F459049

General Info

Members Datasets Scaffolds Average Seq Length
523 277 1046 137

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0152373|Ga0496112_0152373_569_1081
Length 170
Sequence LTTTRASPRSSTPRCASKTPASPPSRSQPVGRRLTDISINAGPYAFTARFERDAAPLTCERFERLLPYHERLIHVRWSGEACWIPLGALDLGLGHENATSFPAPGQILLYPGGISETEILLPYGGCLFASIVGQLAGNHFLTVVEGNENLRALGELTLWQGSQDIEFTRL

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
174 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
175 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
272 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 5.16
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 3.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0152373 3300048915 Bacteria 2279
2 JGI24750J21931_1044306 3300002070 Bacteria 682
3 Ga0070658_11035350 3300005327 Bacteria 714
4 Ga0070683_100013953 3300005329 Bacteria 7020
5 Ga0070683_100986079 3300005329 Bacteria 809
6 Ga0070683_101698370 3300005329 Bacteria 607
7 Ga0070690_100164489 3300005330 Bacteria 1523
8 Ga0068869_100105599 3300005334 Bacteria 2136
9 Ga0068869_100940937 3300005334 Bacteria 750
10 Ga0070666_10863391 3300005335 Bacteria 668
11 Ga0070680_100030754 3300005336 Bacteria 4313
12 Ga0070682_100088041 3300005337 Bacteria 2026
13 Ga0070682_100234138 3300005337 Bacteria 1315
14 Ga0068868_100333802 3300005338 Archaea 1294
15 Ga0068868_101580965 3300005338 Bacteria 616
16 Ga0070660_100886984 3300005339 Bacteria 752
17 Ga0070689_100004510 3300005340 Bacteria 9430
18 Ga0070668_100006128 3300005347 Bacteria 8916
19 Ga0070668_100696707 3300005347 Bacteria 896
20 Ga0070671_100154789 3300005355 Bacteria 1937
21 Ga0070688_100051993 3300005365 Bacteria 2557
22 Ga0070688_101216106 3300005365 Bacteria 606
23 Ga0070659_100024018 3300005366 Bacteria 4670
24 Ga0070667_101852333 3300005367 Bacteria 568
25 Ga0070709_10058612 3300005434 Bacteria 2442
26 Ga0070714_100030404 3300005435 Bacteria 4495
27 Ga0070714_100094472 3300005435 Bacteria 2624
28 Ga0070714_100688243 3300005435 Bacteria 986
29 Ga0070714_100901138 3300005435 Bacteria 859
30 Ga0070713_100020887 3300005436 Bacteria 5027
31 Ga0070713_100080754 3300005436 Bacteria 2773
32 Ga0070713_100420451 3300005436 Bacteria 1251
33 Ga0070713_100667421 3300005436 Bacteria 991
34 Ga0070713_100973687 3300005436 Bacteria 818
35 Ga0070713_100976400 3300005436 Bacteria 817
36 Ga0070710_10035378 3300005437 Bacteria 2723
37 Ga0070710_10122296 3300005437 Bacteria 1577
38 Ga0070710_10492713 3300005437 Bacteria 838
39 Ga0070701_10059140 3300005438 Bacteria 2014
40 Ga0070711_100006397 3300005439 Bacteria 7103
41 Ga0070711_100119092 3300005439 Bacteria 1950
42 Ga0070711_100187259 3300005439 Bacteria 1588
43 Ga0070694_100331442 3300005444 Bacteria 1174
44 Ga0070708_100005598 3300005445 Bacteria 9960
45 Ga0070708_100743771 3300005445 Bacteria 922
46 Ga0070663_101508366 3300005455 Bacteria 598
47 Ga0070678_100173398 3300005456 Bacteria 1759
48 Ga0070678_100222099 3300005456 Bacteria 1571
49 Ga0070662_100050709 3300005457 Bacteria 2994
50 Ga0070681_10057511 3300005458 Bacteria 3869
51 Ga0070681_10146398 3300005458 Bacteria 2291
52 Ga0068867_100401052 3300005459 Bacteria 1157
53 Ga0070706_100054601 3300005467 Bacteria 3687
54 Ga0070698_101938727 3300005471 Bacteria 542
55 Ga0070679_101272494 3300005530 Bacteria 681
56 Ga0070684_100787533 3300005535 Bacteria 888
57 Ga0070697_100145371 3300005536 Bacteria 1996
58 Ga0068853_100494928 3300005539 Bacteria 1154
59 Ga0068853_101961806 3300005539 Bacteria 568
60 Ga0068853_102239720 3300005539 Bacteria 530
61 Ga0070672_100377187 3300005543 Bacteria 1212
62 Ga0070686_100156130 3300005544 Bacteria 1602
63 Ga0070686_100821197 3300005544 Bacteria 751
64 Ga0070695_101790937 3300005545 Bacteria 515
65 Ga0070696_100432275 3300005546 Bacteria 1036
66 Ga0070664_100018871 3300005564 Bacteria 5669
67 Ga0070664_100067547 3300005564 Bacteria 3055
68 Ga0070664_101770785 3300005564 Bacteria 586
69 Ga0068856_100607328 3300005614 Bacteria 1115
70 Ga0068856_100980247 3300005614 Bacteria 864
71 Ga0068856_101496858 3300005614 Bacteria 689
72 Ga0070702_100034820 3300005615 Bacteria 2778
73 Ga0070702_101324085 3300005615 Bacteria 586
74 Ga0068852_100416293 3300005616 Unclassified 1325
75 Ga0068859_102018418 3300005617 Bacteria 637
76 Ga0068864_100270433 3300005618 Bacteria 1583
77 Ga0068866_10019619 3300005718 Bacteria 3083
78 Ga0068866_10649080 3300005718 Unclassified 718
79 Ga0068861_100117351 3300005719 Bacteria 2141
80 Ga0068851_10118952 3300005834 Bacteria 1418
81 Ga0068870_10315229 3300005840 Bacteria 992
82 Ga0068860_100062311 3300005843 Bacteria 3543
83 Ga0068862_100165954 3300005844 Bacteria 1974
84 Ga0068862_100650484 3300005844 Archaea 1017
85 Ga0081455_10120432 3300005937 Bacteria 2069
86 Ga0081455_10204587 3300005937 Bacteria 1476
87 Ga0081538_10000096 3300005981 Bacteria 85350
88 Ga0081538_10000705 3300005981 Bacteria 36642
89 Ga0081538_10001490 3300005981 Bacteria 24031
90 Ga0081538_10022940 3300005981 Bacteria 4502
91 Ga0081538_10054869 3300005981 Bacteria 2351
92 Ga0081538_10067481 3300005981 Bacteria 1997
93 Ga0081538_10084960 3300005981 Bacteria 1665
94 Ga0081540_1075547 3300005983 Bacteria 1539
95 Ga0081539_10006797 3300005985 Bacteria 10730
96 Ga0070717_10112176 3300006028 Bacteria 2327
97 Ga0070717_10132116 3300006028 Bacteria 2148
98 Ga0070717_10232224 3300006028 Bacteria 1624
99 Ga0075363_100612511 3300006048 Bacteria 653
100 Ga0075432_10071155 3300006058 Bacteria 1250
101 Ga0070712_100000791 3300006175 Bacteria 18739
102 Ga0070712_100004154 3300006175 Bacteria 8898
103 Ga0070712_100047360 3300006175 Bacteria 2975
104 Ga0070712_100170599 3300006175 Bacteria 1688
105 Ga0070712_100378986 3300006175 Bacteria 1164
106 Ga0070712_100581783 3300006175 Bacteria 946
107 Ga0070712_100625473 3300006175 Bacteria 913
108 Ga0070712_101300386 3300006175 Bacteria 634
109 Ga0097621_100489083 3300006237 Bacteria 1113
110 Ga0097621_100623078 3300006237 Bacteria 988
111 Ga0068871_102336757 3300006358 Bacteria 510
112 Ga0075428_100115820 3300006844 Bacteria 2919
113 Ga0075428_101069662 3300006844 Bacteria 853
114 Ga0075430_100749901 3300006846 Bacteria 805
115 Ga0075434_101046706 3300006871 Bacteria 830
116 Ga0075434_101294472 3300006871 Bacteria 740
117 Ga0068865_100304416 3300006881 Bacteria 1277
118 Ga0068865_100594326 3300006881 Bacteria 935
119 Ga0097620_102017684 3300006931 Bacteria 637
120 Ga0075435_100196113 3300007076 Bacteria 1710
121 Ga0099795_10108361 3300007788 Bacteria 1098
122 Ga0105240_10514453 3300009093 Bacteria 1329
123 Ga0105240_10727678 3300009093 Bacteria 1081
124 Ga0105240_12301822 3300009093 Bacteria 558
125 Ga0111539_10081358 3300009094 Bacteria 3810
126 Ga0111539_10253812 3300009094 Bacteria 2048
127 Ga0111539_10311092 3300009094 Bacteria 1833
128 Ga0111539_10447498 3300009094 Bacteria 1504
129 Ga0111539_10959139 3300009094 Bacteria 994
130 Ga0111539_13491183 3300009094 Bacteria 505
131 Ga0105245_10093223 3300009098 Bacteria 2775
132 Ga0105245_10109658 3300009098 Bacteria 2565
133 Ga0105245_10245941 3300009098 Bacteria 1736
134 Ga0105247_10085217 3300009101 Bacteria 1998
135 Ga0105243_10077946 3300009148 Bacteria 2697
136 Ga0105243_10683398 3300009148 Unclassified 998
137 Ga0105241_10225979 3300009174 Bacteria 1576
138 Ga0105242_10138754 3300009176 Bacteria 2107
139 Ga0105242_10463277 3300009176 Bacteria 1197
140 Ga0105242_12642032 3300009176 Bacteria 551
141 Ga0105242_13046917 3300009176 Unclassified 519
142 Ga0105248_12512674 3300009177 Bacteria 587
143 Ga0105237_10430223 3300009545 Unclassified 1325
144 Ga0105237_11165649 3300009545 Bacteria 777
145 Ga0105249_10051127 3300009553 Bacteria 3769
146 Ga0105249_10736991 3300009553 Bacteria 1047
147 Ga0105249_10971225 3300009553 Bacteria 918
148 Ga0105239_10072405 3300010375 Bacteria 3788
149 Ga0105239_10633479 3300010375 Bacteria 1221
150 Ga0105239_10684221 3300010375 Unclassified 1172
151 Ga0157371_10376688 3300013102 Bacteria 1036
152 Ga0157371_10578656 3300013102 Bacteria 834
153 Ga0157370_10985662 3300013104 Bacteria 763
154 Ga0157374_10227252 3300013296 Bacteria 1833
155 Ga0157374_10528725 3300013296 Bacteria 1186
156 Ga0157378_10458350 3300013297 Bacteria 1266
157 Ga0157378_11293915 3300013297 Bacteria 770
158 Ga0163162_10952226 3300013306 Bacteria 970
159 Ga0163162_10959537 3300013306 Bacteria 966
160 Ga0163162_12194905 3300013306 Bacteria 634
161 Ga0157372_10373888 3300013307 Bacteria 1661
162 Ga0157372_10629681 3300013307 Bacteria 1250
163 Ga0157375_10044420 3300013308 Bacteria 4317
164 Ga0157375_10522781 3300013308 Bacteria 1350
165 Ga0163163_10219851 3300014325 Bacteria 1948
166 Ga0182008_10034323 3300014497 Bacteria 2544
167 Ga0182008_10271092 3300014497 Bacteria 880
168 Ga0157377_10006045 3300014745 Bacteria 5743
169 Ga0157379_10087731 3300014968 Bacteria 2789
170 Ga0157379_10176600 3300014968 Bacteria 1929
171 Ga0157379_12007486 3300014968 Unclassified 572
172 Ga0213874_10045261 3300021377 Bacteria 1332
173 Ga0213876_10006249 3300021384 Bacteria 6497
174 Ga0213876_10086056 3300021384 Bacteria 1663
175 Ga0213876_10112956 3300021384 Bacteria 1442
176 Ga0213876_10261970 3300021384 Bacteria 919
177 Ga0213875_10000527 3300021388 Bacteria 31621
178 Ga0213875_10003109 3300021388 Bacteria 9571
179 Ga0213875_10008192 3300021388 Bacteria 5364
180 Ga0213875_10021657 3300021388 Bacteria 3076
181 Ga0213875_10039183 3300021388 Bacteria 2233
182 Ga0213875_10059701 3300021388 Bacteria 1785
183 Ga0213875_10068328 3300021388 Unclassified 1659
184 Ga0213875_10196696 3300021388 Bacteria 948
185 Ga0213875_10233860 3300021388 Bacteria 866
186 Ga0207656_10043019 3300025321 Bacteria 1925
187 Ga0207656_10148096 3300025321 Bacteria 1110
188 Ga0207692_10045407 3300025898 Bacteria 2197
189 Ga0207692_10049077 3300025898 Bacteria 2129
190 Ga0207692_10364869 3300025898 Bacteria 893
191 Ga0207692_10442520 3300025898 Bacteria 817
192 Ga0207642_10010963 3300025899 Bacteria 3217
193 Ga0207710_10018089 3300025900 Bacteria 2995
194 Ga0207688_10004904 3300025901 Bacteria 7283
195 Ga0207688_10070925 3300025901 Bacteria 1977
196 Ga0207699_10030768 3300025906 Bacteria 3007
197 Ga0207699_10079910 3300025906 Bacteria 2025
198 Ga0207643_10010757 3300025908 Bacteria 4932
199 Ga0207705_10726911 3300025909 Bacteria 771
200 Ga0207684_10095174 3300025910 Bacteria 2541
201 Ga0207684_10481363 3300025910 Bacteria 1065
202 Ga0207707_10163140 3300025912 Bacteria 1948
203 Ga0207707_10424972 3300025912 Bacteria 1139
204 Ga0207671_10622092 3300025914 Unclassified 860
205 Ga0207693_10004825 3300025915 Bacteria 11340
206 Ga0207693_10022403 3300025915 Bacteria 5021
207 Ga0207693_10122399 3300025915 Bacteria 2043
208 Ga0207693_10267076 3300025915 Bacteria 1341
209 Ga0207663_10010247 3300025916 Bacteria 4981
210 Ga0207663_10138690 3300025916 Bacteria 1691
211 Ga0207660_10121747 3300025917 Bacteria 1977
212 Ga0207657_10481192 3300025919 Unclassified 973
213 Ga0207652_10334682 3300025921 Bacteria 1367
214 Ga0207646_10005497 3300025922 Bacteria 13321
215 Ga0207681_10236890 3300025923 Bacteria 1419
216 Ga0207659_10933900 3300025926 Bacteria 746
217 Ga0207687_10014853 3300025927 Bacteria 5100
218 Ga0207687_10016637 3300025927 Bacteria 4832
219 Ga0207700_10044709 3300025928 Bacteria 3262
220 Ga0207700_10083744 3300025928 Bacteria 2498
221 Ga0207700_10406606 3300025928 Bacteria 1194
222 Ga0207700_10806118 3300025928 Bacteria 840
223 Ga0207664_10087225 3300025929 Bacteria 2551
224 Ga0207664_10159996 3300025929 Bacteria 1920
225 Ga0207644_10292635 3300025931 Bacteria 1310
226 Ga0207690_10007496 3300025932 Bacteria 6477
227 Ga0207690_10033007 3300025932 Bacteria 3326
228 Ga0207690_11522683 3300025932 Bacteria 559
229 Ga0207686_10166859 3300025934 Bacteria 1549
230 Ga0207709_10037068 3300025935 Bacteria 2895
231 Ga0207689_10007657 3300025942 Bacteria 9459
232 Ga0207661_10530381 3300025944 Bacteria 1077
233 Ga0207679_10014344 3300025945 Bacteria 5209
234 Ga0207651_10055099 3300025960 Bacteria 2729
235 Ga0207712_10033630 3300025961 Bacteria 3467
236 Ga0207712_10086597 3300025961 Bacteria 2295
237 Ga0207668_10117417 3300025972 Bacteria 2008
238 Ga0207640_11507986 3300025981 Bacteria 604
239 Ga0207658_10558894 3300025986 Bacteria 1025
240 Ga0207677_10537876 3300026023 Archaea 1016
241 Ga0207678_10017801 3300026067 Bacteria 6238
242 Ga0207678_10199707 3300026067 Bacteria 1710
243 Ga0207708_10039154 3300026075 Bacteria 3611
244 Ga0207702_10563505 3300026078 Bacteria 1115
245 Ga0207648_10069467 3300026089 Bacteria 3069
246 Ga0207648_10867729 3300026089 Bacteria 842
247 Ga0207674_10209536 3300026116 Bacteria 1898
248 Ga0207675_100004117 3300026118 Bacteria 14075
249 Ga0207675_101589043 3300026118 Bacteria 674
250 Ga0207683_10085407 3300026121 Bacteria 2805
251 Ga0207683_10180739 3300026121 Bacteria 1912
252 Ga0207698_10445833 3300026142 Unclassified 1248
253 Ga0207698_10579149 3300026142 Bacteria 1104
254 Ga0207698_10591368 3300026142 Bacteria 1093
255 Ga0207428_10149884 3300027907 Bacteria 1776
256 Ga0268265_10205974 3300028380 Bacteria 1710
257 Ga0268265_10481335 3300028380 Bacteria 1166
258 Ga0265338_10794724 3300028800 Bacteria 649
259 Ga0265338_11050626 3300028800 Bacteria 550
260 Ga0265338_11138265 3300028800 Unclassified 525
261 Ga0265339_10044353 3300031249 Bacteria 2454
262 Ga0307408_100503419 3300031548 Bacteria 1061
263 Ga0265313_10053182 3300031595 Bacteria 1929
264 Ga0265314_10063623 3300031711 Bacteria 2502
265 Ga0307413_10418063 3300031824 Bacteria 1055
266 Ga0307413_11620547 3300031824 Bacteria 575
267 Ga0307410_10929636 3300031852 Bacteria 746
268 Ga0307410_11226067 3300031852 Bacteria 654
269 Ga0307410_11433070 3300031852 Bacteria 607
270 Ga0307410_11650847 3300031852 Bacteria 567
271 Ga0307410_11869392 3300031852 Bacteria 534
272 Ga0307407_10060599 3300031903 Bacteria 2209
273 Ga0307407_10064512 3300031903 Bacteria 2153
274 Ga0307407_10633792 3300031903 Bacteria 799
275 Ga0307409_100014656 3300031995 Bacteria 5110
276 Ga0307409_100171418 3300031995 Bacteria 1910
277 Ga0307409_100771019 3300031995 Bacteria 967
278 Ga0307409_100978361 3300031995 Bacteria 863
279 Ga0307416_100047083 3300032002 Bacteria 3410
280 Ga0307416_100048892 3300032002 Bacteria 3359
281 Ga0307416_100093705 3300032002 Bacteria 2588
282 Ga0307416_100436789 3300032002 Bacteria 1358
283 Ga0307416_100482572 3300032002 Bacteria 1300
284 Ga0307416_101694327 3300032002 Bacteria 737
285 Ga0307416_102446884 3300032002 Bacteria 621
286 Ga0307411_10781053 3300032005 Bacteria 839
287 Ga0307415_100002440 3300032126 Bacteria 9282
288 Ga0307415_100297332 3300032126 Bacteria 1336
289 Ga0307415_100381882 3300032126 Bacteria 1196
290 Ga0373926_0218701 3300035083 Bacteria 735
291 Ga0373944_0170502 3300035089 Bacteria 776
292 Ga0373941_0138657 3300035115 Bacteria 883
293 Ga0373945_0530750 3300035116 Bacteria 527
294 Ga0373954_0105018 3300035118 Unclassified 1364
295 Ga0373956_0236844 3300035119 Bacteria 867
296 Ga0373955_0066970 3300035172 Bacteria 1998
297 Ga0373924_0075541 3300035410 Bacteria 1426
298 Ga0373931_0619904 3300035691 Bacteria 709
299 Ga0373933_0007517 3300035724 Bacteria 5952
300 Ga0373933_0033385 3300035724 Bacteria 2994
301 Ga0373947_0210724 3300035725 Bacteria 1274
302 Ga0373947_0217157 3300035725 Bacteria 1256
303 Ga0373947_0353528 3300035725 Bacteria 986
304 Ga0373937_0006522 3300036401 Bacteria 10075
305 Ga0373937_0020176 3300036401 Bacteria 5973
306 Ga0373937_0140798 3300036401 Bacteria 2257
307 Ga0373925_0412820 3300037068 Bacteria 1102
308 Ga0395900_1200280 3300037418 Bacteria 674
309 Ga0395900_1529022 3300037418 Bacteria 579
310 Ga0395898_1372546 3300037466 Bacteria 635
311 Ga0436364_0038469 3300037853 Bacteria 2275
312 Ga0436364_0042928 3300037853 Bacteria 71182
313 Ga0436364_0083077 3300037853 Bacteria 1618
314 Ga0436364_0112021 3300037853 Bacteria 2010
315 Ga0436364_0604030 3300037853 Bacteria 8182
316 Ga0436364_0755546 3300037853 Bacteria 548
317 Ga0436364_0858825 3300037853 Bacteria 170378
318 Ga0436364_0935468 3300037853 Bacteria 6173
319 Ga0436364_0950192 3300037853 Bacteria 814
320 Ga0436364_0975546 3300037853 Bacteria 3778
321 Ga0436364_1109394 3300037853 Bacteria 1861
322 Ga0436364_1501317 3300037853 Bacteria 561
323 Ga0436364_1502204 3300037853 Bacteria 2021
324 Ga0436364_1506201 3300037853 Bacteria 965
325 Ga0395901_0200518 3300038443 Bacteria 2092
326 Ga0436365_0176992 3300039437 Bacteria 1260
327 Ga0436365_0231390 3300039437 Bacteria 14465
328 Ga0436365_0521726 3300039437 Bacteria 3123
329 Ga0436365_0590896 3300039437 Bacteria 1947
330 Ga0436365_0858856 3300039437 Bacteria 1624
331 Ga0436365_1244328 3300039437 Bacteria 571
332 Ga0436365_1331315 3300039437 Bacteria 1501
333 Ga0436365_1359362 3300039437 Bacteria 1951
334 Ga0436365_1500350 3300039437 Bacteria 4229
335 Ga0436365_1585825 3300039437 Bacteria 26954
336 Ga0436360_0757036 3300039438 Bacteria 1124
337 Ga0436360_1278076 3300039438 Bacteria 992
338 Ga0436363_0186460 3300039450 Bacteria 1103
339 Ga0436363_0413515 3300039450 Bacteria 529
340 Ga0436363_0708951 3300039450 Bacteria 821
341 Ga0436363_0728748 3300039450 Bacteria 703
342 Ga0436363_0730103 3300039450 Bacteria 5302
343 Ga0436363_0903557 3300039450 Bacteria 1082
344 Ga0436363_1153300 3300039450 Bacteria 526
345 Ga0436363_1193882 3300039450 Bacteria 927
346 Ga0436363_1432469 3300039450 Bacteria 1048
347 Ga0436362_1080396 3300039453 Bacteria 2281
348 Ga0451793_1920140 3300041452 Bacteria 653
349 Ga0451839_1617207 3300041496 Bacteria 565
350 Ga0450905_029983 3300042142 Bacteria 835
351 Ga0439458_0132683 3300042157 Bacteria 661
352 Ga0439460_0122967 3300042461 Bacteria 850
353 Ga0466969_0311179 3300044656 Bacteria 713
354 Ga0466972_0322131 3300044658 Unclassified 722
355 Ga0466965_0179773 3300044683 Bacteria 1116
356 Ga0466966_0379293 3300044684 Bacteria 850
357 Ga0466961_0131319 3300044693 Bacteria 1569
358 Ga0466963_0002642 3300044694 Bacteria 10071
359 Ga0466963_0060820 3300044694 Bacteria 2523
360 Ga0466963_0320429 3300044694 Bacteria 1091
361 Ga0466963_0342803 3300044694 Bacteria 1052
362 Ga0466963_0570224 3300044694 Bacteria 799
363 Ga0466964_0462997 3300044706 Bacteria 674
364 Ga0466971_0258150 3300044719 Bacteria 831
365 Ga0466957_0716539 3300044842 Bacteria 707
366 Ga0466960_0118306 3300044901 Bacteria 1385
367 Ga0466960_0178307 3300044901 Unclassified 1150
368 Ga0466959_0004800 3300045049 Bacteria 9125
369 Ga0466959_0191935 3300045049 Bacteria 1425
370 Ga0466959_0435536 3300045049 Bacteria 889
371 Ga0466967_0023794 3300045976 Bacteria 5025
372 Ga0466967_0024535 3300045976 Bacteria 4960
373 Ga0466967_0044122 3300045976 Bacteria 3865
374 Ga0466967_0058957 3300045976 Bacteria 3395
375 Ga0466967_0152181 3300045976 Bacteria 2163
376 Ga0466967_0182329 3300045976 Bacteria 1981
377 Ga0466967_0195186 3300045976 Bacteria 1915
378 Ga0466967_0865703 3300045976 Bacteria 898
379 Ga0466967_0958201 3300045976 Bacteria 851
380 Ga0466967_1348590 3300045976 Bacteria 710
381 Ga0466967_1808702 3300045976 Bacteria 608
382 Ga0466967_1838033 3300045976 Bacteria 603
383 Ga0495592_0008444 3300046454 Bacteria 7726
384 Ga0495651_0001521 3300046462 Bacteria 17919
385 Ga0495651_0136616 3300046462 Bacteria 1783
386 Ga0495653_0069419 3300046463 Bacteria 2640
387 Ga0495580_0236481 3300046472 Bacteria 1253
388 Ga0495664_0117599 3300046477 Bacteria 1607
389 Ga0495664_0330492 3300046477 Bacteria 919
390 Ga0495607_0480000 3300046501 Bacteria 554
391 Ga0495608_0003441 3300046511 Bacteria 11335
392 Ga0495618_0006858 3300046514 Bacteria 6903
393 Ga0495630_0293435 3300046517 Bacteria 1243
394 Ga0495652_0174245 3300046529 Bacteria 1657
395 Ga0495665_0697234 3300046531 Unclassified 504
396 Ga0495587_0003974 3300046536 Bacteria 9804
397 Ga0495645_0630023 3300046543 Bacteria 657
398 Ga0495667_0001155 3300046559 Bacteria 17213
399 Ga0495634_0079791 3300046642 Bacteria 2143
400 Ga0495635_0012945 3300046663 Bacteria 5839
401 Ga0495635_0665229 3300046663 Bacteria 677
402 Ga0495657_0002992 3300046675 Bacteria 13992
403 Ga0495599_0107067 3300046678 Bacteria 1742
404 Ga0495623_0039029 3300046679 Bacteria 3036
405 Ga0495658_0298867 3300046683 Bacteria 1018
406 Ga0495613_0203462 3300046689 Bacteria 1395
407 Ga0495624_0283647 3300046690 Bacteria 1000
408 Ga0495600_0021794 3300046809 Bacteria 4108
409 Ga0495581_0464315 3300047315 Bacteria 737
410 Ga0495604_0003792 3300047317 Bacteria 12032
411 Ga0495674_0061851 3300047319 Bacteria 3262
412 Ga0495674_0200993 3300047319 Bacteria 1653
413 Ga0495680_0032687 3300047322 Bacteria 4220
414 Ga0495680_0652240 3300047322 Bacteria 699
415 Ga0495675_0005251 3300047444 Bacteria 7887
416 Ga0495602_0006643 3300048088 Bacteria 12127
417 Ga0495602_0609800 3300048088 Bacteria 750
418 Ga0496100_0619231 3300048903 Bacteria 841
419 Ga0496102_0187535 3300048905 Bacteria 1949
420 Ga0496102_0652204 3300048905 Bacteria 976
421 Ga0496104_0019218 3300048907 Bacteria 6247
422 Ga0496104_0022827 3300048907 Bacteria 5749
423 Ga0496105_0359309 3300048908 Bacteria 1162
424 Ga0496106_0039372 3300048909 Bacteria 3540
425 Ga0496107_0114372 3300048910 Bacteria 1985
426 Ga0496108_0030880 3300048911 Bacteria 4440
427 Ga0496108_0342611 3300048911 Bacteria 1304
428 Ga0496109_0186008 3300048912 Bacteria 1951
429 Ga0496109_0292293 3300048912 Bacteria 1536
430 Ga0496110_0055734 3300048913 Bacteria 3478
431 Ga0496110_1095439 3300048913 Bacteria 705
432 Ga0496112_0010866 3300048915 Bacteria 8285
433 Ga0496112_0125368 3300048915 Bacteria 2539
434 Ga0496112_0303000 3300048915 Bacteria 1543
435 Ga0496113_0047865 3300048916 Bacteria 3179
436 Ga0496113_0087262 3300048916 Bacteria 2398
437 Ga0496114_0039102 3300048917 Bacteria 3926
438 Ga0496114_0722380 3300048917 Bacteria 872
439 Ga0496114_1457804 3300048917 Bacteria 572
440 Ga0496115_0502644 3300048918 Bacteria 974
441 Ga0496115_0524488 3300048918 Bacteria 949
442 Ga0496115_0774467 3300048918 Bacteria 749
443 Ga0496119_0005295 3300048922 Bacteria 12426
444 Ga0496126_0112976 3300048929 Bacteria 2365
445 Ga0501031_0120355 3300049568 Bacteria 1715
446 Ga0501031_0260331 3300049568 Bacteria 1127
447 Ga0501033_0270713 3300049570 Bacteria 1201
448 Ga0501034_1119838 3300049571 Bacteria 668
449 Ga0501036_0031423 3300049572 Bacteria 4488
450 Ga0501037_0059125 3300049573 Bacteria 2797
451 Ga0501038_0389131 3300049574 Bacteria 1080
452 Ga0501038_1354474 3300049574 Bacteria 512
453 Ga0501039_0094759 3300049575 Bacteria 2327
454 Ga0501039_0141131 3300049575 Bacteria 1892
455 Ga0501041_0235850 3300049577 Bacteria 1149
456 Ga0501041_0292505 3300049577 Bacteria 1026
457 Ga0501042_0027698 3300049578 Bacteria 3986
458 Ga0501042_0331761 3300049578 Bacteria 1099
459 Ga0501043_0613774 3300049579 Bacteria 802
460 Ga0501046_0131185 3300049580 Bacteria 1901
461 Ga0501046_0133710 3300049580 Bacteria 1880
462 Ga0501047_0341884 3300049581 Bacteria 1334
463 Ga0501047_0724033 3300049581 Bacteria 812
464 Ga0501048_0342734 3300049582 Bacteria 1065
465 Ga0501067_0584548 3300049583 Bacteria 626
466 Ga0501070_0481738 3300049586 Bacteria 998
467 Ga0501071_0061329 3300049587 Bacteria 2723
468 Ga0501072_0091914 3300049588 Bacteria 2409
469 Ga0501072_0481077 3300049588 Bacteria 982
470 Ga0501072_1133733 3300049588 Bacteria 608
471 Ga0501075_0092866 3300049591 Bacteria 2291
472 Ga0501075_0168045 3300049591 Bacteria 1673
473 Ga0501076_0085386 3300049592 Bacteria 2536
474 Ga0501076_0403395 3300049592 Bacteria 1124
475 Ga0501076_0458628 3300049592 Bacteria 1049
476 Ga0501261_056122 3300049690 Bacteria 658
477 Ga0501079_0080921 3300049741 Bacteria 2511
478 Ga0501079_0236409 3300049741 Bacteria 1427
479 Ga0501080_0335729 3300049742 Bacteria 1366
480 Ga0501081_0057711 3300049743 Bacteria 2685
481 Ga0501081_0317462 3300049743 Bacteria 1145
482 Ga0501081_0458881 3300049743 Bacteria 947
483 Ga0501081_0583225 3300049743 Bacteria 836
484 Ga0501083_0132083 3300049744 Bacteria 1637
485 Ga0501035_0189244 3300049822 Bacteria 1770
486 Ga0501045_0069210 3300049824 Bacteria 2594
487 Ga0501045_0094780 3300049824 Bacteria 2208
488 Ga0501045_0260989 3300049824 Bacteria 1289
489 nmdc:mga0yw44_323206_c1 3300050492 Bacteria 1036
490 nmdc:mga0qj67_199932_c1 3300050509 Unclassified 1624
491 nmdc:mga0qj67_982960_c1 3300050509 Unclassified 663
492 nmdc:mga06r32_103196_c1 3300050510 Bacteria 2800
493 nmdc:mga08y16_1622379_c1 3300050511 Bacteria 604
494 nmdc:mga08y16_248248_c1 3300050511 Bacteria 1839
495 nmdc:mga08y16_339814_c1 3300050511 Bacteria 1543
496 nmdc:mga08y16_511084_c1 3300050511 Bacteria 1219
497 nmdc:mga08y16_976757_c1 3300050511 Bacteria 828
498 nmdc:mga0n895_1492501_c1 3300050512 Bacteria 642
499 nmdc:mga0n895_1871603_c1 3300050512 Bacteria 559
500 Ga0495601_0114777 3300053077 Bacteria 1746
501 Ga0495601_0666193 3300053077 Bacteria 665
502 Ga0495601_0771098 3300053077 Bacteria 611
503 Ga0495612_0015872 3300053078 Bacteria 3019
504 Ga0495655_0115417 3300053083 Bacteria 812
505 Ga0495595_0009784 3300053084 Bacteria 3974
506 Ga0495595_0404789 3300053084 Bacteria 692
507 Ga0495619_0029071 3300053085 Bacteria 3569
508 Ga0495619_0476876 3300053085 Bacteria 859
509 Ga0495619_0916874 3300053085 Unclassified 589
510 Ga0500562_073013 3300053108 Bacteria 926
511 Ga0500577_0234424 3300053142 Unclassified 796
512 Ga0500611_143086 3300053727 Bacteria 652
513 Ga0500596_000060 3300053735 Bacteria 15216
514 Ga0501084_0013575 3300054114 Bacteria 6740
515 Ga0590075_002831 3300059424 Bacteria 4140
516 Ga0501082_0259877 3300060353 Bacteria 1510
517 Ga0501082_0281907 3300060353 Bacteria 1446
518 Ga0501082_0987330 3300060353 Bacteria 736
519 Ga0466962_0022892 3300061719 Bacteria 3002
520 Ga0466962_0249553 3300061719 Bacteria 872
521 Ga0530510_0013688 3300061734 Bacteria 5710
522 Ga0530510_0149760 3300061734 Bacteria 1722
523 Ga0530510_1185694 3300061734 Bacteria 585
524 Ga0496112_0152373
525 JGI24750J21931_1044306
526 Ga0070658_11035350
527 Ga0070683_100013953
528 Ga0070683_100986079
529 Ga0070683_101698370
530 Ga0070690_100164489
531 Ga0068869_100105599
532 Ga0068869_100940937
533 Ga0070666_10863391
534 Ga0070680_100030754
535 Ga0070682_100088041
536 Ga0070682_100234138
537 Ga0068868_100333802
538 Ga0068868_101580965
539 Ga0070660_100886984
540 Ga0070689_100004510
541 Ga0070668_100006128
542 Ga0070668_100696707
543 Ga0070671_100154789
544 Ga0070688_100051993
545 Ga0070688_101216106
546 Ga0070659_100024018
547 Ga0070667_101852333
548 Ga0070709_10058612
549 Ga0070714_100030404
550 Ga0070714_100094472
551 Ga0070714_100688243
552 Ga0070714_100901138
553 Ga0070713_100020887
554 Ga0070713_100080754
555 Ga0070713_100420451
556 Ga0070713_100667421
557 Ga0070713_100973687
558 Ga0070713_100976400
559 Ga0070710_10035378
560 Ga0070710_10122296
561 Ga0070710_10492713
562 Ga0070701_10059140
563 Ga0070711_100006397
564 Ga0070711_100119092
565 Ga0070711_100187259
566 Ga0070694_100331442
567 Ga0070708_100005598
568 Ga0070708_100743771
569 Ga0070663_101508366
570 Ga0070678_100173398
571 Ga0070678_100222099
572 Ga0070662_100050709
573 Ga0070681_10057511
574 Ga0070681_10146398
575 Ga0068867_100401052
576 Ga0070706_100054601
577 Ga0070698_101938727
578 Ga0070679_101272494
579 Ga0070684_100787533
580 Ga0070697_100145371
581 Ga0068853_100494928
582 Ga0068853_101961806
583 Ga0068853_102239720
584 Ga0070672_100377187
585 Ga0070686_100156130
586 Ga0070686_100821197
587 Ga0070695_101790937
588 Ga0070696_100432275
589 Ga0070664_100018871
590 Ga0070664_100067547
591 Ga0070664_101770785
592 Ga0068856_100607328
593 Ga0068856_100980247
594 Ga0068856_101496858
595 Ga0070702_100034820
596 Ga0070702_101324085
597 Ga0068852_100416293
598 Ga0068859_102018418
599 Ga0068864_100270433
600 Ga0068866_10019619
601 Ga0068866_10649080
602 Ga0068861_100117351
603 Ga0068851_10118952
604 Ga0068870_10315229
605 Ga0068860_100062311
606 Ga0068862_100165954
607 Ga0068862_100650484
608 Ga0081455_10120432
609 Ga0081455_10204587
610 Ga0081538_10000096
611 Ga0081538_10000705
612 Ga0081538_10001490
613 Ga0081538_10022940
614 Ga0081538_10054869
615 Ga0081538_10067481
616 Ga0081538_10084960
617 Ga0081540_1075547
618 Ga0081539_10006797
619 Ga0070717_10112176
620 Ga0070717_10132116
621 Ga0070717_10232224
622 Ga0075363_100612511
623 Ga0075432_10071155
624 Ga0070712_100000791
625 Ga0070712_100004154
626 Ga0070712_100047360
627 Ga0070712_100170599
628 Ga0070712_100378986
629 Ga0070712_100581783
630 Ga0070712_100625473
631 Ga0070712_101300386
632 Ga0097621_100489083
633 Ga0097621_100623078
634 Ga0068871_102336757
635 Ga0075428_100115820
636 Ga0075428_101069662
637 Ga0075430_100749901
638 Ga0075434_101046706
639 Ga0075434_101294472
640 Ga0068865_100304416
641 Ga0068865_100594326
642 Ga0097620_102017684
643 Ga0075435_100196113
644 Ga0099795_10108361
645 Ga0105240_10514453
646 Ga0105240_10727678
647 Ga0105240_12301822
648 Ga0111539_10081358
649 Ga0111539_10253812
650 Ga0111539_10311092
651 Ga0111539_10447498
652 Ga0111539_10959139
653 Ga0111539_13491183
654 Ga0105245_10093223
655 Ga0105245_10109658
656 Ga0105245_10245941
657 Ga0105247_10085217
658 Ga0105243_10077946
659 Ga0105243_10683398
660 Ga0105241_10225979
661 Ga0105242_10138754
662 Ga0105242_10463277
663 Ga0105242_12642032
664 Ga0105242_13046917
665 Ga0105248_12512674
666 Ga0105237_10430223
667 Ga0105237_11165649
668 Ga0105249_10051127
669 Ga0105249_10736991
670 Ga0105249_10971225
671 Ga0105239_10072405
672 Ga0105239_10633479
673 Ga0105239_10684221
674 Ga0157371_10376688
675 Ga0157371_10578656
676 Ga0157370_10985662
677 Ga0157374_10227252
678 Ga0157374_10528725
679 Ga0157378_10458350
680 Ga0157378_11293915
681 Ga0163162_10952226
682 Ga0163162_10959537
683 Ga0163162_12194905
684 Ga0157372_10373888
685 Ga0157372_10629681
686 Ga0157375_10044420
687 Ga0157375_10522781
688 Ga0163163_10219851
689 Ga0182008_10034323
690 Ga0182008_10271092
691 Ga0157377_10006045
692 Ga0157379_10087731
693 Ga0157379_10176600
694 Ga0157379_12007486
695 Ga0213874_10045261
696 Ga0213876_10006249
697 Ga0213876_10086056
698 Ga0213876_10112956
699 Ga0213876_10261970
700 Ga0213875_10000527
701 Ga0213875_10003109
702 Ga0213875_10008192
703 Ga0213875_10021657
704 Ga0213875_10039183
705 Ga0213875_10059701
706 Ga0213875_10068328
707 Ga0213875_10196696
708 Ga0213875_10233860
709 Ga0207656_10043019
710 Ga0207656_10148096
711 Ga0207692_10045407
712 Ga0207692_10049077
713 Ga0207692_10364869
714 Ga0207692_10442520
715 Ga0207642_10010963
716 Ga0207710_10018089
717 Ga0207688_10004904
718 Ga0207688_10070925
719 Ga0207699_10030768
720 Ga0207699_10079910
721 Ga0207643_10010757
722 Ga0207705_10726911
723 Ga0207684_10095174
724 Ga0207684_10481363
725 Ga0207707_10163140
726 Ga0207707_10424972
727 Ga0207671_10622092
728 Ga0207693_10004825
729 Ga0207693_10022403
730 Ga0207693_10122399
731 Ga0207693_10267076
732 Ga0207663_10010247
733 Ga0207663_10138690
734 Ga0207660_10121747
735 Ga0207657_10481192
736 Ga0207652_10334682
737 Ga0207646_10005497
738 Ga0207681_10236890
739 Ga0207659_10933900
740 Ga0207687_10014853
741 Ga0207687_10016637
742 Ga0207700_10044709
743 Ga0207700_10083744
744 Ga0207700_10406606
745 Ga0207700_10806118
746 Ga0207664_10087225
747 Ga0207664_10159996
748 Ga0207644_10292635
749 Ga0207690_10007496
750 Ga0207690_10033007
751 Ga0207690_11522683
752 Ga0207686_10166859
753 Ga0207709_10037068
754 Ga0207689_10007657
755 Ga0207661_10530381
756 Ga0207679_10014344
757 Ga0207651_10055099
758 Ga0207712_10033630
759 Ga0207712_10086597
760 Ga0207668_10117417
761 Ga0207640_11507986
762 Ga0207658_10558894
763 Ga0207677_10537876
764 Ga0207678_10017801
765 Ga0207678_10199707
766 Ga0207708_10039154
767 Ga0207702_10563505
768 Ga0207648_10069467
769 Ga0207648_10867729
770 Ga0207674_10209536
771 Ga0207675_100004117
772 Ga0207675_101589043
773 Ga0207683_10085407
774 Ga0207683_10180739
775 Ga0207698_10445833
776 Ga0207698_10579149
777 Ga0207698_10591368
778 Ga0207428_10149884
779 Ga0268265_10205974
780 Ga0268265_10481335
781 Ga0265338_10794724
782 Ga0265338_11050626
783 Ga0265338_11138265
784 Ga0265339_10044353
785 Ga0307408_100503419
786 Ga0265313_10053182
787 Ga0265314_10063623
788 Ga0307413_10418063
789 Ga0307413_11620547
790 Ga0307410_10929636
791 Ga0307410_11226067
792 Ga0307410_11433070
793 Ga0307410_11650847
794 Ga0307410_11869392
795 Ga0307407_10060599
796 Ga0307407_10064512
797 Ga0307407_10633792
798 Ga0307409_100014656
799 Ga0307409_100171418
800 Ga0307409_100771019
801 Ga0307409_100978361
802 Ga0307416_100047083
803 Ga0307416_100048892
804 Ga0307416_100093705
805 Ga0307416_100436789
806 Ga0307416_100482572
807 Ga0307416_101694327
808 Ga0307416_102446884
809 Ga0307411_10781053
810 Ga0307415_100002440
811 Ga0307415_100297332
812 Ga0307415_100381882
813 Ga0373926_0218701
814 Ga0373944_0170502
815 Ga0373941_0138657
816 Ga0373945_0530750
817 Ga0373954_0105018
818 Ga0373956_0236844
819 Ga0373955_0066970
820 Ga0373924_0075541
821 Ga0373931_0619904
822 Ga0373933_0007517
823 Ga0373933_0033385
824 Ga0373947_0210724
825 Ga0373947_0217157
826 Ga0373947_0353528
827 Ga0373937_0006522
828 Ga0373937_0020176
829 Ga0373937_0140798
830 Ga0373925_0412820
831 Ga0395900_1200280
832 Ga0395900_1529022
833 Ga0395898_1372546
834 Ga0436364_0038469
835 Ga0436364_0042928
836 Ga0436364_0083077
837 Ga0436364_0112021
838 Ga0436364_0604030
839 Ga0436364_0755546
840 Ga0436364_0858825
841 Ga0436364_0935468
842 Ga0436364_0950192
843 Ga0436364_0975546
844 Ga0436364_1109394
845 Ga0436364_1501317
846 Ga0436364_1502204
847 Ga0436364_1506201
848 Ga0395901_0200518
849 Ga0436365_0176992
850 Ga0436365_0231390
851 Ga0436365_0521726
852 Ga0436365_0590896
853 Ga0436365_0858856
854 Ga0436365_1244328
855 Ga0436365_1331315
856 Ga0436365_1359362
857 Ga0436365_1500350
858 Ga0436365_1585825
859 Ga0436360_0757036
860 Ga0436360_1278076
861 Ga0436363_0186460
862 Ga0436363_0413515
863 Ga0436363_0708951
864 Ga0436363_0728748
865 Ga0436363_0730103
866 Ga0436363_0903557
867 Ga0436363_1153300
868 Ga0436363_1193882
869 Ga0436363_1432469
870 Ga0436362_1080396
871 Ga0451793_1920140
872 Ga0451839_1617207
873 Ga0450905_029983
874 Ga0439458_0132683
875 Ga0439460_0122967
876 Ga0466969_0311179
877 Ga0466972_0322131
878 Ga0466965_0179773
879 Ga0466966_0379293
880 Ga0466961_0131319
881 Ga0466963_0002642
882 Ga0466963_0060820
883 Ga0466963_0320429
884 Ga0466963_0342803
885 Ga0466963_0570224
886 Ga0466964_0462997
887 Ga0466971_0258150
888 Ga0466957_0716539
889 Ga0466960_0118306
890 Ga0466960_0178307
891 Ga0466959_0004800
892 Ga0466959_0191935
893 Ga0466959_0435536
894 Ga0466967_0023794
895 Ga0466967_0024535
896 Ga0466967_0044122
897 Ga0466967_0058957
898 Ga0466967_0152181
899 Ga0466967_0182329
900 Ga0466967_0195186
901 Ga0466967_0865703
902 Ga0466967_0958201
903 Ga0466967_1348590
904 Ga0466967_1808702
905 Ga0466967_1838033
906 Ga0495592_0008444
907 Ga0495651_0001521
908 Ga0495651_0136616
909 Ga0495653_0069419
910 Ga0495580_0236481
911 Ga0495664_0117599
912 Ga0495664_0330492
913 Ga0495607_0480000
914 Ga0495608_0003441
915 Ga0495618_0006858
916 Ga0495630_0293435
917 Ga0495652_0174245
918 Ga0495665_0697234
919 Ga0495587_0003974
920 Ga0495645_0630023
921 Ga0495667_0001155
922 Ga0495634_0079791
923 Ga0495635_0012945
924 Ga0495635_0665229
925 Ga0495657_0002992
926 Ga0495599_0107067
927 Ga0495623_0039029
928 Ga0495658_0298867
929 Ga0495613_0203462
930 Ga0495624_0283647
931 Ga0495600_0021794
932 Ga0495581_0464315
933 Ga0495604_0003792
934 Ga0495674_0061851
935 Ga0495674_0200993
936 Ga0495680_0032687
937 Ga0495680_0652240
938 Ga0495675_0005251
939 Ga0495602_0006643
940 Ga0495602_0609800
941 Ga0496100_0619231
942 Ga0496102_0187535
943 Ga0496102_0652204
944 Ga0496104_0019218
945 Ga0496104_0022827
946 Ga0496105_0359309
947 Ga0496106_0039372
948 Ga0496107_0114372
949 Ga0496108_0030880
950 Ga0496108_0342611
951 Ga0496109_0186008
952 Ga0496109_0292293
953 Ga0496110_0055734
954 Ga0496110_1095439
955 Ga0496112_0010866
956 Ga0496112_0125368
957 Ga0496112_0303000
958 Ga0496113_0047865
959 Ga0496113_0087262
960 Ga0496114_0039102
961 Ga0496114_0722380
962 Ga0496114_1457804
963 Ga0496115_0502644
964 Ga0496115_0524488
965 Ga0496115_0774467
966 Ga0496119_0005295
967 Ga0496126_0112976
968 Ga0501031_0120355
969 Ga0501031_0260331
970 Ga0501033_0270713
971 Ga0501034_1119838
972 Ga0501036_0031423
973 Ga0501037_0059125
974 Ga0501038_0389131
975 Ga0501038_1354474
976 Ga0501039_0094759
977 Ga0501039_0141131
978 Ga0501041_0235850
979 Ga0501041_0292505
980 Ga0501042_0027698
981 Ga0501042_0331761
982 Ga0501043_0613774
983 Ga0501046_0131185
984 Ga0501046_0133710
985 Ga0501047_0341884
986 Ga0501047_0724033
987 Ga0501048_0342734
988 Ga0501067_0584548
989 Ga0501070_0481738
990 Ga0501071_0061329
991 Ga0501072_0091914
992 Ga0501072_0481077
993 Ga0501072_1133733
994 Ga0501075_0092866
995 Ga0501075_0168045
996 Ga0501076_0085386
997 Ga0501076_0403395
998 Ga0501076_0458628
999 Ga0501261_056122
1000 Ga0501079_0080921
1001 Ga0501079_0236409
1002 Ga0501080_0335729
1003 Ga0501081_0057711
1004 Ga0501081_0317462
1005 Ga0501081_0458881
1006 Ga0501081_0583225
1007 Ga0501083_0132083
1008 Ga0501035_0189244
1009 Ga0501045_0069210
1010 Ga0501045_0094780
1011 Ga0501045_0260989
1012 nmdc:mga0yw44_323206_c1
1013 nmdc:mga0qj67_199932_c1
1014 nmdc:mga0qj67_982960_c1
1015 nmdc:mga06r32_103196_c1
1016 nmdc:mga08y16_1622379_c1
1017 nmdc:mga08y16_248248_c1
1018 nmdc:mga08y16_339814_c1
1019 nmdc:mga08y16_511084_c1
1020 nmdc:mga08y16_976757_c1
1021 nmdc:mga0n895_1492501_c1
1022 nmdc:mga0n895_1871603_c1
1023 Ga0495601_0114777
1024 Ga0495601_0666193
1025 Ga0495601_0771098
1026 Ga0495612_0015872
1027 Ga0495655_0115417
1028 Ga0495595_0009784
1029 Ga0495595_0404789
1030 Ga0495619_0029071
1031 Ga0495619_0476876
1032 Ga0495619_0916874
1033 Ga0500562_073013
1034 Ga0500577_0234424
1035 Ga0500611_143086
1036 Ga0500596_000060
1037 Ga0501084_0013575
1038 Ga0590075_002831
1039 Ga0501082_0259877
1040 Ga0501082_0281907
1041 Ga0501082_0987330
1042 Ga0466962_0022892
1043 Ga0466962_0249553
1044 Ga0530510_0013688
1045 Ga0530510_0149760
1046 Ga0530510_1185694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12903

DUF3830

Protein of unknown function (DUF3830)

37

169

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kop-assembly1.cif.gz_F crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8564 2 137
3kop-assembly1.cif.gz_F crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8448 2 137
3kop-assembly1.cif.gz_B crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8262 1 137
3kop-assembly1.cif.gz_D crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8245 1 137
3kop-assembly1.cif.gz_B crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8207 1 137
ID Description Score Start End Superfamily
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.8394 1 137 2.40.100.20
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.8343 1 137 2.40.100.20
3x27B01 Mainly Beta;Beta Barrel;Cyclophilin; 0.7765 4 136 2.40.100.20
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.7721 3 137 2.40.100.20
3x27B01 Mainly Beta;Beta Barrel;Cyclophilin; 0.7512 4 136 2.40.100.20
ID Description Score Start End GO Terms
AF-A0A4P6JTT2-F1-model_v4 DUF3830 family protein 1.002 1 137
AF-A0A535W1R1-F1-model_v4 DUF3830 family protein 1.002 1 137
AF-A0A3D2J1F8-F1-model_v4 DUF3830 domain-containing protein 1.001 2 137
AF-A0A7W1TKA6-F1-model_v4 DUF3830 family protein 1.001 2 137 GO:0005506
GO:0016491
AF-A0A1P8JRC8-F1-model_v4 Cyclophilin-like superfamily protein 1 1 137

Map