309312 313
9 3300006175 Ga0070712_100132280 Ga0070712_1001322801 313
10 3300007076 Ga0075435_100100671 Ga0075435_1001006712 313
11 3300009093 Ga0105240_10032039 Ga0105240_100320393 313
12 3300010375 Ga0105239_10324972 Ga0105239_103249721 313
13 3300025901 Ga0207688_10066302 Ga0207688_100663022 313
14 3300025928 Ga0207700_10059882 Ga0207700_100598824 313
15 3300025928 Ga0207700_10532531 Ga0207700_105325311 313
16 3300025929 Ga0207664_10070122 Ga0207664_100701222 313
17 3300025939 Ga0207665_10011677 Ga0207665_100116774 313
18 3300026078 Ga0207702_10178994 Ga0207702_101789942 313
19 3300030521 Ga0307511_10001052 Ga0307511_1000105225 313
20 3300044842 Ga0466957_0209375 Ga0466957_0209375_164_1105 313
21 3300048905 Ga0496102_0266316 Ga0496102_0266316_254_1195 313
22 3300048909 Ga0496106_0272156 Ga0496106_0272156_16_957 313
23 3300048910 Ga0496107_0105794 Ga0496107_0105794_181_1122 313
24 3300050513 nmdc:mga0rr50_88135_c1 nmdc:mga0rr50_88135_c1_1249_2190 313
25 3300053178 Ga0500637_0043632 Ga0500637_0043632_397_1338 313
26 3300025939 Ga0207665_10117369 Ga0207665_101173692 314
27 3300005328 Ga0070676_10078399 Ga0070676_100783993 315
28 3300005347 Ga0070668_100070254 Ga0070668_1000702542 315
29 3300005354 Ga0070675_100029345 Ga0070675_1000293452 315
30 3300005356 Ga0070674_100109662 Ga0070674_1001096622 315
31 3300005441 Ga0070700_100257549 Ga0070700_1002575492 315
32 3300005456 Ga0070678_100036058 Ga0070678_1000360582 315
33 3300005459 Ga0068867_100010633 Ga0068867_1000106333 315
34 3300005543 Ga0070672_100240507 Ga0070672_1002405072 315
35 3300005618 Ga0068864_100125267 Ga0068864_1001252672 315
36 3300005844 Ga0068862_100075569 Ga0068862_1000755693 315
37 3300006852 Ga0075433_10002453 Ga0075433_100024537 315
38 3300006871 Ga0075434_100001214 Ga0075434_10000121410 315
39 3300007076 Ga0075435_100004449 Ga0075435_1000044492 315
40 3300009147 Ga0114129_10005205 Ga0114129_1000520515 315
41 3300013306 Ga0163162_10145457 Ga0163162_101454573 315
42 3300014325 Ga0163163_10268199 Ga0163163_102681992 315
43 3300025908 Ga0207643_10044734 Ga0207643_100447342 315
44 3300025933 Ga0207706_10080112 Ga0207706_100801123 315
45 3300025938 Ga0207704_10046708 Ga0207704_100467081 315
46 3300026067 Ga0207678_10124888 Ga0207678_101248882 315
47 3300026075 Ga0207708_10090495 Ga0207708_100904952 315
48 3300026089 Ga0207648_10057515 Ga0207648_100575152 315
49 3300026095 Ga0207676_10056327 Ga0207676_100563272 315
50 3300026121 Ga0207683_10017813 Ga0207683_100178133 315
51 3300031238 Ga0265332_10051868 Ga0265332_100518682 315
52 3300031239 Ga0265328_10010998 Ga0265328_100109983 315
53 3300031249 Ga0265339_10028172 Ga0265339_100281723 315
54 3300031250 Ga0265331_10073399 Ga0265331_100733992 315
55 3300031344 Ga0265316_10039325 Ga0265316_100393252 315
56 3300031712 Ga0265342_10033437 Ga0265342_100334373 315
57 3300036401 Ga0373937_0049624 Ga0373937_0049624_1787_2734 315
58 3300050507 nmdc:mga05p37_10892_c1 nmdc:mga05p37_10892_c1_5860_6807 315
59 3300050511 nmdc:mga08y16_107112_c1 nmdc:mga08y16_107112_c1_851_1798 315
60 3300050512 nmdc:mga0n895_3048_c1 nmdc:mga0n895_3048_c1_11534_12481 315
61 3300050513 nmdc:mga0rr50_12834_c1 nmdc:mga0rr50_12834_c1_2917_3864 315
62 3300050515 nmdc:mga0a205_7791_c1 nmdc:mga0a205_7791_c1_4325_5272 315
63 3300005467 Ga0070706_100002200 Ga0070706_10000220016 316
64 3300005467 Ga0070706_100012306 Ga0070706_1000123062 316
65 3300005471 Ga0070698_100000016 Ga0070698_10000001613 316
66 3300005536 Ga0070697_100003509 Ga0070697_1000035093 316
67 3300005937 Ga0081455_10006643 Ga0081455_100066433 316
68 3300025910 Ga0207684_10002191 Ga0207684_1000219117 316
69 3300005445 Ga0070708_100063709 Ga0070708_1000637092 318
70 3300005445 Ga0070708_100112942 Ga0070708_1001129421 318
71 3300005471 Ga0070698_100150639 Ga0070698_1001506392 318
72 3300025910 Ga0207684_10071088 Ga0207684_100710882 318
73 3300025922 Ga0207646_10014653 Ga0207646_100146533 318
74 3300036647 Ga0316582_0335636 Ga0316582_0335636_43_1002 319
75 3300037588 Ga0316581_0013577 Ga0316581_0013577_23_982 319
76 iso_pu_bacteria 8004395343 8004399711 319
77 3300009177 Ga0105248_10001194 Ga0105248_100011945 322
78 3300013297 Ga0157378_10054530 Ga0157378_100545303 322
79 3300035398 Ga0316574_0087246 Ga0316574_0087246_29_997 322
80 3300048912 Ga0496109_0381607 Ga0496109_0381607_102_1070 322
81 iso_pu_bacteria 2906354277 2906355298 326
82 3300009098 Ga0105245_10154361 Ga0105245_101543614 333
83 3300035086 Ga0373934_0004494 Ga0373934_0004494_2395_3399 334
84 3300035117 Ga0373953_0001644 Ga0373953_0001644_2793_3797 334
85 3300035118 Ga0373954_0000313 Ga0373954_0000313_3011_4015 334
86 3300035119 Ga0373956_0049320 Ga0373956_0049320_313_1317 334
87 3300035120 Ga0373957_0001531 Ga0373957_0001531_4101_5105 334
88 3300035172 Ga0373955_0000495 Ga0373955_0000495_1745_2749 334
89 3300036401 Ga0373937_0001044 Ga0373937_0001044_3309_4313 334
90 3300046454 Ga0495592_0004486 Ga0495592_0004486_3770_4774 334
91 3300046459 Ga0495629_0005200 Ga0495629_0005200_7579_8583 334
92 3300046462 Ga0495651_0001257 Ga0495651_0001257_3076_4080 334
93 3300046463 Ga0495653_0000881 Ga0495653_0000881_3026_4030 334
94 3300046511 Ga0495608_0000687 Ga0495608_0000687_19338_20342 334
95 3300046516 Ga0495628_0013293 Ga0495628_0013293_2723_3727 334
96 3300046529 Ga0495652_0004854 Ga0495652_0004854_8736_9740 334
97 3300046533 Ga0495640_0021536 Ga0495640_0021536_90_1094 334
98 3300046536 Ga0495587_0000799 Ga0495587_0000799_96_1100 334
99 3300046559 Ga0495667_0001241 Ga0495667_0001241_15561_16565 334
100 3300046663 Ga0495635_0019926 Ga0495635_0019926_3048_4052 334
101 3300046675 Ga0495657_0009057 Ga0495657_0009057_780_1784 334
102 3300046678 Ga0495599_0000559 Ga0495599_0000559_3237_4241 334
103 3300046679 Ga0495623_0008450 Ga0495623_0008450_1130_2134 334
104 3300046680 Ga0495646_0015958 Ga0495646_0015958_582_1586 334
105 3300046809 Ga0495600_0000253 Ga0495600_0000253_25125_26129 334
106 3300047317 Ga0495604_0001029 Ga0495604_0001029_3181_4185 334
107 3300047319 Ga0495674_0239581 Ga0495674_0239581_64_1068 334
108 3300047322 Ga0495680_0001875 Ga0495680_0001875_7949_8953 334
109 3300047444 Ga0495675_0000610 Ga0495675_0000610_2955_3959 334
110 3300047471 Ga0495684_0001161 Ga0495684_0001161_3066_4070 334
111 3300047673 Ga0495593_0030293 Ga0495593_0030293_117_1121 334
112 3300048088 Ga0495602_0009531 Ga0495602_0009531_224_1228 334
113 3300053077 Ga0495601_0176451 Ga0495601_0176451_372_1376 334
114 3300053085 Ga0495619_0000685 Ga0495619_0000685_7965_8969 334
115 3300037471 Ga0395905_0144871 Ga0395905_0144871_155_1195 346
116 3300025938 Ga0207704_10123067 Ga0207704_101230671 352
117 3300003775 Ga0055524_1000630 Ga0055524_10006303 355
118 3300025299 Ga0209256_1000089 Ga0209256_1000089170 355
119 3300031691 Ga0316579_10001843 Ga0316579_100018433 356
120 3300032133 Ga0316583_10002501 Ga0316583_100025015 356
121 3300025906 Ga0207699_10009626 Ga0207699_100096261 357
122 3300045976 Ga0466967_0073043 Ga0466967_0073043_786_1865 357
123 iso_pu_bacteria 2509276022 2509393671 357
124 iso_pu_bacteria 2513237090 2513608486 357
125 iso_pu_bacteria 2599185301 2599936251 357
126 iso_pu_bacteria 2693429783 2694628519 357
127 iso_pu_bacteria 2693429784 2694637568 357
128 iso_pu_bacteria 2721755686 2723574667 357
129 iso_pu_bacteria 2847670302 2847675175 357
130 iso_pu_bacteria 2847686936 2847691351 357
131 iso_pu_bacteria 2856314179 2856315015 357
132 iso_pu_bacteria 2856356410 2856363526 357
133 iso_pu_bacteria 2856364286 2856368233 357
134 iso_pu_bacteria 2857349434 2857351576 357
135 iso_pu_bacteria 2869162929 2869166766 357
136 iso_pu_bacteria 2869285874 2869290148 357
137 iso_pu_bacteria 2871429161 2871432432 357
138 iso_pu_bacteria 2871488783 2871493054 357
139 iso_pu_bacteria 2871495908 2871502488 357
140 iso_pu_bacteria 2874123672 2874126971 357
141 iso_pu_bacteria 2874139085 2874142866 357
142 iso_pu_bacteria 2874146452 2874152397 357
143 iso_pu_bacteria 2874155637 2874159799 357
144 iso_pu_bacteria 2876392853 2876393902 357
145 iso_pu_bacteria 2876413966 2876418315 357
146 iso_pu_bacteria 2878035449 2878042258 357
147 iso_pu_bacteria 2878745973 2878750045 357
148 iso_pu_bacteria 2878753008 2878757100 357
149 iso_pu_bacteria 2878760144 2878766380 357
150 iso_pu_bacteria 2878767105 2878773576 357
151 iso_pu_bacteria 2881147464 2881150174 357
152 iso_pu_bacteria 2881155292 2881161284 357
153 iso_pu_bacteria 2881161766 2881167014 357
154 iso_pu_bacteria 2881845957 2881848811 357
155 iso_pu_bacteria 2881853255 2881858799 357
156 iso_pu_bacteria 2881861095 2881861205 357
157 iso_pu_bacteria 2882912400 2882919289 357
158 iso_pu_bacteria 2885305155 2885308526 357
159 iso_pu_bacteria 2885318864 2885322166 357
160 iso_pu_bacteria 2885326080 2885331284 357
161 iso_pu_bacteria 2885334103 2885339396 357
162 iso_pu_bacteria 2888350351 2888355331 357
163 iso_pu_bacteria 2889010040 2889010310 357
164 iso_pu_bacteria 2889016732 2889018025 357
165 iso_pu_bacteria 2903492973 2903500826 357
166 iso_pu_bacteria 2903492973 2903505106 357
167 iso_pu_bacteria 2903540706 2903547529 357
168 iso_pu_bacteria 2904659560 2904660233 357
169 iso_pu_bacteria 2906308376 2906312404 357
170 iso_pu_bacteria 2906321335 2906325113 357
171 iso_pu_bacteria 2906328253 2906330462 357
172 iso_pu_bacteria 2906414383 2906419659 357
173 iso_pu_bacteria 2909042592 2909046055 357
174 iso_pu_bacteria 2919450847 2919451122 357
175 iso_pu_bacteria 2922130491 2922135765 357
176 iso_pu_bacteria 2922158528 2922163966 357
177 iso_pu_bacteria 2922185730 2922185997 357
178 iso_pu_bacteria 2924718760 2924722214 357
179 iso_pu_bacteria 2924726620 2924729003 357
180 iso_pu_bacteria 2924762789 2924766233 357
181 iso_pu_bacteria 2924784321 2924786403 357
182 iso_pu_bacteria 2937813078 2937819453 357
183 iso_pu_bacteria 2937822353 2937825203 357
184 iso_pu_bacteria 2937891427 2937897646 357
185 iso_pu_bacteria 2937994558 2938001404 357
186 iso_pu_bacteria 2958041894 2958057906 357
187 iso_pu_bacteria 2958100919 2958105914 357
188 iso_pu_bacteria 2958115193 2958116495 357
189 iso_pu_bacteria 2958130278 2958134535 357
190 iso_pu_bacteria 2958165035 2958171558 357
191 iso_pu_bacteria 2958172287 2958173946 357
192 iso_pu_bacteria 2958179912 2958181016 357
193 iso_pu_bacteria 2961077736 2961078853 357
194 iso_pu_bacteria 2961114664 2961115557 357
195 iso_pu_bacteria 2961163497 2961169999 357
196 iso_pu_bacteria 2961170736 2961175572 357
197 iso_pu_bacteria 2965018300 2965024750 357
198 iso_pu_bacteria 2965062239 2965063486 357
199 iso_pu_bacteria 2967996073 2967999372 357
200 iso_pu_bacteria 2968003550 2968007784 357
201 iso_pu_bacteria 2968091066 2968094992 357
202 iso_pu_bacteria 2968097103 2968102548 357
203 iso_pu_bacteria 2968110612 2968111290 357
204 iso_pu_bacteria 2968117919 2968119560 357
205 iso_pu_bacteria 2968128360 2968130551 357
206 iso_pu_bacteria 2968171901 2968178391 357
207 iso_pu_bacteria 2970503327 2970508160 357
208 iso_pu_bacteria 2970554993 2970561236 357
209 iso_pu_bacteria 2977821940 2977826259 357
210 iso_pu_bacteria 2977843712 2977848192 357
211 iso_pu_bacteria 2977864932 2977869012 357
212 iso_pu_bacteria 2977942078 2977944561 357
213 iso_pu_bacteria 2977971508 2977973331 357
214 iso_pu_bacteria 2979710463 2979717479 357
215 iso_pu_bacteria 2979742915 2979748059 357
216 iso_pu_bacteria 2979779861 2979784201 357
217 iso_pu_bacteria 2979808191 2979813344 357
218 iso_pu_bacteria 2987636660 2987638760 357
219 iso_pu_bacteria 2987652177 2987658823 357
220 iso_pu_bacteria 2987659509 2987666240 357
221 iso_pu_bacteria 2987666974 2987670842 357
222 iso_pu_bacteria 2996341866 2996343764 357
223 iso_pu_bacteria 3004167301 3004173367 357
224 iso_pu_bacteria 3004188549 3004195246 357
225 iso_pu_bacteria 3004203850 3004204997 357
226 iso_pu_bacteria 8004374579 8004378675 357
227 iso_pu_bacteria 8004387939 8004392353 357
228 iso_pu_bacteria 8004640170 8004641200 357
229 iso_pu_bacteria 8004703790 8004705428 357
230 iso_pu_bacteria 8004714634 8004718663 357
231 3300009094 Ga0111539_10232358 Ga0111539_102323582 358
232 3300044842 Ga0466957_0026703 Ga0466957_0026703_934_2010 358
233 3300045976 Ga0466967_0004316 Ga0466967_0004316_23_1099 358
234 3300046535 Ga0495586_0105612 Ga0495586_0105612_27_1103 358
235 iso_pu_bacteria 2508501127 2509145282 358
236 iso_pu_bacteria 2512875016 2512933829 358
237 iso_pu_bacteria 2512875024 2512962011 358
238 iso_pu_bacteria 2513237164 2514038843 358
239 iso_pu_bacteria 2588253730 2588519923 358
240 iso_pu_bacteria 2597489875 2597810813 358
241 iso_pu_bacteria 2643221557 2643808879 358
242 iso_pu_bacteria 2643221595 2643985840 358
243 iso_pu_bacteria 2643221610 2644064316 358
244 iso_pu_bacteria 2643221627 2644157100 358
245 iso_pu_bacteria 2643221643 2644238179 358
246 iso_pu_bacteria 2643221668 2644376483 358
247 iso_pu_bacteria 2643221675 2644416147 358
248 iso_pu_bacteria 2643221680 2644449188 358
249 iso_pu_bacteria 2643221726 2644691987 358
250 iso_pu_bacteria 2765235802 2765469192 358
251 iso_pu_bacteria 2839993093 2839995986 358
252 iso_pu_bacteria 2841734538 2841736538 358
253 iso_pu_bacteria 2856320880 2856323843 358
254 iso_pu_bacteria 2856342000 2856348091 358
255 iso_pu_bacteria 2869278585 2869284814 358
256 iso_pu_bacteria 2871474448 2871481288 358
257 iso_pu_bacteria 2876363079 2876363915 358
258 iso_pu_bacteria 2878738818 2878741065 358
259 iso_pu_bacteria 2885312484 2885313974 358
260 iso_pu_bacteria 2888337043 2888343328 358
261 iso_pu_bacteria 2888343758 2888344518 358
262 iso_pu_bacteria 2903448605 2903454003 358
263 iso_pu_bacteria 2903521522 2903525926 358
264 iso_pu_bacteria 2903528002 2903532528 358
265 iso_pu_bacteria 2904578770 2904581277 358
266 iso_pu_bacteria 2919119836 2919122516 358
267 iso_pu_bacteria 2924754689 2924759031 358
268 iso_pu_bacteria 2924776078 2924778666 358
269 iso_pu_bacteria 2937836603 2937838886 358
270 iso_pu_bacteria 2937877337 2937878435 358
271 iso_pu_bacteria 2937972304 2937974335 358
272 iso_pu_bacteria 2958034702 2958041331 358
273 iso_pu_bacteria 2958041894 2958042305 358
274 iso_pu_bacteria 2958071322 2958072317 358
275 iso_pu_bacteria 2958084443 2958085708 358
276 iso_pu_bacteria 2958144490 2958146683 358
277 iso_pu_bacteria 2963644680 2963645373 358
278 iso_pu_bacteria 2968016561 2968019159 358
279 iso_pu_bacteria 2968083720 2968089729 358
280 iso_pu_bacteria 2970469710 2970472523 358
281 iso_pu_bacteria 2970524798 2970526238 358
282 iso_pu_bacteria 2970593180 2970599425 358
283 iso_pu_bacteria 2977986579 2977992132 358
284 iso_pu_bacteria 2996348954 2996349427 358
285 iso_pu_bacteria 3000135777 3000137437 358
286 iso_pu_bacteria 3004275668 3004276135 358
287 iso_pu_bacteria 3004334049 3004337214 358
288 iso_pu_bacteria 637000159 637076940 358
289 iso_pu_bacteria 8004633249 8004638951 358
290 iso_pu_bacteria 8055617313 8055618095 358
291 3300001990 JGI24737J22298_10016764 JGI24737J22298_100167643 359
292 3300002077 JGI24744J21845_10000310 JGI24744J21845_100003104 359
293 3300005293 Ga0065715_10146266 Ga0065715_101462661 359
294 3300005329 Ga0070683_100022712 Ga0070683_1000227124 359
295 3300005343 Ga0070687_100028291 Ga0070687_1000282911 359
296 3300005347 Ga0070668_100038811 Ga0070668_1000388113 359
297 3300005354 Ga0070675_100069511 Ga0070675_1000695112 359
298 3300005355 Ga0070671_100064814 Ga0070671_1000648143 359
299 3300005356 Ga0070674_100003067 Ga0070674_1000030675 359
300 3300005456 Ga0070678_100009821 Ga0070678_1000098216 359
301 3300005459 Ga0068867_100021809 Ga0068867_1000218095 359
302 3300005530 Ga0070679_100199240 Ga0070679_1001992403 359
303 3300005535 Ga0070684_100050104 Ga0070684_1000501042 359
304 3300005539 Ga0068853_100050190 Ga0068853_1000501902 359
305 3300005543 Ga0070672_100131391 Ga0070672_1001313912 359
306 3300005543 Ga0070672_100387928 Ga0070672_1003879281 359
307 3300005563 Ga0068855_100281472 Ga0068855_1002814721 359
308 3300005564 Ga0070664_100015774 Ga0070664_1000157742 359
309 3300005578 Ga0068854_100031845 Ga0068854_1000318455 359
310 3300005614 Ga0068856_100026868 Ga0068856_1000268682 359
311 3300005618 Ga0068864_100185552 Ga0068864_1001855523 359
312 3300010375 Ga0105239_10059103 Ga0105239_100591034 359
313 3300013102 Ga0157371_10061031 Ga0157371_100610312 359
314 3300013296 Ga0157374_10029808 Ga0157374_100298082 359
315 3300013297 Ga0157378_10016193 Ga0157378_100161935 359
316 3300013307 Ga0157372_10251572 Ga0157372_102515721 359
317 3300014326 Ga0157380_10098485 Ga0157380_100984852 359
318 3300014745 Ga0157377_10051383 Ga0157377_100513832 359
319 3300020082 Ga0206353_11210551 Ga0206353_112105511 359
320 3300025315 Ga0207697_10006980 Ga0207697_100069805 359
321 3300025893 Ga0207682_10007417 Ga0207682_100074172 359
322 3300025931 Ga0207644_10000548 Ga0207644_1000054818 359
323 3300025937 Ga0207669_10049928 Ga0207669_100499283 359
324 3300025940 Ga0207691_10021446 Ga0207691_100214465 359
325 3300025941 Ga0207711_10179664 Ga0207711_101796642 359
326 3300025944 Ga0207661_10014566 Ga0207661_100145664 359
327 3300025960 Ga0207651_10055165 Ga0207651_100551654 359
328 3300025972 Ga0207668_10221458 Ga0207668_102214582 359
329 3300025981 Ga0207640_10023335 Ga0207640_100233352 359
330 3300026023 Ga0207677_10096486 Ga0207677_100964862 359
331 3300026078 Ga0207702_10181559 Ga0207702_101815592 359
332 3300026089 Ga0207648_10004785 Ga0207648_1000478510 359
333 3300026121 Ga0207683_10026890 Ga0207683_100268902 359
334 3300026142 Ga0207698_10187509 Ga0207698_101875092 359
335 3300037312 Ga0395899_0037434 Ga0395899_0037434_871_1950 359
336 3300037418 Ga0395900_0001861 Ga0395900_0001861_17936_19015 359
337 3300037418 Ga0395900_0027782 Ga0395900_0027782_3106_4185 359
338 3300038443 Ga0395901_0008476 Ga0395901_0008476_6869_7948 359
339 3300048905 Ga0496102_0073856 Ga0496102_0073856_435_1514 359
340 3300049571 Ga0501034_0001717 Ga0501034_0001717_2354_3433 359
341 3300049588 Ga0501072_0181302 Ga0501072_0181302_165_1244 359
342 3300005327 Ga0070658_10033177 Ga0070658_100331774 360
343 3300005366 Ga0070659_100147797 Ga0070659_1001477972 360
344 3300005436 Ga0070713_100044672 Ga0070713_1000446723 360
345 3300005439 Ga0070711_100006916 Ga0070711_1000069166 360
346 3300006173 Ga0070716_100214240 Ga0070716_1002142402 360
347 3300009177 Ga0105248_10020072 Ga0105248_100200724 360
348 3300025916 Ga0207663_10103178 Ga0207663_101031782 360
349 3300025928 Ga0207700_10160897 Ga0207700_101608972 360
350 3300025932 Ga0207690_10109734 Ga0207690_101097342 360
351 3300025941 Ga0207711_10021479 Ga0207711_100214793 360
352 3300026116 Ga0207674_10086038 Ga0207674_100860382 360
353 3300031665 Ga0316575_10047370 Ga0316575_100473702 360
354 3300031727 Ga0316576_10029361 Ga0316576_100293613 360
355 3300031728 Ga0316578_10021357 Ga0316578_100213573 360
356 3300031733 Ga0316577_10009894 Ga0316577_100098942 360
357 3300032137 Ga0316585_10017024 Ga0316585_100170242 360
358 3300032139 Ga0316580_10002035 Ga0316580_100020353 360
359 3300036647 Ga0316582_0004006 Ga0316582_0004006_3986_5110 360
360 3300036712 Ga0316584_0081555 Ga0316584_0081555_47_1129 360
361 3300036712 Ga0316584_0111148 Ga0316584_0111148_463_1587 360
362 3300037312 Ga0395899_0136997 Ga0395899_0136997_276_1358 360
363 3300037418 Ga0395900_0065929 Ga0395900_0065929_1229_2311 360
364 3300037471 Ga0395905_0063571 Ga0395905_0063571_113_1195 360
365 3300037853 Ga0436364_1240449 Ga0436364_1240449_2634_3728 360
366 3300046462 Ga0495651_0028903 Ga0495651_0028903_93_1181 360
367 3300046678 Ga0495599_0045149 Ga0495599_0045149_1147_2235 360
368 3300047444 Ga0495675_0054153 Ga0495675_0054153_562_1650 360
369 3300048928 Ga0496125_0120415 Ga0496125_0120415_619_1701 360
370 3300049584 Ga0501068_0019866 Ga0501068_0019866_310_1392 360
371 3300053077 Ga0495601_0242604 Ga0495601_0242604_12_1100 360
372 3300001979 JGI24740J21852_10011038 JGI24740J21852_100110381 361
373 3300002067 JGI24735J21928_10008208 JGI24735J21928_100082082 361
374 3300002741 JGI25157J39369_1000368 JGI25157J39369_10003689 361
375 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006382 361
376 3300003323 rootH1_10136782 rootH1_101367821 361
377 3300005327 Ga0070658_10026524 Ga0070658_100265242 361
378 3300005329 Ga0070683_100017991 Ga0070683_1000179911 361
379 3300005336 Ga0070680_100004400 Ga0070680_1000044006 361
380 3300005341 Ga0070691_10002731 Ga0070691_100027315 361
381 3300005344 Ga0070661_100035064 Ga0070661_1000350642 361
382 3300005356 Ga0070674_100101438 Ga0070674_1001014382 361
383 3300005366 Ga0070659_100018390 Ga0070659_1000183902 361
384 3300005455 Ga0070663_100045666 Ga0070663_1000456662 361
385 3300005456 Ga0070678_100005197 Ga0070678_1000051975 361
386 3300005530 Ga0070679_100224503 Ga0070679_1002245032 361
387 3300005535 Ga0070684_100007464 Ga0070684_1000074647 361
388 3300005539 Ga0068853_100006807 Ga0068853_1000068078 361
389 3300005548 Ga0070665_100131593 Ga0070665_1001315932 361
390 3300005548 Ga0070665_100558018 Ga0070665_1005580181 361
391 3300005564 Ga0070664_100009414 Ga0070664_1000094143 361
392 3300005577 Ga0068857_100008187 Ga0068857_1000081872 361
393 3300005578 Ga0068854_100003391 Ga0068854_1000033914 361
394 3300005614 Ga0068856_100018038 Ga0068856_1000180382 361
395 3300005614 Ga0068856_100202448 Ga0068856_1002024482 361
396 3300005616 Ga0068852_100034797 Ga0068852_1000347972 361
397 3300006038 Ga0075365_10001409 Ga0075365_100014099 361
398 3300006048 Ga0075363_100042064 Ga0075363_1000420642 361
399 3300006178 Ga0075367_10018485 Ga0075367_100184853 361
400 3300009545 Ga0105237_10059551 Ga0105237_100595512 361
401 3300009551 Ga0105238_10002480 Ga0105238_1000248016 361
402 3300009551 Ga0105238_10016863 Ga0105238_100168637 361
403 3300010375 Ga0105239_10456609 Ga0105239_104566092 361
404 3300013100 Ga0157373_10012137 Ga0157373_100121376 361
405 3300013105 Ga0157369_10145795 Ga0157369_101457952 361
406 3300025250 Ga0209026_1000089 Ga0209026_100008934 361
407 3300025256 Ga0209759_1000040 Ga0209759_1000040220 361
408 3300025261 Ga0209233_1000010 Ga0209233_1000010963 361
409 3300025904 Ga0207647_10004002 Ga0207647_1000400210 361
410 3300025904 Ga0207647_10008715 Ga0207647_100087159 361
411 3300025909 Ga0207705_10004960 Ga0207705_1000496010 361
412 3300025913 Ga0207695_10005231 Ga0207695_100052319 361
413 3300025914 Ga0207671_10027555 Ga0207671_100275553 361
414 3300025919 Ga0207657_10020620 Ga0207657_100206201 361
415 3300025920 Ga0207649_10002339 Ga0207649_1000233910 361
416 3300025921 Ga0207652_10277675 Ga0207652_102776752 361
417 3300025923 Ga0207681_10215022 Ga0207681_102150222 361
418 3300025924 Ga0207694_10021922 Ga0207694_100219221 361
419 3300025937 Ga0207669_10060594 Ga0207669_100605942 361
420 3300025937 Ga0207669_10146624 Ga0207669_101466242 361
421 3300025945 Ga0207679_10208254 Ga0207679_102082542 361
422 3300025949 Ga0207667_10014964 Ga0207667_100149649 361
423 3300026041 Ga0207639_10002939 Ga0207639_1000293910 361
424 3300026078 Ga0207702_10004166 Ga0207702_1000416613 361
425 3300026078 Ga0207702_10160253 Ga0207702_101602532 361
426 3300026089 Ga0207648_10276737 Ga0207648_102767371 361
427 3300026116 Ga0207674_10024513 Ga0207674_100245136 361
428 3300026142 Ga0207698_10002323 Ga0207698_100023234 361
429 3300028379 Ga0268266_10100215 Ga0268266_101002152 361
430 3300028379 Ga0268266_10162151 Ga0268266_101621511 361
431 3300031456 Ga0307513_10206985 Ga0307513_102069852 361
432 3300031733 Ga0316577_10079278 Ga0316577_100792781 361
433 3300037312 Ga0395899_0009434 Ga0395899_0009434_3887_4972 361
434 3300037312 Ga0395899_0180672 Ga0395899_0180672_93_1178 361
435 3300037418 Ga0395900_0025630 Ga0395900_0025630_4015_5100 361
436 3300037418 Ga0395900_0054936 Ga0395900_0054936_952_2037 361
437 3300037466 Ga0395898_0011471 Ga0395898_0011471_2005_3090 361
438 3300037466 Ga0395898_0197112 Ga0395898_0197112_282_1367 361
439 3300037471 Ga0395905_0025930 Ga0395905_0025930_554_1639 361
440 3300037471 Ga0395905_0045007 Ga0395905_0045007_2408_3493 361
441 3300038443 Ga0395901_0040412 Ga0395901_0040412_2962_4047 361
442 3300038443 Ga0395901_0043658 Ga0395901_0043658_1627_2712 361
443 3300038443 Ga0395901_0074012 Ga0395901_0074012_1324_2409 361
444 3300038443 Ga0395901_0099929 Ga0395901_0099929_1674_2759 361
445 3300044658 Ga0466972_0029331 Ga0466972_0029331_1292_2377 361
446 3300046460 Ga0495638_0000416 Ga0495638_0000416_1785_2870 361
447 3300046530 Ga0495654_0098841 Ga0495654_0098841_181_1266 361
448 3300048921 Ga0496118_0172402 Ga0496118_0172402_219_1304 361
449 3300048923 Ga0496120_0001080 Ga0496120_0001080_15972_17057 361
450 3300048928 Ga0496125_0181265 Ga0496125_0181265_118_1203 361
451 3300049569 Ga0501032_0104787 Ga0501032_0104787_174_1265 361
452 3300049570 Ga0501033_0031107 Ga0501033_0031107_1682_2860 361
453 3300049742 Ga0501080_0148310 Ga0501080_0148310_586_1671 361
454 3300050492 nmdc:mga0yw44_48230_c1 nmdc:mga0yw44_48230_c1_867_1952 361
455 3300050494 nmdc:mga06z11_54661_c1 nmdc:mga06z11_54661_c1_444_1529 361
456 3300050495 nmdc:mga04h51_26638_c1 nmdc:mga04h51_26638_c1_328_1413 361
457 3300050516 nmdc:mga0sz30_58864_c1 nmdc:mga0sz30_58864_c1_405_1490 361
458 3300053155 Ga0500620_000143 Ga0500620_000143_8198_9283 361
459 3300053158 Ga0500627_0012724 Ga0500627_0012724_683_1768 361
460 3300053158 Ga0500627_0104745 Ga0500627_0104745_90_1175 361
461 3300001915 JGI24741J21665_1000320 JGI24741J21665_10003204 362
462 3300001979 JGI24740J21852_10006522 JGI24740J21852_100065223 362
463 3300001989 JGI24739J22299_10008028 JGI24739J22299_100080281 362
464 3300001990 JGI24737J22298_10005828 JGI24737J22298_100058283 362
465 3300002067 JGI24735J21928_10003322 JGI24735J21928_100033223 362
466 3300003771 Ga0055526_1000113 Ga0055526_100011319 362
467 3300003771 Ga0055526_1000189 Ga0055526_10001892 362
468 3300005327 Ga0070658_10026373 Ga0070658_100263733 362
469 3300005329 Ga0070683_100020324 Ga0070683_1000203242 362
470 3300005336 Ga0070680_100148973 Ga0070680_1001489732 362
471 3300005337 Ga0070682_100022989 Ga0070682_1000229892 362
472 3300005344 Ga0070661_100047836 Ga0070661_1000478362 362
473 3300005345 Ga0070692_10004755 Ga0070692_100047555 362
474 3300005455 Ga0070663_100002557 Ga0070663_1000025574 362
475 3300005457 Ga0070662_100033293 Ga0070662_1000332933 362
476 3300005539 Ga0068853_100090743 Ga0068853_1000907432 362
477 3300005548 Ga0070665_100297380 Ga0070665_1002973802 362
478 3300005563 Ga0068855_100111933 Ga0068855_1001119332 362
479 3300005564 Ga0070664_100013597 Ga0070664_1000135976 362
480 3300005578 Ga0068854_100053476 Ga0068854_1000534763 362
481 3300005614 Ga0068856_100274135 Ga0068856_1002741352 362
482 3300005616 Ga0068852_100070841 Ga0068852_1000708413 362
483 3300006051 Ga0075364_10057027 Ga0075364_100570272 362
484 3300009174 Ga0105241_10360341 Ga0105241_103603411 362
485 3300009545 Ga0105237_10343998 Ga0105237_103439981 362
486 3300013100 Ga0157373_10094583 Ga0157373_100945833 362
487 3300013102 Ga0157371_10014961 Ga0157371_100149615 362
488 3300013105 Ga0157369_10134895 Ga0157369_101348952 362
489 3300021320 Ga0214544_1000029 Ga0214544_1000029113 362
490 3300021321 Ga0214542_1000092 Ga0214542_100009281 362
491 3300021327 Ga0214543_1000045 Ga0214543_1000045113 362
492 3300025254 Ga0209148_1000738 Ga0209148_10007389 362
493 3300025272 Ga0209455_1000638 Ga0209455_10006388 362
494 3300025295 Ga0209564_1000017 Ga0209564_1000017258 362
495 3300025904 Ga0207647_10114139 Ga0207647_101141392 362
496 3300025912 Ga0207707_10004841 Ga0207707_100048418 362
497 3300025914 Ga0207671_10049202 Ga0207671_100492022 362
498 3300025917 Ga0207660_10004828 Ga0207660_100048283 362
499 3300025919 Ga0207657_10004234 Ga0207657_100042343 362
500 3300025920 Ga0207649_10010209 Ga0207649_100102094 362
501 3300025933 Ga0207706_10001668 Ga0207706_1000166813 362
502 3300025945 Ga0207679_10006438 Ga0207679_100064386 362
503 3300026067 Ga0207678_10002277 Ga0207678_100022776 362
504 3300026078 Ga0207702_10148038 Ga0207702_101480381 362
505 3300026078 Ga0207702_10480755 Ga0207702_104807551 362
506 3300026116 Ga0207674_10010013 Ga0207674_100100139 362
507 3300032004 Ga0307414_10267489 Ga0307414_102674891 362
508 3300037853 Ga0436364_0756344 Ga0436364_0756344_1551_2642 362
509 3300042436 Ga0439435_0002165 Ga0439435_0002165_225_1337 362
510 3300046460 Ga0495638_0031765 Ga0495638_0031765_17_1105 362
511 3300046660 Ga0495625_0127577 Ga0495625_0127577_119_1207 362
512 3300048905 Ga0496102_0168462 Ga0496102_0168462_516_1604 362
513 3300048913 Ga0496110_0292149 Ga0496110_0292149_64_1152 362
514 3300048917 Ga0496114_0302093 Ga0496114_0302093_163_1251 362
515 3300048923 Ga0496120_0008180 Ga0496120_0008180_1919_3007 362
516 3300049574 Ga0501038_0070289 Ga0501038_0070289_352_1452 362
517 3300049589 Ga0501073_0085434 Ga0501073_0085434_329_1429 362
518 3300049742 Ga0501080_0085581 Ga0501080_0085581_109_1209 362
519 3300049744 Ga0501083_0031874 Ga0501083_0031874_1208_2308 362
520 3300049823 Ga0501044_0207480 Ga0501044_0207480_433_1533 362
521 3300049823 Ga0501044_0272388 Ga0501044_0272388_329_1417 362
522 3300050492 nmdc:mga0yw44_87865_c1 nmdc:mga0yw44_87865_c1_289_1377 362
523 3300050496 nmdc:mga07m45_117713_c1 nmdc:mga07m45_117713_c1_30_1118 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

50

355

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o58-assembly1.cif.gz_A crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9443 20 331
5xeo-assembly1.cif.gz_B crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum 0.9402 16 331
1o58-assembly1.cif.gz_B crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9382 20 331
5xeo-assembly1.cif.gz_B crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum 0.9372 16 331
3fca-assembly1.cif.gz_A genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe 0.9337 19 331
ID Description Score Start End Superfamily
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9788 58 157 3.40.50.1100
af_A0A1D6JTA1_151_233_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9669 82 129 3.40.50.1100
5b1iC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.962 57 157 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.96 58 157 3.40.50.1100
af_Q965I8_90_187_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9573 54 152 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7S0JKB7-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9904 71 171 GO:0016020
AF-A0A358MGW6-F1-model_v4 Cysteine synthase 0.987 160 284 GO:0006534
GO:0009069
GO:0044272
AF-A0A524KGS4-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9793 15 309 GO:0004124
GO:0006535
AF-A0A660MEY9-F1-model_v4 cysteine synthase (EC 2.5.1.47) 0.9768 15 177 GO:0006535
GO:0016765
AF-A0A7Y6PL45-F1-model_v4 cysteine synthase (EC 2.5.1.47) 0.9761 15 290 GO:0004124
GO:0006535

Feature Viewer

pLDDT pTM Quality
88.3 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map