F459040

General Info

Members Datasets Scaffolds Average Seq Length
523 275 1046 121

Family's Representative Sequence

Representative Sequence 3300047315|Ga0495581_0609847|Ga0495581_0609847_247_615
Length 122
Sequence LNLRIDLSWLLMVAEHKTPGDPQVDWGALVAAVARHEAEIFGSAVYSDPYSRAAALLQLLLHVPALEHSNAMFASAVAYGYLVASGLKVITSAEQVRDLARLVKEGKADVRAIADELRQWSL

Samples

Sample ID Description Type Environment
1 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
57 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
60 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
61 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
64 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
67 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
70 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
71 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
72 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
73 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
74 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
75 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
76 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
77 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
78 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
79 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
215 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
218 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
228 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
229 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
230 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
231 2643221548 Streptomyces sp. Root55 Isolate Unclassified
232 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
233 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
234 2643221714 Streptomyces sp. Root264 Isolate Unclassified
235 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
236 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
237 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
238 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
239 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
240 2808606448 Streptomyces sp. 193411 Isolate Unclassified
241 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
242 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
243 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
244 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
245 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
246 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
247 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
248 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
249 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
250 2867369537 Streptomyces sp. Z26 Isolate Unclassified
251 2867475112 Streptomyces sp. TM32 Isolate Unclassified
252 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
253 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
254 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
255 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
256 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
257 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
258 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
259 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
260 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
261 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
262 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
263 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
264 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
265 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
266 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
267 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
268 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
269 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
270 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
271 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
272 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
273 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
274 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
275 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.48
Metatranscriptomes 1.15
Isolates 9.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 0.38
Rhizoplane 1.15
Rhizosphere 81.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495581_0609847 3300047315 Bacteria 632
2 JGI24739J22299_10049492 3300001989 Bacteria 1363
3 JGI24737J22298_10073903 3300001990 Bacteria 1017
4 JGI24735J21928_10044658 3300002067 Bacteria 1287
5 JGI24738J21930_10010809 3300002075 Bacteria 2022
6 JGI25153J46596_10127273 3300003215 Bacteria 567
7 rootH2_10027383 3300003320 Bacteria 4356
8 rootH1_10123038 3300003323 Bacteria 1730
9 JGI25160J50197_1039491 3300003354 Bacteria 1104
10 Ga0006562J51391_1091030 3300003578 Bacteria 2179
11 Ga0006562J51391_1091031 3300003578 Bacteria 1440
12 Ga0070706_101461227 3300005467 Bacteria 625
13 Ga0068853_100061741 3300005539 Bacteria 3242
14 Ga0070665_100073243 3300005548 Bacteria 3432
15 Ga0068854_100888419 3300005578 Bacteria 782
16 Ga0075363_100024547 3300006048 Bacteria 3066
17 Ga0075363_100129798 3300006048 Bacteria 1413
18 Ga0075367_10521484 3300006178 Bacteria 754
19 Ga0075370_10044119 3300006353 Bacteria 2521
20 Ga0075370_10291932 3300006353 Bacteria 969
21 Ga0105251_10101939 3300009011 Bacteria 1312
22 Ga0105250_10232150 3300009092 Bacteria 785
23 Ga0105238_10128532 3300009551 Bacteria 2512
24 Ga0105239_11017403 3300010375 Bacteria 953
25 Ga0105246_10147630 3300011119 Bacteria 1776
26 Ga0157375_11965115 3300013308 Bacteria 695
27 Ga0183367_1003 3300015688 Bacteria 814276
28 Ga0206350_10146675 3300020080 Bacteria 831
29 Ga0154015_1113076 3300020610 Bacteria 620
30 Ga0209758_1017010 3300025297 Bacteria 3652
31 Ga0207426_1002017 3300025302 Bacteria 14333
32 Ga0207426_1002125 3300025302 Bacteria 13570
33 Ga0207426_1002278 3300025302 Bacteria 12662
34 Ga0207426_1014546 3300025302 Bacteria 2879
35 Ga0207696_1215152 3300025711 Bacteria 503
36 Ga0207647_10021225 3300025904 Bacteria 4338
37 Ga0207709_10373011 3300025935 Bacteria 1083
38 Ga0207640_10705105 3300025981 Bacteria 866
39 Ga0207639_10194714 3300026041 Bacteria 1734
40 Ga0207698_11614360 3300026142 Bacteria 664
41 Ga0209371_1052402 3300027312 Bacteria 778
42 Ga0268266_10149629 3300028379 Bacteria 2103
43 Ga0307517_10023551 3300028786 Bacteria 7645
44 Ga0307515_10005754 3300028794 Bacteria 25051
45 Ga0307515_10150737 3300028794 Bacteria 2432
46 Ga0307511_10014403 3300030521 Bacteria 7700
47 Ga0307511_10035691 3300030521 Bacteria 4337
48 Ga0307511_10199277 3300030521 Bacteria 1043
49 Ga0307512_10002929 3300030522 Bacteria 20641
50 Ga0307512_10264944 3300030522 Bacteria 839
51 Ga0307512_10397680 3300030522 Bacteria 580
52 Ga0307513_10038660 3300031456 Bacteria 5297
53 Ga0307513_10143100 3300031456 Bacteria 2314
54 Ga0307509_10010609 3300031507 Bacteria 11257
55 Ga0307509_10056864 3300031507 Bacteria 4150
56 Ga0307509_10155993 3300031507 Bacteria 2189
57 Ga0307508_10016762 3300031616 Bacteria 6666
58 Ga0307508_10041124 3300031616 Bacteria 4149
59 Ga0307508_10057229 3300031616 Bacteria 3450
60 Ga0307508_10201610 3300031616 Bacteria 1590
61 Ga0307514_10104566 3300031649 Bacteria 2024
62 Ga0307514_10200442 3300031649 Bacteria 1255
63 Ga0307514_10202193 3300031649 Bacteria 1246
64 Ga0307514_10265354 3300031649 Bacteria 1000
65 Ga0307516_10004873 3300031730 Bacteria 16350
66 Ga0307516_10008353 3300031730 Bacteria 11732
67 Ga0307413_10955069 3300031824 Bacteria 732
68 Ga0307518_10024234 3300031838 Bacteria 4376
69 Ga0307518_10033437 3300031838 Bacteria 3730
70 Ga0307518_10052341 3300031838 Bacteria 2966
71 Ga0307518_10150891 3300031838 Bacteria 1608
72 Ga0307410_10318651 3300031852 Bacteria 1233
73 Ga0307410_10437341 3300031852 Bacteria 1064
74 Ga0307416_100348110 3300032002 Bacteria 1498
75 Ga0307411_10424056 3300032005 Bacteria 1106
76 Ga0307411_10535208 3300032005 Bacteria 997
77 Ga0307507_10033128 3300033179 Bacteria 5371
78 Ga0307507_10104343 3300033179 Bacteria 2353
79 Ga0307507_10192660 3300033179 Bacteria 1429
80 Ga0307510_10114569 3300033180 Bacteria 2424
81 Ga0307510_10196597 3300033180 Bacteria 1557
82 Ga0307510_10234389 3300033180 Bacteria 1335
83 Ga0307510_10464921 3300033180 Bacteria 706
84 Ga0395900_0387957 3300037418 Bacteria 1363
85 Ga0395898_0026940 3300037466 Bacteria 5776
86 Ga0395898_0040078 3300037466 Bacteria 4634
87 Ga0395901_0239154 3300038443 Bacteria 1894
88 Ga0395901_0694682 3300038443 Bacteria 1016
89 Ga0439436_0009907 3300041404 Bacteria 2914
90 Ga0439439_0044251 3300041406 Bacteria 1159
91 Ga0451793_0522410 3300041452 Bacteria 640
92 Ga0451795_1540716 3300041456 Bacteria 830
93 Ga0451807_2752245 3300041486 Bacteria 648
94 Ga0451851_0431015 3300041507 Bacteria 751
95 Ga0451853_1913544 3300041512 Bacteria 1697
96 Ga0451853_2032809 3300041512 Bacteria 1638
97 Ga0451853_2381442 3300041512 Bacteria 7823
98 Ga0439442_006505 3300042002 Bacteria 2347
99 Ga0439442_020028 3300042002 Bacteria 1386
100 Ga0439445_0192163 3300042004 Bacteria 601
101 Ga0439448_0005546 3300042005 Bacteria 3600
102 Ga0439448_0068391 3300042005 Bacteria 1181
103 Ga0439449_0005506 3300042007 Bacteria 4846
104 Ga0439449_0049257 3300042007 Bacteria 1559
105 Ga0439449_0065133 3300042007 Bacteria 1344
106 Ga0439449_0084298 3300042007 Bacteria 1172
107 Ga0439457_002121 3300042014 Bacteria 5771
108 Ga0439457_006584 3300042014 Bacteria 2836
109 Ga0439462_0038842 3300042015 Bacteria 1268
110 Ga0450920_032048 3300042122 Bacteria 1037
111 Ga0450890_012173 3300042127 Bacteria 1115
112 Ga0450897_023848 3300042128 Bacteria 668
113 Ga0450894_002730 3300042131 Bacteria 2337
114 Ga0450896_000189 3300042133 Bacteria 5279
115 Ga0450898_000450 3300042134 Bacteria 4788
116 Ga0450899_000411 3300042135 Bacteria 4770
117 Ga0450903_000071 3300042138 Bacteria 20404
118 Ga0450906_003012 3300042145 Bacteria 3657
119 Ga0439458_0000542 3300042157 Bacteria 9700
120 Ga0439458_0121880 3300042157 Bacteria 687
121 Ga0450908_001630 3300042184 Bacteria 4366
122 Ga0466969_0058159 3300044656 Bacteria 1883
123 Ga0466972_0006966 3300044658 Bacteria 5668
124 Ga0466972_0011171 3300044658 Bacteria 4506
125 Ga0466972_0017446 3300044658 Bacteria 3593
126 Ga0466972_0090235 3300044658 Bacteria 1454
127 Ga0466965_0000261 3300044683 Bacteria 17138
128 Ga0466965_0041775 3300044683 Bacteria 2260
129 Ga0466965_0057159 3300044683 Bacteria 1944
130 Ga0466966_0011697 3300044684 Bacteria 5817
131 Ga0466961_0001765 3300044693 Bacteria 13416
132 Ga0466961_0003700 3300044693 Bacteria 9550
133 Ga0466961_0032579 3300044693 Bacteria 3350
134 Ga0466963_0011320 3300044694 Bacteria 5428
135 Ga0466963_0124966 3300044694 Bacteria 1773
136 Ga0466964_0382083 3300044706 Bacteria 731
137 Ga0466971_0030470 3300044719 Bacteria 2414
138 Ga0466971_0056408 3300044719 Bacteria 1772
139 Ga0466968_0027361 3300044735 Bacteria 2347
140 Ga0466968_0165188 3300044735 Bacteria 1023
141 Ga0466968_0479549 3300044735 Bacteria 618
142 Ga0466970_0001360 3300044765 Bacteria 11791
143 Ga0466970_0141136 3300044765 Bacteria 1327
144 Ga0466957_0002728 3300044842 Bacteria 9550
145 Ga0466960_0093819 3300044901 Bacteria 1534
146 Ga0466959_0003655 3300045049 Bacteria 10146
147 Ga0466959_0246070 3300045049 Bacteria 1234
148 Ga0466958_0000240 3300045836 Bacteria 21068
149 Ga0466958_0339644 3300045836 Bacteria 966
150 Ga0466967_0003331 3300045976 Bacteria 10438
151 Ga0466967_0026728 3300045976 Bacteria 4787
152 Ga0466967_0244447 3300045976 Bacteria 1712
153 Ga0466967_1003411 3300045976 Bacteria 831
154 Ga0495592_0023782 3300046454 Bacteria 4660
155 Ga0495592_0089634 3300046454 Bacteria 2208
156 Ga0495603_0001264 3300046455 Bacteria 14738
157 Ga0495603_0002283 3300046455 Bacteria 11266
158 Ga0495603_0011028 3300046455 Bacteria 5479
159 Ga0495603_0069867 3300046455 Bacteria 2065
160 Ga0495603_0194443 3300046455 Bacteria 1172
161 Ga0495603_0225222 3300046455 Bacteria 1081
162 Ga0495603_0227521 3300046455 Bacteria 1075
163 Ga0495603_0271498 3300046455 Bacteria 975
164 Ga0495629_0002718 3300046459 Bacteria 13535
165 Ga0495629_0004593 3300046459 Bacteria 10334
166 Ga0495629_0008683 3300046459 Bacteria 7481
167 Ga0495629_0015023 3300046459 Bacteria 5565
168 Ga0495629_0035726 3300046459 Bacteria 3511
169 Ga0495629_0125317 3300046459 Bacteria 1789
170 Ga0495629_0130040 3300046459 Bacteria 1754
171 Ga0495638_0191472 3300046460 Bacteria 1160
172 Ga0495651_0001712 3300046462 Bacteria 16952
173 Ga0495651_0104644 3300046462 Bacteria 2101
174 Ga0495651_0122812 3300046462 Bacteria 1905
175 Ga0495653_0215554 3300046463 Bacteria 1294
176 Ga0495582_0148966 3300046473 Bacteria 1328
177 Ga0495605_0014678 3300046474 Bacteria 4282
178 Ga0495605_0094643 3300046474 Bacteria 1380
179 Ga0495639_0001505 3300046475 Bacteria 10391
180 Ga0495639_0604357 3300046475 Bacteria 564
181 Ga0495662_0001848 3300046476 Bacteria 10610
182 Ga0495662_0013645 3300046476 Bacteria 3956
183 Ga0495662_0112812 3300046476 Bacteria 1332
184 Ga0495662_0225673 3300046476 Bacteria 923
185 Ga0495664_0003026 3300046477 Bacteria 9103
186 Ga0495664_0117373 3300046477 Bacteria 1609
187 Ga0495664_0582711 3300046477 Bacteria 665
188 Ga0495584_0035051 3300046491 Bacteria 2537
189 Ga0495585_0005128 3300046492 Bacteria 8333
190 Ga0495585_0095262 3300046492 Bacteria 1599
191 Ga0495594_0002923 3300046499 Bacteria 8877
192 Ga0495594_0004049 3300046499 Bacteria 7532
193 Ga0495594_0023118 3300046499 Bacteria 3329
194 Ga0495594_0037713 3300046499 Bacteria 2637
195 Ga0495594_0082036 3300046499 Bacteria 1801
196 Ga0495594_0205904 3300046499 Bacteria 1121
197 Ga0495596_0372227 3300046500 Bacteria 556
198 Ga0495607_0023993 3300046501 Bacteria 3809
199 Ga0495607_0048265 3300046501 Bacteria 2490
200 Ga0495583_0054256 3300046506 Bacteria 1815
201 Ga0495583_0401532 3300046506 Bacteria 538
202 Ga0495606_0005990 3300046507 Bacteria 11397
203 Ga0495608_0075162 3300046511 Bacteria 2202
204 Ga0495610_0026633 3300046512 Bacteria 3085
205 Ga0495616_0002310 3300046513 Bacteria 12756
206 Ga0495618_0050770 3300046514 Bacteria 2621
207 Ga0495618_0135949 3300046514 Bacteria 1572
208 Ga0495628_0037067 3300046516 Bacteria 3910
209 Ga0495628_0040797 3300046516 Bacteria 3707
210 Ga0495628_0105141 3300046516 Bacteria 2175
211 Ga0495630_0062470 3300046517 Bacteria 2798
212 Ga0495630_0428885 3300046517 Bacteria 1013
213 Ga0495630_0737226 3300046517 Bacteria 753
214 Ga0495631_0005413 3300046518 Bacteria 6679
215 Ga0495632_0266658 3300046519 Bacteria 765
216 Ga0495643_0001589 3300046522 Bacteria 20162
217 Ga0495648_0246224 3300046524 Bacteria 865
218 Ga0495666_0039637 3300046526 Bacteria 2286
219 Ga0495642_0020632 3300046528 Bacteria 2590
220 Ga0495652_0014326 3300046529 Bacteria 7120
221 Ga0495652_0051439 3300046529 Bacteria 3518
222 Ga0495652_0177342 3300046529 Bacteria 1639
223 Ga0495652_0526403 3300046529 Bacteria 816
224 Ga0495640_0005916 3300046533 Bacteria 9700
225 Ga0495640_0008555 3300046533 Bacteria 8023
226 Ga0495640_0019064 3300046533 Bacteria 5072
227 Ga0495640_0194333 3300046533 Bacteria 1289
228 Ga0495586_0030366 3300046535 Bacteria 2892
229 Ga0495586_0456949 3300046535 Bacteria 736
230 Ga0495587_0033341 3300046536 Bacteria 3109
231 Ga0495609_0026191 3300046538 Bacteria 2670
232 Ga0495597_0110199 3300046542 Bacteria 1154
233 Ga0495645_0096586 3300046543 Bacteria 2105
234 Ga0495645_0348203 3300046543 Bacteria 955
235 Ga0495622_0002962 3300046557 Bacteria 8080
236 Ga0495622_0029596 3300046557 Bacteria 2559
237 Ga0495622_0190183 3300046557 Bacteria 918
238 Ga0495633_0022648 3300046558 Bacteria 3122
239 Ga0495633_0121821 3300046558 Bacteria 1208
240 Ga0495667_0056862 3300046559 Bacteria 2572
241 Ga0495667_0121623 3300046559 Bacteria 1685
242 Ga0495656_0102096 3300046615 Bacteria 1328
243 Ga0495656_0222203 3300046615 Bacteria 945
244 Ga0495634_0002188 3300046642 Bacteria 16423
245 Ga0495634_0004602 3300046642 Bacteria 10774
246 Ga0495611_0030020 3300046648 Bacteria 2388
247 Ga0495625_0022185 3300046660 Bacteria 4871
248 Ga0495625_0025533 3300046660 Bacteria 4479
249 Ga0495625_0026041 3300046660 Bacteria 4424
250 Ga0495625_0235378 3300046660 Bacteria 1194
251 Ga0495635_0001162 3300046663 Bacteria 17568
252 Ga0495635_0021180 3300046663 Bacteria 4531
253 Ga0495635_0119958 3300046663 Bacteria 1794
254 Ga0495661_0036126 3300046665 Bacteria 3096
255 Ga0495588_0008008 3300046674 Bacteria 4830
256 Ga0495588_0009468 3300046674 Bacteria 4503
257 Ga0495588_0053334 3300046674 Bacteria 2085
258 Ga0495588_0160823 3300046674 Bacteria 1188
259 Ga0495588_0378564 3300046674 Bacteria 743
260 Ga0495588_0445615 3300046674 Bacteria 679
261 Ga0495657_0000283 3300046675 Bacteria 45961
262 Ga0495657_0005957 3300046675 Bacteria 9577
263 Ga0495657_0015209 3300046675 Bacteria 5635
264 Ga0495657_0039527 3300046675 Bacteria 3240
265 Ga0495599_0151614 3300046678 Bacteria 1435
266 Ga0495623_0038956 3300046679 Bacteria 3039
267 Ga0495646_0001097 3300046680 Bacteria 15738
268 Ga0495647_0417305 3300046681 Bacteria 618
269 Ga0495658_0025200 3300046683 Bacteria 3177
270 Ga0495613_0000322 3300046689 Bacteria 43462
271 Ga0495613_0002209 3300046689 Bacteria 14739
272 Ga0495613_0002503 3300046689 Bacteria 13859
273 Ga0495613_0004316 3300046689 Bacteria 10645
274 Ga0495613_0012215 3300046689 Bacteria 6381
275 Ga0495613_0023508 3300046689 Bacteria 4591
276 Ga0495613_0099643 3300046689 Bacteria 2099
277 Ga0495624_0038590 3300046690 Bacteria 3068
278 Ga0495670_0068121 3300046691 Bacteria 1798
279 Ga0495670_0134311 3300046691 Bacteria 1291
280 Ga0495671_0012941 3300046692 Bacteria 4540
281 Ga0495671_0116890 3300046692 Bacteria 1302
282 Ga0495671_0173843 3300046692 Bacteria 1047
283 Ga0495649_0026830 3300046694 Bacteria 3199
284 Ga0495589_0022493 3300046794 Bacteria 3217
285 Ga0495589_0029584 3300046794 Bacteria 2762
286 Ga0495600_0063744 3300046809 Bacteria 2408
287 Ga0495600_0147549 3300046809 Bacteria 1524
288 Ga0495600_0237057 3300046809 Bacteria 1163
289 Ga0495581_0007961 3300047315 Bacteria 6140
290 Ga0495581_0042488 3300047315 Bacteria 2631
291 Ga0495581_0089499 3300047315 Bacteria 1785
292 Ga0495581_0235455 3300047315 Bacteria 1071
293 Ga0495604_0021247 3300047317 Bacteria 5181
294 Ga0495604_0040360 3300047317 Bacteria 3665
295 Ga0495604_0062664 3300047317 Bacteria 2839
296 Ga0495604_0072067 3300047317 Bacteria 2612
297 Ga0495604_0265005 3300047317 Bacteria 1166
298 Ga0495636_0006490 3300047318 Bacteria 4596
299 Ga0495636_0021767 3300047318 Bacteria 2590
300 Ga0495636_0033374 3300047318 Bacteria 2114
301 Ga0495636_0042357 3300047318 Bacteria 1891
302 Ga0495636_0102830 3300047318 Bacteria 1251
303 Ga0495674_0148314 3300047319 Bacteria 1968
304 Ga0495674_0361937 3300047319 Bacteria 1176
305 Ga0495672_0072100 3300047320 Bacteria 1952
306 Ga0495676_0001163 3300047321 Bacteria 22412
307 Ga0495676_0001475 3300047321 Bacteria 20305
308 Ga0495676_0006543 3300047321 Bacteria 10737
309 Ga0495676_0009368 3300047321 Bacteria 8920
310 Ga0495676_0060665 3300047321 Bacteria 2962
311 Ga0495676_0156288 3300047321 Bacteria 1617
312 Ga0495676_0227998 3300047321 Bacteria 1280
313 Ga0495680_0056287 3300047322 Bacteria 3045
314 Ga0495683_0097131 3300047323 Bacteria 1420
315 Ga0495687_000668 3300047443 Bacteria 39207
316 Ga0495687_001421 3300047443 Bacteria 22043
317 Ga0495687_038505 3300047443 Bacteria 2121
318 Ga0495675_0058772 3300047444 Bacteria 2438
319 Ga0495675_0071923 3300047444 Bacteria 2182
320 Ga0495677_0065809 3300047445 Bacteria 1347
321 Ga0495685_040640 3300047447 Bacteria 1590
322 Ga0495685_050825 3300047447 Bacteria 1406
323 Ga0495681_0003993 3300047470 Bacteria 10154
324 Ga0495681_0024803 3300047470 Bacteria 3148
325 Ga0495686_0028236 3300047472 Bacteria 3654
326 Ga0495686_0281690 3300047472 Bacteria 924
327 Ga0495593_0003182 3300047673 Bacteria 9858
328 Ga0495593_0047169 3300047673 Bacteria 2292
329 Ga0495593_0061981 3300047673 Bacteria 1955
330 Ga0495602_0036802 3300048088 Bacteria 4550
331 Ga0495602_0088224 3300048088 Bacteria 2583
332 Ga0495614_0002494 3300048089 Bacteria 8175
333 Ga0495614_0003265 3300048089 Bacteria 7244
334 Ga0495614_0014278 3300048089 Bacteria 3479
335 Ga0495614_0062874 3300048089 Bacteria 1595
336 Ga0495614_0082108 3300048089 Bacteria 1397
337 Ga0495614_0590970 3300048089 Bacteria 533
338 Ga0495615_0202032 3300048090 Bacteria 614
339 Ga0495626_0068330 3300048091 Bacteria 1602
340 Ga0496109_0163116 3300048912 Bacteria 2088
341 Ga0496110_0656692 3300048913 Bacteria 949
342 Ga0496115_0963487 3300048918 Bacteria 654
343 Ga0501306_064643 3300049127 Bacteria 608
344 Ga0501031_0009611 3300049568 Bacteria 6296
345 Ga0501031_0033790 3300049568 Bacteria 3338
346 Ga0501031_0212499 3300049568 Bacteria 1260
347 Ga0501031_0313462 3300049568 Bacteria 1016
348 Ga0501032_0000859 3300049569 Bacteria 24673
349 Ga0501032_0039827 3300049569 Bacteria 3195
350 Ga0501032_0057504 3300049569 Bacteria 2613
351 Ga0501032_0173309 3300049569 Bacteria 1414
352 Ga0501032_0341799 3300049569 Bacteria 964
353 Ga0501032_0468234 3300049569 Bacteria 806
354 Ga0501033_0018999 3300049570 Bacteria 5195
355 Ga0501033_0020968 3300049570 Bacteria 4934
356 Ga0501033_0046569 3300049570 Bacteria 3224
357 Ga0501033_0048684 3300049570 Bacteria 3147
358 Ga0501033_0072977 3300049570 Bacteria 2519
359 Ga0501033_0191550 3300049570 Bacteria 1463
360 Ga0501033_0238747 3300049570 Bacteria 1289
361 Ga0501034_0011784 3300049571 Bacteria 9048
362 Ga0501034_0041278 3300049571 Bacteria 4667
363 Ga0501034_0042539 3300049571 Bacteria 4599
364 Ga0501034_0144105 3300049571 Bacteria 2360
365 Ga0501034_0150601 3300049571 Bacteria 2302
366 Ga0501034_0434410 3300049571 Bacteria 1232
367 Ga0501036_0001999 3300049572 Bacteria 15844
368 Ga0501036_0010162 3300049572 Bacteria 7756
369 Ga0501036_0013575 3300049572 Bacteria 6770
370 Ga0501036_0031796 3300049572 Bacteria 4459
371 Ga0501036_0060180 3300049572 Bacteria 3217
372 Ga0501036_0133978 3300049572 Bacteria 2091
373 Ga0501037_0000829 3300049573 Bacteria 23083
374 Ga0501037_0001735 3300049573 Bacteria 15823
375 Ga0501037_0254223 3300049573 Bacteria 1229
376 Ga0501038_0000639 3300049574 Bacteria 31108
377 Ga0501038_0035878 3300049574 Bacteria 4352
378 Ga0501038_0051336 3300049574 Bacteria 3559
379 Ga0501038_0130931 3300049574 Bacteria 2060
380 Ga0501039_0090465 3300049575 Bacteria 2385
381 Ga0501039_1034722 3300049575 Bacteria 637
382 Ga0501041_0000324 3300049577 Bacteria 23255
383 Ga0501042_0002035 3300049578 Bacteria 12252
384 Ga0501042_0012898 3300049578 Bacteria 5676
385 Ga0501043_0009370 3300049579 Bacteria 7690
386 Ga0501043_0017014 3300049579 Bacteria 5700
387 Ga0501043_0026184 3300049579 Bacteria 4575
388 Ga0501043_0062655 3300049579 Bacteria 2920
389 Ga0501043_0604069 3300049579 Bacteria 810
390 Ga0501046_0007160 3300049580 Bacteria 9814
391 Ga0501046_0011680 3300049580 Bacteria 7506
392 Ga0501046_0071063 3300049580 Bacteria 2705
393 Ga0501046_0202892 3300049580 Bacteria 1475
394 Ga0501047_0001294 3300049581 Bacteria 24700
395 Ga0501047_0010245 3300049581 Bacteria 8867
396 Ga0501047_0015688 3300049581 Bacteria 7218
397 Ga0501047_0039162 3300049581 Bacteria 4585
398 Ga0501047_0055944 3300049581 Bacteria 3814
399 Ga0501047_0103110 3300049581 Bacteria 2732
400 Ga0501047_0176912 3300049581 Bacteria 2001
401 Ga0501047_0247165 3300049581 Bacteria 1633
402 Ga0501047_1338106 3300049581 Bacteria 531
403 Ga0501048_0006306 3300049582 Bacteria 9015
404 Ga0501048_0053377 3300049582 Bacteria 2874
405 Ga0501067_0010227 3300049583 Bacteria 5189
406 Ga0501068_0000686 3300049584 Bacteria 17319
407 Ga0501068_0531340 3300049584 Bacteria 764
408 Ga0501069_0404960 3300049585 Bacteria 807
409 Ga0501070_0124918 3300049586 Bacteria 2126
410 Ga0501070_0428527 3300049586 Bacteria 1068
411 Ga0501070_0440524 3300049586 Bacteria 1051
412 Ga0501070_0871885 3300049586 Bacteria 703
413 Ga0501071_0000976 3300049587 Bacteria 15635
414 Ga0501072_0000664 3300049588 Bacteria 24821
415 Ga0501072_0832411 3300049588 Bacteria 722
416 Ga0501073_0345904 3300049589 Bacteria 1026
417 Ga0501073_0958875 3300049589 Bacteria 589
418 Ga0501073_0986649 3300049589 Bacteria 580
419 Ga0501073_1218642 3300049589 Bacteria 516
420 Ga0501074_0072883 3300049590 Bacteria 2466
421 Ga0501074_0092063 3300049590 Bacteria 2171
422 Ga0501076_0041921 3300049592 Bacteria 3604
423 Ga0501077_0020667 3300049593 Bacteria 4168
424 Ga0501216_118500 3300049660 Bacteria 602
425 Ga0501235_014374 3300049669 Bacteria 1745
426 Ga0501079_0011231 3300049741 Bacteria 6830
427 Ga0501080_0046790 3300049742 Bacteria 4027
428 Ga0501080_0824608 3300049742 Bacteria 812
429 Ga0501080_1360706 3300049742 Bacteria 607
430 Ga0501083_0016263 3300049744 Bacteria 5209
431 Ga0501282_015602 3300049778 Bacteria 825
432 Ga0501035_0001216 3300049822 Bacteria 26831
433 Ga0501035_0004750 3300049822 Bacteria 12897
434 Ga0501035_0018783 3300049822 Bacteria 6367
435 Ga0501035_0025832 3300049822 Bacteria 5381
436 Ga0501035_0037208 3300049822 Bacteria 4408
437 Ga0501035_0075448 3300049822 Bacteria 2982
438 Ga0501035_0093980 3300049822 Bacteria 2637
439 Ga0501035_0096182 3300049822 Bacteria 2602
440 Ga0501035_0119436 3300049822 Bacteria 2305
441 Ga0501035_0872405 3300049822 Bacteria 714
442 Ga0501044_0001566 3300049823 Bacteria 26801
443 Ga0501044_0016802 3300049823 Bacteria 7853
444 Ga0501044_0082432 3300049823 Bacteria 3254
445 Ga0501044_0175774 3300049823 Bacteria 2110
446 Ga0501044_0178532 3300049823 Bacteria 2091
447 Ga0501044_0207943 3300049823 Bacteria 1912
448 Ga0501044_0292855 3300049823 Bacteria 1559
449 Ga0501044_0388109 3300049823 Bacteria 1310
450 Ga0501044_0770484 3300049823 Bacteria 843
451 Ga0501044_1439595 3300049823 Bacteria 554
452 Ga0501045_0076291 3300049824 Bacteria 2469
453 Ga0501045_0120916 3300049824 Bacteria 1945
454 Ga0501045_0125153 3300049824 Bacteria 1909
455 Ga0501045_0181375 3300049824 Bacteria 1569
456 nmdc:mga03n38_30531_c1 3300050490 Bacteria 2267
457 nmdc:mga06z11_576621_c1 3300050494 Bacteria 684
458 nmdc:mga07m45_27864_c1 3300050496 Bacteria 3116
459 nmdc:mga07m45_280658_c1 3300050496 Bacteria 969
460 Ga0495601_0049692 3300053077 Bacteria 2645
461 Ga0500583_0062429 3300053092 Bacteria 1762
462 Ga0500640_000272 3300053095 Bacteria 11458
463 Ga0500650_0095872 3300053098 Bacteria 1389
464 Ga0500660_205165 3300053100 Bacteria 672
465 Ga0500560_006433 3300053107 Bacteria 2688
466 Ga0500559_0206738 3300053136 Bacteria 926
467 Ga0500600_0061522 3300053149 Bacteria 2091
468 Ga0500636_0094404 3300053177 Bacteria 1709
469 Ga0501084_0111614 3300054114 Bacteria 2297
470 Ga0587111_0270492 3300060346 Bacteria 510
471 Ga0501082_0003556 3300060353 Bacteria 13608
472 Ga0466962_0013625 3300061719 Bacteria 3913
473 Ga0466962_0163148 3300061719 Bacteria 1083
474 Ga0530510_0146029 3300061734 Bacteria 1744
475 2547409115 2547132111 Bacteria 8013147
476 2585297749 2582581312 Bacteria 7308206
477 2585315933 2582581314 Bacteria 11452267
478 2616902734 2616644941 Bacteria 8510691
479 2643764436 2643221548 Bacteria 8053412
480 2644438287 2643221678 Bacteria 9540101
481 2644458505 2643221682 Bacteria 6743283
482 2644630043 2643221714 Bacteria 9015452
483 2784586507 2784132148 Bacteria 8627943
484 2785345999 2784746763 Bacteria 9783172
485 2785366909 2784746768 Bacteria 10036182
486 2786667945 2786546132 Bacteria 10419719
487 2808847408 2808606359 Bacteria 9866990
488 2809230019 2808606448 Bacteria 8656184
489 2811846753 2808606982 Bacteria 7791042
490 2812360559 2811994879 Bacteria 9313447
491 2812482630 2811994917 Bacteria 7761064
492 2819699326 2818991463 Bacteria 7948711
493 2852641383 2852635781 Bacteria 8251373
494 2862289960 2862281513 Bacteria 9621493
495 2862386313 2862382967 Bacteria 10317375
496 2862516195 2862507626 Bacteria 9425308
497 2863407263 2863404153 Bacteria 9672205
498 2867369628 2867369537 Bacteria 6501581
499 2867481352 2867475112 Bacteria 6909112
500 2873158194 2873151551 Bacteria 8625867
501 2877683633 2877676314 Bacteria 9512378
502 2912722920 2912715099 Bacteria 9460473
503 2912726417 2912723979 Bacteria 8557534
504 2919474366 2919468124 Bacteria 9133025
505 2946052255 2946045630 Bacteria 8527308
506 2946065327 2946064051 Bacteria 8957905
507 2946073694 2946072368 Bacteria 8999607
508 2947232119 2947224130 Bacteria 9938529
509 2954008760 2954002825 Bacteria 9173742
510 2954674231 2954673503 Bacteria 9685905
511 2954689901 2954682443 Bacteria 9862841
512 2966604666 2966598605 Bacteria 7676064
513 2990063558 2990059506 Bacteria 9321252
514 2990091824 2990088156 Bacteria 6657676
515 3006324476 3006321560 Bacteria 8247479
516 3006497138 3006493962 Bacteria 8825450
517 8008560993 8008558824 Bacteria 10610750
518 8008581025 8008574985 Bacteria 7815457
519 8023628636 8023623736 Bacteria 8593882
520 8025535976 8025530807 Bacteria 8495698
521 8048412955 8048406513 Bacteria 8936924
522 8054164263 8054160619 Bacteria 7783213
523 8056832570 8056829672 Bacteria 9045328
524 Ga0495581_0609847
525 JGI24739J22299_10049492
526 JGI24737J22298_10073903
527 JGI24735J21928_10044658
528 JGI24738J21930_10010809
529 JGI25153J46596_10127273
530 rootH2_10027383
531 rootH1_10123038
532 JGI25160J50197_1039491
533 Ga0006562J51391_1091030
534 Ga0006562J51391_1091031
535 Ga0070706_101461227
536 Ga0068853_100061741
537 Ga0070665_100073243
538 Ga0068854_100888419
539 Ga0075363_100024547
540 Ga0075363_100129798
541 Ga0075367_10521484
542 Ga0075370_10044119
543 Ga0075370_10291932
544 Ga0105251_10101939
545 Ga0105250_10232150
546 Ga0105238_10128532
547 Ga0105239_11017403
548 Ga0105246_10147630
549 Ga0157375_11965115
550 Ga0183367_1003
551 Ga0206350_10146675
552 Ga0154015_1113076
553 Ga0209758_1017010
554 Ga0207426_1002017
555 Ga0207426_1002125
556 Ga0207426_1002278
557 Ga0207426_1014546
558 Ga0207696_1215152
559 Ga0207647_10021225
560 Ga0207709_10373011
561 Ga0207640_10705105
562 Ga0207639_10194714
563 Ga0207698_11614360
564 Ga0209371_1052402
565 Ga0268266_10149629
566 Ga0307517_10023551
567 Ga0307515_10005754
568 Ga0307515_10150737
569 Ga0307511_10014403
570 Ga0307511_10035691
571 Ga0307511_10199277
572 Ga0307512_10002929
573 Ga0307512_10264944
574 Ga0307512_10397680
575 Ga0307513_10038660
576 Ga0307513_10143100
577 Ga0307509_10010609
578 Ga0307509_10056864
579 Ga0307509_10155993
580 Ga0307508_10016762
581 Ga0307508_10041124
582 Ga0307508_10057229
583 Ga0307508_10201610
584 Ga0307514_10104566
585 Ga0307514_10200442
586 Ga0307514_10202193
587 Ga0307514_10265354
588 Ga0307516_10004873
589 Ga0307516_10008353
590 Ga0307413_10955069
591 Ga0307518_10024234
592 Ga0307518_10033437
593 Ga0307518_10052341
594 Ga0307518_10150891
595 Ga0307410_10318651
596 Ga0307410_10437341
597 Ga0307416_100348110
598 Ga0307411_10424056
599 Ga0307411_10535208
600 Ga0307507_10033128
601 Ga0307507_10104343
602 Ga0307507_10192660
603 Ga0307510_10114569
604 Ga0307510_10196597
605 Ga0307510_10234389
606 Ga0307510_10464921
607 Ga0395900_0387957
608 Ga0395898_0026940
609 Ga0395898_0040078
610 Ga0395901_0239154
611 Ga0395901_0694682
612 Ga0439436_0009907
613 Ga0439439_0044251
614 Ga0451793_0522410
615 Ga0451795_1540716
616 Ga0451807_2752245
617 Ga0451851_0431015
618 Ga0451853_1913544
619 Ga0451853_2032809
620 Ga0451853_2381442
621 Ga0439442_006505
622 Ga0439442_020028
623 Ga0439445_0192163
624 Ga0439448_0005546
625 Ga0439448_0068391
626 Ga0439449_0005506
627 Ga0439449_0049257
628 Ga0439449_0065133
629 Ga0439449_0084298
630 Ga0439457_002121
631 Ga0439457_006584
632 Ga0439462_0038842
633 Ga0450920_032048
634 Ga0450890_012173
635 Ga0450897_023848
636 Ga0450894_002730
637 Ga0450896_000189
638 Ga0450898_000450
639 Ga0450899_000411
640 Ga0450903_000071
641 Ga0450906_003012
642 Ga0439458_0000542
643 Ga0439458_0121880
644 Ga0450908_001630
645 Ga0466969_0058159
646 Ga0466972_0006966
647 Ga0466972_0011171
648 Ga0466972_0017446
649 Ga0466972_0090235
650 Ga0466965_0000261
651 Ga0466965_0041775
652 Ga0466965_0057159
653 Ga0466966_0011697
654 Ga0466961_0001765
655 Ga0466961_0003700
656 Ga0466961_0032579
657 Ga0466963_0011320
658 Ga0466963_0124966
659 Ga0466964_0382083
660 Ga0466971_0030470
661 Ga0466971_0056408
662 Ga0466968_0027361
663 Ga0466968_0165188
664 Ga0466968_0479549
665 Ga0466970_0001360
666 Ga0466970_0141136
667 Ga0466957_0002728
668 Ga0466960_0093819
669 Ga0466959_0003655
670 Ga0466959_0246070
671 Ga0466958_0000240
672 Ga0466958_0339644
673 Ga0466967_0003331
674 Ga0466967_0026728
675 Ga0466967_0244447
676 Ga0466967_1003411
677 Ga0495592_0023782
678 Ga0495592_0089634
679 Ga0495603_0001264
680 Ga0495603_0002283
681 Ga0495603_0011028
682 Ga0495603_0069867
683 Ga0495603_0194443
684 Ga0495603_0225222
685 Ga0495603_0227521
686 Ga0495603_0271498
687 Ga0495629_0002718
688 Ga0495629_0004593
689 Ga0495629_0008683
690 Ga0495629_0015023
691 Ga0495629_0035726
692 Ga0495629_0125317
693 Ga0495629_0130040
694 Ga0495638_0191472
695 Ga0495651_0001712
696 Ga0495651_0104644
697 Ga0495651_0122812
698 Ga0495653_0215554
699 Ga0495582_0148966
700 Ga0495605_0014678
701 Ga0495605_0094643
702 Ga0495639_0001505
703 Ga0495639_0604357
704 Ga0495662_0001848
705 Ga0495662_0013645
706 Ga0495662_0112812
707 Ga0495662_0225673
708 Ga0495664_0003026
709 Ga0495664_0117373
710 Ga0495664_0582711
711 Ga0495584_0035051
712 Ga0495585_0005128
713 Ga0495585_0095262
714 Ga0495594_0002923
715 Ga0495594_0004049
716 Ga0495594_0023118
717 Ga0495594_0037713
718 Ga0495594_0082036
719 Ga0495594_0205904
720 Ga0495596_0372227
721 Ga0495607_0023993
722 Ga0495607_0048265
723 Ga0495583_0054256
724 Ga0495583_0401532
725 Ga0495606_0005990
726 Ga0495608_0075162
727 Ga0495610_0026633
728 Ga0495616_0002310
729 Ga0495618_0050770
730 Ga0495618_0135949
731 Ga0495628_0037067
732 Ga0495628_0040797
733 Ga0495628_0105141
734 Ga0495630_0062470
735 Ga0495630_0428885
736 Ga0495630_0737226
737 Ga0495631_0005413
738 Ga0495632_0266658
739 Ga0495643_0001589
740 Ga0495648_0246224
741 Ga0495666_0039637
742 Ga0495642_0020632
743 Ga0495652_0014326
744 Ga0495652_0051439
745 Ga0495652_0177342
746 Ga0495652_0526403
747 Ga0495640_0005916
748 Ga0495640_0008555
749 Ga0495640_0019064
750 Ga0495640_0194333
751 Ga0495586_0030366
752 Ga0495586_0456949
753 Ga0495587_0033341
754 Ga0495609_0026191
755 Ga0495597_0110199
756 Ga0495645_0096586
757 Ga0495645_0348203
758 Ga0495622_0002962
759 Ga0495622_0029596
760 Ga0495622_0190183
761 Ga0495633_0022648
762 Ga0495633_0121821
763 Ga0495667_0056862
764 Ga0495667_0121623
765 Ga0495656_0102096
766 Ga0495656_0222203
767 Ga0495634_0002188
768 Ga0495634_0004602
769 Ga0495611_0030020
770 Ga0495625_0022185
771 Ga0495625_0025533
772 Ga0495625_0026041
773 Ga0495625_0235378
774 Ga0495635_0001162
775 Ga0495635_0021180
776 Ga0495635_0119958
777 Ga0495661_0036126
778 Ga0495588_0008008
779 Ga0495588_0009468
780 Ga0495588_0053334
781 Ga0495588_0160823
782 Ga0495588_0378564
783 Ga0495588_0445615
784 Ga0495657_0000283
785 Ga0495657_0005957
786 Ga0495657_0015209
787 Ga0495657_0039527
788 Ga0495599_0151614
789 Ga0495623_0038956
790 Ga0495646_0001097
791 Ga0495647_0417305
792 Ga0495658_0025200
793 Ga0495613_0000322
794 Ga0495613_0002209
795 Ga0495613_0002503
796 Ga0495613_0004316
797 Ga0495613_0012215
798 Ga0495613_0023508
799 Ga0495613_0099643
800 Ga0495624_0038590
801 Ga0495670_0068121
802 Ga0495670_0134311
803 Ga0495671_0012941
804 Ga0495671_0116890
805 Ga0495671_0173843
806 Ga0495649_0026830
807 Ga0495589_0022493
808 Ga0495589_0029584
809 Ga0495600_0063744
810 Ga0495600_0147549
811 Ga0495600_0237057
812 Ga0495581_0007961
813 Ga0495581_0042488
814 Ga0495581_0089499
815 Ga0495581_0235455
816 Ga0495604_0021247
817 Ga0495604_0040360
818 Ga0495604_0062664
819 Ga0495604_0072067
820 Ga0495604_0265005
821 Ga0495636_0006490
822 Ga0495636_0021767
823 Ga0495636_0033374
824 Ga0495636_0042357
825 Ga0495636_0102830
826 Ga0495674_0148314
827 Ga0495674_0361937
828 Ga0495672_0072100
829 Ga0495676_0001163
830 Ga0495676_0001475
831 Ga0495676_0006543
832 Ga0495676_0009368
833 Ga0495676_0060665
834 Ga0495676_0156288
835 Ga0495676_0227998
836 Ga0495680_0056287
837 Ga0495683_0097131
838 Ga0495687_000668
839 Ga0495687_001421
840 Ga0495687_038505
841 Ga0495675_0058772
842 Ga0495675_0071923
843 Ga0495677_0065809
844 Ga0495685_040640
845 Ga0495685_050825
846 Ga0495681_0003993
847 Ga0495681_0024803
848 Ga0495686_0028236
849 Ga0495686_0281690
850 Ga0495593_0003182
851 Ga0495593_0047169
852 Ga0495593_0061981
853 Ga0495602_0036802
854 Ga0495602_0088224
855 Ga0495614_0002494
856 Ga0495614_0003265
857 Ga0495614_0014278
858 Ga0495614_0062874
859 Ga0495614_0082108
860 Ga0495614_0590970
861 Ga0495615_0202032
862 Ga0495626_0068330
863 Ga0496109_0163116
864 Ga0496110_0656692
865 Ga0496115_0963487
866 Ga0501306_064643
867 Ga0501031_0009611
868 Ga0501031_0033790
869 Ga0501031_0212499
870 Ga0501031_0313462
871 Ga0501032_0000859
872 Ga0501032_0039827
873 Ga0501032_0057504
874 Ga0501032_0173309
875 Ga0501032_0341799
876 Ga0501032_0468234
877 Ga0501033_0018999
878 Ga0501033_0020968
879 Ga0501033_0046569
880 Ga0501033_0048684
881 Ga0501033_0072977
882 Ga0501033_0191550
883 Ga0501033_0238747
884 Ga0501034_0011784
885 Ga0501034_0041278
886 Ga0501034_0042539
887 Ga0501034_0144105
888 Ga0501034_0150601
889 Ga0501034_0434410
890 Ga0501036_0001999
891 Ga0501036_0010162
892 Ga0501036_0013575
893 Ga0501036_0031796
894 Ga0501036_0060180
895 Ga0501036_0133978
896 Ga0501037_0000829
897 Ga0501037_0001735
898 Ga0501037_0254223
899 Ga0501038_0000639
900 Ga0501038_0035878
901 Ga0501038_0051336
902 Ga0501038_0130931
903 Ga0501039_0090465
904 Ga0501039_1034722
905 Ga0501041_0000324
906 Ga0501042_0002035
907 Ga0501042_0012898
908 Ga0501043_0009370
909 Ga0501043_0017014
910 Ga0501043_0026184
911 Ga0501043_0062655
912 Ga0501043_0604069
913 Ga0501046_0007160
914 Ga0501046_0011680
915 Ga0501046_0071063
916 Ga0501046_0202892
917 Ga0501047_0001294
918 Ga0501047_0010245
919 Ga0501047_0015688
920 Ga0501047_0039162
921 Ga0501047_0055944
922 Ga0501047_0103110
923 Ga0501047_0176912
924 Ga0501047_0247165
925 Ga0501047_1338106
926 Ga0501048_0006306
927 Ga0501048_0053377
928 Ga0501067_0010227
929 Ga0501068_0000686
930 Ga0501068_0531340
931 Ga0501069_0404960
932 Ga0501070_0124918
933 Ga0501070_0428527
934 Ga0501070_0440524
935 Ga0501070_0871885
936 Ga0501071_0000976
937 Ga0501072_0000664
938 Ga0501072_0832411
939 Ga0501073_0345904
940 Ga0501073_0958875
941 Ga0501073_0986649
942 Ga0501073_1218642
943 Ga0501074_0072883
944 Ga0501074_0092063
945 Ga0501076_0041921
946 Ga0501077_0020667
947 Ga0501216_118500
948 Ga0501235_014374
949 Ga0501079_0011231
950 Ga0501080_0046790
951 Ga0501080_0824608
952 Ga0501080_1360706
953 Ga0501083_0016263
954 Ga0501282_015602
955 Ga0501035_0001216
956 Ga0501035_0004750
957 Ga0501035_0018783
958 Ga0501035_0025832
959 Ga0501035_0037208
960 Ga0501035_0075448
961 Ga0501035_0093980
962 Ga0501035_0096182
963 Ga0501035_0119436
964 Ga0501035_0872405
965 Ga0501044_0001566
966 Ga0501044_0016802
967 Ga0501044_0082432
968 Ga0501044_0175774
969 Ga0501044_0178532
970 Ga0501044_0207943
971 Ga0501044_0292855
972 Ga0501044_0388109
973 Ga0501044_0770484
974 Ga0501044_1439595
975 Ga0501045_0076291
976 Ga0501045_0120916
977 Ga0501045_0125153
978 Ga0501045_0181375
979 nmdc:mga03n38_30531_c1
980 nmdc:mga06z11_576621_c1
981 nmdc:mga07m45_27864_c1
982 nmdc:mga07m45_280658_c1
983 Ga0495601_0049692
984 Ga0500583_0062429
985 Ga0500640_000272
986 Ga0500650_0095872
987 Ga0500660_205165
988 Ga0500560_006433
989 Ga0500559_0206738
990 Ga0500600_0061522
991 Ga0500636_0094404
992 Ga0501084_0111614
993 Ga0587111_0270492
994 Ga0501082_0003556
995 Ga0466962_0013625
996 Ga0466962_0163148
997 Ga0530510_0146029
998 2547409115
999 2585297749
1000 2585315933
1001 2616902734
1002 2643764436
1003 2644438287
1004 2644458505
1005 2644630043
1006 2784586507
1007 2785345999
1008 2785366909
1009 2786667945
1010 2808847408
1011 2809230019
1012 2811846753
1013 2812360559
1014 2812482630
1015 2819699326
1016 2852641383
1017 2862289960
1018 2862386313
1019 2862516195
1020 2863407263
1021 2867369628
1022 2867481352
1023 2873158194
1024 2877683633
1025 2912722920
1026 2912726417
1027 2919474366
1028 2946052255
1029 2946065327
1030 2946073694
1031 2947232119
1032 2954008760
1033 2954674231
1034 2954689901
1035 2966604666
1036 2990063558
1037 2990091824
1038 3006324476
1039 3006497138
1040 8008560993
1041 8008581025
1042 8023628636
1043 8025535976
1044 8048412955
1045 8054164263
1046 8056832570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zmd-assembly1.cif.gz_B crystal structure of hype covalently tethered to bip bound to amp-pnp 0.6714 25 122
6i7h-assembly1.cif.gz_A-2 crystal structure of dimeric ficd mutant k256s 0.6628 25 122
6i7i-assembly1.cif.gz_A-2 crystal structure of dimeric ficd mutant k256a complexed with mgatp 0.6521 20 122
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.6475 8 124
6i7g-assembly1.cif.gz_B crystal structure of dimeric wild type ficd complexed with atp 0.6442 20 122
ID Description Score Start End Superfamily
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.6475 8 124 1.20.120.1870
4wgjA00 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.6246 52 124 1.10.3290.10
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.6076 8 124 1.20.120.1870
3cucA00 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.602 26 121 1.10.3290.10
af_Q54RJ6_2_142_1.10.3290.10 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.4998 7 121 1.10.3290.10
ID Description Score Start End GO Terms
AF-A0A559U1E9-F1-model_v4 Fic family toxin-antitoxin system, toxin component 0.9439 45 124
AF-A0A559U1E9-F1-model_v4 Fic family toxin-antitoxin system, toxin component 0.9328 45 124
AF-A0A6I5DHS1-F1-model_v4 deleted 0.9214 48 122
AF-A0A560VZH8-F1-model_v4 Uncharacterized protein 0.9163 47 124
AF-A0A2N2ND21-F1-model_v4 Fido domain-containing protein 0.9153 31 124 GO:0016301

Map