F459015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 523 | 297 | 520 | 528 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0048377|Ga0395901_0048377_2244_4196 |
| Length | 626 |
| Sequence | MAEQGRNANFVAVSLIGHGALVAGATIWNQTELLAVLAPWPLLRVFFLHGSVKPGVLTATQPQDASEVSEQHFDFLRDRAGLQQITLGAMSTLKGSKKLWYCLFSFDHPTEVKVVSKTTVSKILPGLAAWFWGDDVGQSNISAYSRGVMGYTTPTIDRLAGEGVMFTDYYAEQSCTAGRASFITGQSGLRTGMTKVGLPGATLGLQKEDPTIAELLKPLGYATGQFGKNHLGDRNEFLPTVHGFDEFYGNLYHLNAEEEPELPDYPKDPSFRAKYGPRGVMDCKASDRDDPTVDPRFGKVGKQVCTDTGPLTKARMVGIDDDIQSRAVDFIQRQRQAGKPFFIWVNFTHMHFRTHAKPQSIGQSGPFQSPYHDTMIDHDKNVGAVLKALDDLGIADNTFVMYGTDNGPHMNSWPDAGMTPFRSEKNSNWEGAYRVPAIFRWPGRIRAGLVSNEIVSHLDMLPTILAIAGDPQVTNKLLTGHRVGDLTYKVHLDGYNLVPYLTGQAAKSPRDSFFYINDDQQLTSLRYDNWKFVFLEQRAPGQLLIWANPFTNLRVPKIFNLRTDPYERADVTSNTYYDWLIDHVFLLVPAQEYVGQFLATFRDFPPRQKAATFNMDEVLSKLKDAM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 162 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 172 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 173 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 174 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 175 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 176 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.63 |
| Nodule | 0 |
| Rhizoplane | 6.5 |
| Rhizosphere | 89.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1000805 | 3300002070 | Bacteria | 4360 |
| 2 | JGI25404J52841_10001818 | 3300003659 | Bacteria | 3874 |
| 3 | Ga0055530_10000772 | 3300003791 | Bacteria | 26697 |
| 4 | Ga0065715_10127930 | 3300005293 | Bacteria | 2076 |
| 5 | Ga0065707_10104037 | 3300005295 | Bacteria | 2717 |
| 6 | Ga0065707_10128452 | 3300005295 | Bacteria | 1965 |
| 7 | Ga0070676_10022795 | 3300005328 | Bacteria | 3514 |
| 8 | Ga0070690_100071878 | 3300005330 | Bacteria | 2248 |
| 9 | Ga0070670_100004932 | 3300005331 | Bacteria | 11231 |
| 10 | Ga0068869_100018568 | 3300005334 | Bacteria | 4735 |
| 11 | Ga0070680_100032845 | 3300005336 | Bacteria | 4178 |
| 12 | Ga0070680_100047428 | 3300005336 | Bacteria | 3498 |
| 13 | Ga0068868_100011672 | 3300005338 | Bacteria | 6398 |
| 14 | Ga0070660_100018168 | 3300005339 | Bacteria | 5133 |
| 15 | Ga0070689_100016960 | 3300005340 | Bacteria | 5341 |
| 16 | Ga0070689_100087191 | 3300005340 | Bacteria | 2455 |
| 17 | Ga0070691_10005763 | 3300005341 | Bacteria | 5650 |
| 18 | Ga0070687_100013573 | 3300005343 | Bacteria | 3633 |
| 19 | Ga0070668_100018833 | 3300005347 | Bacteria | 5186 |
| 20 | Ga0070669_100013120 | 3300005353 | Bacteria | 5888 |
| 21 | Ga0070669_100050048 | 3300005353 | Bacteria | 3051 |
| 22 | Ga0070673_100003866 | 3300005364 | Bacteria | 9404 |
| 23 | Ga0070673_100052173 | 3300005364 | Bacteria | 3208 |
| 24 | Ga0070659_100055335 | 3300005366 | Bacteria | 3126 |
| 25 | Ga0070667_100016350 | 3300005367 | Bacteria | 6139 |
| 26 | Ga0070709_10001799 | 3300005434 | Bacteria | 11629 |
| 27 | Ga0070709_10018957 | 3300005434 | Bacteria | 3970 |
| 28 | Ga0070714_100037354 | 3300005435 | Bacteria | 4081 |
| 29 | Ga0070713_100013734 | 3300005436 | Bacteria | 5988 |
| 30 | Ga0070710_10005029 | 3300005437 | Bacteria | 6257 |
| 31 | Ga0070701_10011707 | 3300005438 | Bacteria | 3935 |
| 32 | Ga0070705_100002165 | 3300005440 | Bacteria | 9985 |
| 33 | Ga0070705_100115943 | 3300005440 | Bacteria | 1721 |
| 34 | Ga0070700_100014427 | 3300005441 | Bacteria | 4461 |
| 35 | Ga0070700_100040353 | 3300005441 | Bacteria | 2856 |
| 36 | Ga0070700_100056842 | 3300005441 | Bacteria | 2454 |
| 37 | Ga0070694_100018354 | 3300005444 | Bacteria | 4439 |
| 38 | Ga0070694_100046682 | 3300005444 | Bacteria | 2909 |
| 39 | Ga0070663_100002602 | 3300005455 | Bacteria | 10204 |
| 40 | Ga0070663_100010426 | 3300005455 | Bacteria | 5791 |
| 41 | Ga0070678_100028092 | 3300005456 | Bacteria | 3831 |
| 42 | Ga0070678_100037457 | 3300005456 | Bacteria | 3406 |
| 43 | Ga0070662_100042070 | 3300005457 | Bacteria | 3262 |
| 44 | Ga0070662_100155056 | 3300005457 | Bacteria | 1787 |
| 45 | Ga0070681_10027205 | 3300005458 | Bacteria | 5750 |
| 46 | Ga0068867_100022822 | 3300005459 | Bacteria | 4477 |
| 47 | Ga0070685_10007483 | 3300005466 | Bacteria | 5589 |
| 48 | Ga0070685_10029958 | 3300005466 | Bacteria | 3027 |
| 49 | Ga0070699_100038139 | 3300005518 | Bacteria | 4161 |
| 50 | Ga0070679_100230872 | 3300005530 | Bacteria | 1810 |
| 51 | Ga0070684_100019408 | 3300005535 | Bacteria | 5623 |
| 52 | Ga0070684_100041500 | 3300005535 | Bacteria | 3967 |
| 53 | Ga0068853_100171713 | 3300005539 | Bacteria | 1962 |
| 54 | Ga0070686_100112851 | 3300005544 | Bacteria | 1854 |
| 55 | Ga0070695_100045648 | 3300005545 | Bacteria | 2794 |
| 56 | Ga0070696_100000102 | 3300005546 | Bacteria | 43346 |
| 57 | Ga0070693_100000047 | 3300005547 | Bacteria | 46631 |
| 58 | Ga0070693_100020072 | 3300005547 | Bacteria | 3517 |
| 59 | Ga0070665_100036167 | 3300005548 | Bacteria | 4968 |
| 60 | Ga0070704_100022448 | 3300005549 | Bacteria | 4107 |
| 61 | Ga0068855_100059733 | 3300005563 | Bacteria | 4460 |
| 62 | Ga0068855_100189705 | 3300005563 | Bacteria | 2319 |
| 63 | Ga0068857_100048364 | 3300005577 | Bacteria | 3776 |
| 64 | Ga0068854_100086846 | 3300005578 | Bacteria | 2319 |
| 65 | Ga0068856_100089348 | 3300005614 | Bacteria | 3064 |
| 66 | Ga0070702_100005312 | 3300005615 | Bacteria | 5983 |
| 67 | Ga0070702_100015137 | 3300005615 | Bacteria | 3931 |
| 68 | Ga0068852_100116116 | 3300005616 | Bacteria | 2441 |
| 69 | Ga0068859_100072533 | 3300005617 | Bacteria | 3480 |
| 70 | Ga0068864_100022592 | 3300005618 | Bacteria | 5275 |
| 71 | Ga0068864_100027765 | 3300005618 | Bacteria | 4782 |
| 72 | Ga0068866_10002035 | 3300005718 | Bacteria | 8422 |
| 73 | Ga0068861_100049768 | 3300005719 | Bacteria | 3174 |
| 74 | Ga0068861_100062578 | 3300005719 | Bacteria | 2859 |
| 75 | Ga0068861_100070118 | 3300005719 | Bacteria | 2713 |
| 76 | Ga0068861_100111386 | 3300005719 | Bacteria | 2193 |
| 77 | Ga0068870_10000839 | 3300005840 | Bacteria | 11969 |
| 78 | Ga0068863_100124278 | 3300005841 | Bacteria | 2461 |
| 79 | Ga0068863_100129809 | 3300005841 | Bacteria | 2406 |
| 80 | Ga0068863_100135733 | 3300005841 | Bacteria | 2350 |
| 81 | Ga0068858_100024518 | 3300005842 | Bacteria | 5620 |
| 82 | Ga0068858_100035223 | 3300005842 | Bacteria | 4643 |
| 83 | Ga0068858_100073135 | 3300005842 | Bacteria | 3182 |
| 84 | Ga0068858_100086640 | 3300005842 | Bacteria | 2913 |
| 85 | Ga0068860_100023260 | 3300005843 | Bacteria | 5988 |
| 86 | Ga0068860_100041626 | 3300005843 | Bacteria | 4388 |
| 87 | Ga0068860_100134682 | 3300005843 | Bacteria | 2372 |
| 88 | Ga0068862_100002530 | 3300005844 | Bacteria | 16185 |
| 89 | Ga0068862_100022589 | 3300005844 | Bacteria | 5263 |
| 90 | Ga0068862_100035208 | 3300005844 | Bacteria | 4238 |
| 91 | Ga0081455_10036833 | 3300005937 | Bacteria | 4350 |
| 92 | Ga0081455_10084704 | 3300005937 | Bacteria | 2586 |
| 93 | Ga0081455_10123836 | 3300005937 | Bacteria | 2033 |
| 94 | Ga0081540_1002128 | 3300005983 | Bacteria | 16489 |
| 95 | Ga0081540_1004473 | 3300005983 | Bacteria | 10641 |
| 96 | Ga0081540_1005093 | 3300005983 | Bacteria | 9859 |
| 97 | Ga0081540_1005381 | 3300005983 | Bacteria | 9570 |
| 98 | Ga0081540_1034919 | 3300005983 | Bacteria | 2703 |
| 99 | Ga0081540_1038843 | 3300005983 | Bacteria | 2503 |
| 100 | Ga0070717_10067029 | 3300006028 | Bacteria | 2986 |
| 101 | Ga0075365_10022919 | 3300006038 | Bacteria | 3920 |
| 102 | Ga0075364_10020684 | 3300006051 | Bacteria | 4141 |
| 103 | Ga0070715_10041065 | 3300006163 | Bacteria | 1937 |
| 104 | Ga0070716_100002533 | 3300006173 | Bacteria | 8459 |
| 105 | Ga0070712_100009149 | 3300006175 | Bacteria | 6238 |
| 106 | Ga0070712_100015400 | 3300006175 | Bacteria | 4925 |
| 107 | Ga0070712_100033149 | 3300006175 | Bacteria | 3493 |
| 108 | Ga0070712_100122831 | 3300006175 | Bacteria | 1956 |
| 109 | Ga0075362_10019926 | 3300006177 | Bacteria | 2797 |
| 110 | Ga0075367_10014425 | 3300006178 | Bacteria | 4278 |
| 111 | Ga0075367_10043976 | 3300006178 | Bacteria | 2616 |
| 112 | Ga0075369_10003558 | 3300006186 | Bacteria | 5678 |
| 113 | Ga0075369_10051112 | 3300006186 | Bacteria | 1789 |
| 114 | Ga0075366_10052943 | 3300006195 | Bacteria | 2411 |
| 115 | Ga0097621_100000882 | 3300006237 | Bacteria | 21034 |
| 116 | Ga0097621_100005781 | 3300006237 | Bacteria | 8733 |
| 117 | Ga0097621_100010060 | 3300006237 | Bacteria | 6898 |
| 118 | Ga0075370_10015429 | 3300006353 | Bacteria | 4091 |
| 119 | Ga0068871_100001763 | 3300006358 | Bacteria | 14569 |
| 120 | Ga0068871_100005451 | 3300006358 | Bacteria | 8921 |
| 121 | Ga0068871_100029949 | 3300006358 | Bacteria | 4281 |
| 122 | Ga0068871_100055591 | 3300006358 | Bacteria | 3214 |
| 123 | Ga0068871_100059950 | 3300006358 | Bacteria | 3102 |
| 124 | Ga0068871_100074223 | 3300006358 | Bacteria | 2805 |
| 125 | Ga0075431_100006700 | 3300006847 | Bacteria | 11436 |
| 126 | Ga0075433_10011372 | 3300006852 | Bacteria | 7165 |
| 127 | Ga0075434_100096823 | 3300006871 | Bacteria | 2956 |
| 128 | Ga0075434_100099559 | 3300006871 | Bacteria | 2912 |
| 129 | Ga0068865_100029827 | 3300006881 | Bacteria | 3623 |
| 130 | Ga0068865_100071256 | 3300006881 | Bacteria | 2465 |
| 131 | Ga0097620_100072533 | 3300006931 | Bacteria | 3480 |
| 132 | Ga0075435_100015161 | 3300007076 | Bacteria | 5787 |
| 133 | Ga0075435_100021597 | 3300007076 | Bacteria | 4953 |
| 134 | Ga0105251_10023425 | 3300009011 | Bacteria | 3187 |
| 135 | Ga0105250_10022309 | 3300009092 | Bacteria | 2553 |
| 136 | Ga0111539_10008802 | 3300009094 | Bacteria | 12802 |
| 137 | Ga0111539_10061824 | 3300009094 | Bacteria | 4436 |
| 138 | Ga0105245_10005433 | 3300009098 | Bacteria | 11193 |
| 139 | Ga0105245_10012782 | 3300009098 | Bacteria | 7313 |
| 140 | Ga0105245_10148831 | 3300009098 | Bacteria | 2212 |
| 141 | Ga0114129_10024876 | 3300009147 | Bacteria | 8489 |
| 142 | Ga0114129_10134797 | 3300009147 | Bacteria | 3389 |
| 143 | Ga0114129_10292840 | 3300009147 | Bacteria | 2172 |
| 144 | Ga0105243_10071869 | 3300009148 | Bacteria | 2799 |
| 145 | Ga0105241_10005406 | 3300009174 | Bacteria | 9441 |
| 146 | Ga0105241_10045709 | 3300009174 | Bacteria | 3324 |
| 147 | Ga0105241_10080107 | 3300009174 | Bacteria | 2555 |
| 148 | Ga0105242_10003659 | 3300009176 | Bacteria | 11964 |
| 149 | Ga0105242_10020765 | 3300009176 | Bacteria | 5151 |
| 150 | Ga0105242_10181536 | 3300009176 | Bacteria | 1857 |
| 151 | Ga0105248_10008408 | 3300009177 | Bacteria | 11327 |
| 152 | Ga0105248_10027007 | 3300009177 | Bacteria | 6386 |
| 153 | Ga0105248_10055812 | 3300009177 | Bacteria | 4431 |
| 154 | Ga0105237_10022221 | 3300009545 | Bacteria | 6510 |
| 155 | Ga0105249_10034516 | 3300009553 | Bacteria | 4585 |
| 156 | Ga0105239_10025578 | 3300010375 | Bacteria | 6498 |
| 157 | Ga0105239_10098495 | 3300010375 | Bacteria | 3232 |
| 158 | Ga0105239_10109967 | 3300010375 | Bacteria | 3055 |
| 159 | Ga0105246_10133486 | 3300011119 | Bacteria | 1857 |
| 160 | Ga0157374_10003302 | 3300013296 | Bacteria | 13547 |
| 161 | Ga0157374_10047297 | 3300013296 | Bacteria | 3988 |
| 162 | Ga0157374_10047649 | 3300013296 | Bacteria | 3974 |
| 163 | Ga0157378_10019103 | 3300013297 | Bacteria | 6022 |
| 164 | Ga0157378_10024710 | 3300013297 | Bacteria | 5289 |
| 165 | Ga0157378_10029534 | 3300013297 | Bacteria | 4841 |
| 166 | Ga0157378_10045594 | 3300013297 | Bacteria | 3896 |
| 167 | Ga0157378_10122497 | 3300013297 | Bacteria | 2399 |
| 168 | Ga0163162_10013586 | 3300013306 | Bacteria | 7955 |
| 169 | Ga0163162_10043427 | 3300013306 | Bacteria | 4501 |
| 170 | Ga0157375_10003981 | 3300013308 | Bacteria | 12818 |
| 171 | Ga0163163_10046035 | 3300014325 | Bacteria | 4284 |
| 172 | Ga0163163_10085243 | 3300014325 | Bacteria | 3167 |
| 173 | Ga0157380_10058382 | 3300014326 | Bacteria | 3076 |
| 174 | Ga0157380_10179324 | 3300014326 | Bacteria | 1859 |
| 175 | Ga0157379_10031754 | 3300014968 | Bacteria | 4705 |
| 176 | Ga0157379_10054072 | 3300014968 | Bacteria | 3587 |
| 177 | Ga0157379_10120107 | 3300014968 | Bacteria | 2364 |
| 178 | Ga0157379_10148866 | 3300014968 | Bacteria | 2112 |
| 179 | Ga0157376_10002379 | 3300014969 | Bacteria | 12701 |
| 180 | Ga0157376_10002629 | 3300014969 | Bacteria | 12215 |
| 181 | Ga0157376_10015168 | 3300014969 | Bacteria | 5812 |
| 182 | Ga0157376_10018085 | 3300014969 | Bacteria | 5393 |
| 183 | Ga0157376_10029778 | 3300014969 | Bacteria | 4352 |
| 184 | Ga0157376_10058643 | 3300014969 | Bacteria | 3226 |
| 185 | Ga0163161_10039279 | 3300017792 | Bacteria | 3397 |
| 186 | Ga0207666_1000064 | 3300025271 | Bacteria | 19030 |
| 187 | Ga0207696_1016932 | 3300025711 | Bacteria | 2426 |
| 188 | Ga0207692_10003085 | 3300025898 | Bacteria | 6470 |
| 189 | Ga0207642_10001449 | 3300025899 | Bacteria | 7352 |
| 190 | Ga0207710_10001979 | 3300025900 | Bacteria | 9783 |
| 191 | Ga0207688_10035643 | 3300025901 | Bacteria | 2757 |
| 192 | Ga0207680_10047375 | 3300025903 | Bacteria | 2547 |
| 193 | Ga0207647_10041878 | 3300025904 | Bacteria | 2876 |
| 194 | Ga0207699_10007364 | 3300025906 | Bacteria | 5381 |
| 195 | Ga0207645_10017820 | 3300025907 | Bacteria | 4682 |
| 196 | Ga0207654_10003273 | 3300025911 | Bacteria | 8190 |
| 197 | Ga0207654_10033715 | 3300025911 | Bacteria | 2840 |
| 198 | Ga0207654_10060150 | 3300025911 | Bacteria | 2218 |
| 199 | Ga0207707_10084818 | 3300025912 | Bacteria | 2767 |
| 200 | Ga0207693_10004125 | 3300025915 | Bacteria | 12334 |
| 201 | Ga0207693_10015774 | 3300025915 | Bacteria | 6054 |
| 202 | Ga0207693_10018993 | 3300025915 | Bacteria | 5471 |
| 203 | Ga0207663_10011825 | 3300025916 | Bacteria | 4699 |
| 204 | Ga0207663_10038438 | 3300025916 | Bacteria | 2893 |
| 205 | Ga0207663_10081052 | 3300025916 | Bacteria | 2124 |
| 206 | Ga0207660_10013544 | 3300025917 | Bacteria | 5346 |
| 207 | Ga0207660_10095067 | 3300025917 | Bacteria | 2216 |
| 208 | Ga0207662_10064416 | 3300025918 | Bacteria | 2205 |
| 209 | Ga0207649_10069394 | 3300025920 | Bacteria | 2244 |
| 210 | Ga0207681_10111143 | 3300025923 | Bacteria | 1993 |
| 211 | Ga0207650_10002016 | 3300025925 | Bacteria | 14219 |
| 212 | Ga0207687_10013910 | 3300025927 | Bacteria | 5258 |
| 213 | Ga0207687_10041590 | 3300025927 | Bacteria | 3157 |
| 214 | Ga0207700_10007998 | 3300025928 | Bacteria | 6514 |
| 215 | Ga0207700_10023916 | 3300025928 | Bacteria | 4222 |
| 216 | Ga0207644_10081738 | 3300025931 | Bacteria | 2388 |
| 217 | Ga0207690_10012193 | 3300025932 | Bacteria | 5144 |
| 218 | Ga0207706_10002877 | 3300025933 | Bacteria | 16672 |
| 219 | Ga0207706_10025291 | 3300025933 | Bacteria | 5321 |
| 220 | Ga0207706_10031111 | 3300025933 | Bacteria | 4756 |
| 221 | Ga0207706_10161653 | 3300025933 | Bacteria | 1968 |
| 222 | Ga0207686_10002158 | 3300025934 | Bacteria | 10830 |
| 223 | Ga0207686_10012100 | 3300025934 | Bacteria | 4741 |
| 224 | Ga0207709_10009666 | 3300025935 | Bacteria | 5313 |
| 225 | Ga0207709_10113749 | 3300025935 | Bacteria | 1815 |
| 226 | Ga0207670_10035216 | 3300025936 | Bacteria | 3244 |
| 227 | Ga0207670_10093682 | 3300025936 | Bacteria | 2129 |
| 228 | Ga0207669_10033709 | 3300025937 | Bacteria | 2893 |
| 229 | Ga0207704_10027987 | 3300025938 | Bacteria | 3120 |
| 230 | Ga0207665_10033458 | 3300025939 | Bacteria | 3407 |
| 231 | Ga0207691_10138318 | 3300025940 | Bacteria | 2147 |
| 232 | Ga0207711_10035097 | 3300025941 | Bacteria | 4250 |
| 233 | Ga0207689_10013624 | 3300025942 | Bacteria | 6933 |
| 234 | Ga0207689_10023117 | 3300025942 | Bacteria | 5221 |
| 235 | Ga0207689_10059789 | 3300025942 | Bacteria | 3134 |
| 236 | Ga0207689_10072443 | 3300025942 | Bacteria | 2831 |
| 237 | Ga0207667_10113101 | 3300025949 | Bacteria | 2799 |
| 238 | Ga0207667_10126912 | 3300025949 | Bacteria | 2628 |
| 239 | Ga0207651_10056318 | 3300025960 | Bacteria | 2705 |
| 240 | Ga0207712_10015086 | 3300025961 | Bacteria | 4979 |
| 241 | Ga0207712_10034675 | 3300025961 | Bacteria | 3421 |
| 242 | Ga0207712_10084526 | 3300025961 | Bacteria | 2319 |
| 243 | Ga0207712_10093508 | 3300025961 | Bacteria | 2219 |
| 244 | Ga0207668_10006761 | 3300025972 | Bacteria | 6787 |
| 245 | Ga0207668_10014835 | 3300025972 | Bacteria | 4829 |
| 246 | Ga0207658_10015221 | 3300025986 | Bacteria | 5277 |
| 247 | Ga0207658_10018489 | 3300025986 | Bacteria | 4813 |
| 248 | Ga0207658_10076641 | 3300025986 | Bacteria | 2548 |
| 249 | Ga0207677_10074340 | 3300026023 | Bacteria | 2411 |
| 250 | Ga0207703_10020753 | 3300026035 | Bacteria | 5140 |
| 251 | Ga0207703_10022951 | 3300026035 | Bacteria | 4899 |
| 252 | Ga0207703_10027177 | 3300026035 | Bacteria | 4506 |
| 253 | Ga0207703_10039372 | 3300026035 | Bacteria | 3778 |
| 254 | Ga0207703_10056590 | 3300026035 | Bacteria | 3195 |
| 255 | Ga0207703_10081308 | 3300026035 | Bacteria | 2700 |
| 256 | Ga0207703_10169598 | 3300026035 | Bacteria | 1918 |
| 257 | Ga0207678_10004916 | 3300026067 | Bacteria | 12003 |
| 258 | Ga0207678_10025389 | 3300026067 | Bacteria | 5172 |
| 259 | Ga0207678_10034620 | 3300026067 | Bacteria | 4399 |
| 260 | Ga0207708_10005065 | 3300026075 | Bacteria | 9718 |
| 261 | Ga0207708_10036476 | 3300026075 | Bacteria | 3743 |
| 262 | Ga0207708_10044601 | 3300026075 | Bacteria | 3379 |
| 263 | Ga0207702_10052830 | 3300026078 | Bacteria | 3440 |
| 264 | Ga0207702_10079341 | 3300026078 | Bacteria | 2845 |
| 265 | Ga0207648_10027089 | 3300026089 | Bacteria | 5091 |
| 266 | Ga0207648_10037259 | 3300026089 | Bacteria | 4283 |
| 267 | Ga0207676_10140675 | 3300026095 | Bacteria | 2065 |
| 268 | Ga0207674_10015139 | 3300026116 | Bacteria | 8487 |
| 269 | Ga0207674_10052231 | 3300026116 | Bacteria | 4169 |
| 270 | Ga0207675_100026056 | 3300026118 | Bacteria | 5442 |
| 271 | Ga0207675_100026914 | 3300026118 | Bacteria | 5354 |
| 272 | Ga0207675_100151787 | 3300026118 | Bacteria | 2205 |
| 273 | Ga0207675_100155720 | 3300026118 | Bacteria | 2177 |
| 274 | Ga0207683_10006298 | 3300026121 | Bacteria | 10169 |
| 275 | Ga0207683_10022292 | 3300026121 | Bacteria | 5434 |
| 276 | Ga0207683_10029218 | 3300026121 | Bacteria | 4772 |
| 277 | Ga0207698_10143721 | 3300026142 | Bacteria | 2059 |
| 278 | Ga0209998_10007947 | 3300027717 | Bacteria | 2201 |
| 279 | Ga0209813_10016402 | 3300027866 | Bacteria | 2022 |
| 280 | Ga0207428_10000160 | 3300027907 | Bacteria | 92379 |
| 281 | Ga0207428_10004626 | 3300027907 | Bacteria | 13044 |
| 282 | Ga0268266_10001098 | 3300028379 | Bacteria | 33929 |
| 283 | Ga0268266_10025697 | 3300028379 | Bacteria | 5010 |
| 284 | Ga0268265_10000839 | 3300028380 | Bacteria | 28924 |
| 285 | Ga0268265_10009578 | 3300028380 | Bacteria | 6541 |
| 286 | Ga0268265_10010066 | 3300028380 | Bacteria | 6382 |
| 287 | Ga0268265_10028814 | 3300028380 | Bacteria | 3979 |
| 288 | Ga0268265_10069356 | 3300028380 | Bacteria | 2737 |
| 289 | Ga0268264_10046840 | 3300028381 | Bacteria | 3593 |
| 290 | Ga0265332_10000096 | 3300031238 | Bacteria | 76689 |
| 291 | Ga0265328_10007779 | 3300031239 | Bacteria | 4455 |
| 292 | Ga0265325_10000520 | 3300031241 | Bacteria | 27739 |
| 293 | Ga0265329_10005325 | 3300031242 | Bacteria | 5211 |
| 294 | Ga0265340_10031213 | 3300031247 | Bacteria | 2666 |
| 295 | Ga0265339_10006085 | 3300031249 | Bacteria | 7963 |
| 296 | Ga0265331_10000175 | 3300031250 | Bacteria | 78849 |
| 297 | Ga0265331_10000184 | 3300031250 | Bacteria | 76712 |
| 298 | Ga0265316_10000620 | 3300031344 | Bacteria | 39538 |
| 299 | Ga0307508_10109406 | 3300031616 | Bacteria | 2363 |
| 300 | Ga0316579_10009838 | 3300031691 | Bacteria | 4027 |
| 301 | Ga0265314_10000310 | 3300031711 | Bacteria | 69421 |
| 302 | Ga0265314_10001965 | 3300031711 | Bacteria | 21875 |
| 303 | Ga0265342_10001874 | 3300031712 | Bacteria | 18989 |
| 304 | Ga0316576_10021235 | 3300031727 | Bacteria | 4486 |
| 305 | Ga0316578_10007765 | 3300031728 | Bacteria | 5410 |
| 306 | Ga0316583_10024835 | 3300032133 | Bacteria | 2140 |
| 307 | Ga0316585_10002332 | 3300032137 | Bacteria | 5108 |
| 308 | Ga0316580_10003474 | 3300032139 | Bacteria | 4479 |
| 309 | Ga0316592_1008423 | 3300033524 | Bacteria | 2038 |
| 310 | Ga0373940_0000745 | 3300035088 | Bacteria | 5310 |
| 311 | Ga0373923_0030264 | 3300035111 | Bacteria | 2176 |
| 312 | Ga0373932_0006812 | 3300035112 | Bacteria | 2712 |
| 313 | Ga0373932_0008631 | 3300035112 | Bacteria | 2437 |
| 314 | Ga0373953_0000879 | 3300035117 | Bacteria | 8428 |
| 315 | Ga0373954_0000261 | 3300035118 | Bacteria | 19044 |
| 316 | Ga0373954_0005480 | 3300035118 | Bacteria | 5488 |
| 317 | Ga0373956_0003139 | 3300035119 | Bacteria | 6682 |
| 318 | Ga0373956_0013972 | 3300035119 | Bacteria | 3347 |
| 319 | Ga0373956_0046157 | 3300035119 | Bacteria | 1945 |
| 320 | Ga0373957_0012793 | 3300035120 | Bacteria | 2832 |
| 321 | Ga0373946_0016709 | 3300035171 | Bacteria | 2799 |
| 322 | Ga0373955_0000455 | 3300035172 | Bacteria | 17320 |
| 323 | Ga0373955_0007664 | 3300035172 | Bacteria | 4972 |
| 324 | Ga0373955_0028015 | 3300035172 | Bacteria | 2917 |
| 325 | Ga0373942_0002202 | 3300035207 | Bacteria | 4793 |
| 326 | Ga0373962_0014836 | 3300035242 | Bacteria | 1990 |
| 327 | Ga0373931_0046566 | 3300035691 | Bacteria | 2293 |
| 328 | Ga0373935_0006381 | 3300035692 | Bacteria | 7036 |
| 329 | Ga0373935_0006524 | 3300035692 | Bacteria | 6970 |
| 330 | Ga0373935_0032478 | 3300035692 | Bacteria | 3244 |
| 331 | Ga0373935_0038744 | 3300035692 | Bacteria | 2986 |
| 332 | Ga0373927_0007639 | 3300035695 | Bacteria | 7315 |
| 333 | Ga0373927_0011114 | 3300035695 | Bacteria | 5997 |
| 334 | Ga0373927_0012295 | 3300035695 | Bacteria | 5695 |
| 335 | Ga0373933_0000346 | 3300035724 | Bacteria | 29613 |
| 336 | Ga0373933_0008589 | 3300035724 | Bacteria | 5570 |
| 337 | Ga0373933_0076276 | 3300035724 | Bacteria | 2047 |
| 338 | Ga0373947_0017970 | 3300035725 | Bacteria | 4069 |
| 339 | Ga0373947_0033249 | 3300035725 | Bacteria | 3043 |
| 340 | Ga0373937_0001412 | 3300036401 | Bacteria | 20055 |
| 341 | Ga0373937_0001801 | 3300036401 | Bacteria | 18000 |
| 342 | Ga0373937_0086258 | 3300036401 | Bacteria | 2905 |
| 343 | Ga0373937_0164477 | 3300036401 | Bacteria | 2080 |
| 344 | Ga0373937_0234069 | 3300036401 | Bacteria | 1730 |
| 345 | Ga0316584_0069178 | 3300036712 | Bacteria | 2646 |
| 346 | Ga0373925_0044581 | 3300037068 | Bacteria | 3293 |
| 347 | Ga0395905_0058698 | 3300037471 | Bacteria | 3598 |
| 348 | Ga0395901_0048377 | 3300038443 | Bacteria | 4416 |
| 349 | Ga0451576_0011826 | 3300045051 | Bacteria | 9878 |
| 350 | Ga0451576_0017147 | 3300045051 | Bacteria | 7967 |
| 351 | Ga0451576_0024507 | 3300045051 | Bacteria | 6518 |
| 352 | Ga0451576_0033809 | 3300045051 | Bacteria | 5433 |
| 353 | Ga0495592_0003017 | 3300046454 | Bacteria | 11992 |
| 354 | Ga0495592_0010557 | 3300046454 | Bacteria | 6966 |
| 355 | Ga0495629_0017952 | 3300046459 | Bacteria | 5071 |
| 356 | Ga0495629_0029634 | 3300046459 | Bacteria | 3880 |
| 357 | Ga0495629_0093222 | 3300046459 | Bacteria | 2102 |
| 358 | Ga0495638_0014772 | 3300046460 | Bacteria | 5266 |
| 359 | Ga0495651_0001035 | 3300046462 | Bacteria | 21511 |
| 360 | Ga0495653_0000572 | 3300046463 | Bacteria | 28222 |
| 361 | Ga0495580_0025165 | 3300046472 | Bacteria | 4350 |
| 362 | Ga0495582_0004723 | 3300046473 | Bacteria | 7656 |
| 363 | Ga0495639_0001757 | 3300046475 | Bacteria | 9612 |
| 364 | Ga0495662_0023730 | 3300046476 | Bacteria | 2962 |
| 365 | Ga0495664_0003799 | 3300046477 | Bacteria | 8238 |
| 366 | Ga0495594_0004523 | 3300046499 | Bacteria | 7155 |
| 367 | Ga0495606_0041358 | 3300046507 | Bacteria | 3091 |
| 368 | Ga0495608_0002256 | 3300046511 | Bacteria | 13916 |
| 369 | Ga0495608_0047834 | 3300046511 | Bacteria | 2842 |
| 370 | Ga0495618_0028875 | 3300046514 | Bacteria | 3458 |
| 371 | Ga0495618_0063698 | 3300046514 | Bacteria | 2342 |
| 372 | Ga0495628_0058601 | 3300046516 | Bacteria | 3025 |
| 373 | Ga0495628_0069896 | 3300046516 | Bacteria | 2738 |
| 374 | Ga0495628_0075538 | 3300046516 | Bacteria | 2624 |
| 375 | Ga0495630_0015635 | 3300046517 | Bacteria | 5544 |
| 376 | Ga0495643_0002439 | 3300046522 | Bacteria | 14756 |
| 377 | Ga0495652_0002502 | 3300046529 | Bacteria | 18853 |
| 378 | Ga0495665_0010611 | 3300046531 | Bacteria | 4988 |
| 379 | Ga0495640_0009293 | 3300046533 | Bacteria | 7659 |
| 380 | Ga0495640_0010409 | 3300046533 | Bacteria | 7193 |
| 381 | Ga0495640_0042165 | 3300046533 | Bacteria | 3186 |
| 382 | Ga0495586_0042136 | 3300046535 | Bacteria | 2459 |
| 383 | Ga0495587_0006519 | 3300046536 | Bacteria | 7606 |
| 384 | Ga0495667_0011111 | 3300046559 | Bacteria | 6090 |
| 385 | Ga0495668_0088374 | 3300046616 | Bacteria | 1699 |
| 386 | Ga0495634_0011584 | 3300046642 | Bacteria | 6415 |
| 387 | Ga0495625_0000182 | 3300046660 | Bacteria | 98244 |
| 388 | Ga0495625_0007605 | 3300046660 | Bacteria | 9408 |
| 389 | Ga0495625_0009571 | 3300046660 | Bacteria | 8095 |
| 390 | Ga0495635_0000241 | 3300046663 | Bacteria | 34839 |
| 391 | Ga0495635_0032155 | 3300046663 | Bacteria | 3641 |
| 392 | Ga0495657_0004360 | 3300046675 | Bacteria | 11293 |
| 393 | Ga0495599_0000148 | 3300046678 | Bacteria | 45714 |
| 394 | Ga0495599_0049182 | 3300046678 | Bacteria | 2643 |
| 395 | Ga0495646_0004040 | 3300046680 | Bacteria | 9200 |
| 396 | Ga0495646_0022874 | 3300046680 | Bacteria | 3938 |
| 397 | Ga0495647_0001153 | 3300046681 | Bacteria | 8116 |
| 398 | Ga0495658_0013073 | 3300046683 | Bacteria | 4221 |
| 399 | Ga0495658_0018942 | 3300046683 | Bacteria | 3587 |
| 400 | Ga0495658_0054870 | 3300046683 | Bacteria | 2268 |
| 401 | Ga0495624_0006586 | 3300046690 | Bacteria | 8224 |
| 402 | Ga0495624_0035544 | 3300046690 | Bacteria | 3217 |
| 403 | Ga0495624_0101757 | 3300046690 | Bacteria | 1769 |
| 404 | Ga0495649_0088374 | 3300046694 | Bacteria | 1653 |
| 405 | Ga0495600_0009200 | 3300046809 | Bacteria | 6094 |
| 406 | Ga0495581_0006366 | 3300047315 | Bacteria | 6848 |
| 407 | Ga0495604_0001413 | 3300047317 | Bacteria | 19679 |
| 408 | Ga0495604_0005073 | 3300047317 | Bacteria | 10423 |
| 409 | Ga0495604_0044782 | 3300047317 | Bacteria | 3455 |
| 410 | Ga0495604_0136546 | 3300047317 | Bacteria | 1757 |
| 411 | Ga0495674_0008912 | 3300047319 | Bacteria | 9543 |
| 412 | Ga0495674_0012043 | 3300047319 | Bacteria | 8151 |
| 413 | Ga0495674_0012075 | 3300047319 | Bacteria | 8141 |
| 414 | Ga0495674_0014103 | 3300047319 | Bacteria | 7488 |
| 415 | Ga0495674_0120577 | 3300047319 | Bacteria | 2215 |
| 416 | Ga0495676_0075304 | 3300047321 | Bacteria | 2582 |
| 417 | Ga0495676_0148708 | 3300047321 | Bacteria | 1670 |
| 418 | Ga0495680_0002177 | 3300047322 | Bacteria | 20274 |
| 419 | Ga0495680_0053351 | 3300047322 | Bacteria | 3147 |
| 420 | Ga0495675_0001603 | 3300047444 | Bacteria | 13592 |
| 421 | Ga0495684_0001447 | 3300047471 | Bacteria | 18997 |
| 422 | Ga0495684_0042652 | 3300047471 | Bacteria | 3474 |
| 423 | Ga0495684_0045884 | 3300047471 | Bacteria | 3343 |
| 424 | Ga0495684_0105322 | 3300047471 | Bacteria | 2131 |
| 425 | Ga0495593_0013362 | 3300047673 | Bacteria | 4685 |
| 426 | Ga0495593_0021216 | 3300047673 | Bacteria | 3631 |
| 427 | Ga0495593_0070896 | 3300047673 | Bacteria | 1810 |
| 428 | Ga0495602_0003318 | 3300048088 | Bacteria | 16622 |
| 429 | Ga0495602_0052458 | 3300048088 | Bacteria | 3622 |
| 430 | Ga0496101_0017030 | 3300048904 | Bacteria | 4921 |
| 431 | Ga0496101_0063591 | 3300048904 | Bacteria | 2686 |
| 432 | Ga0496101_0156513 | 3300048904 | Bacteria | 1746 |
| 433 | Ga0496102_0041102 | 3300048905 | Bacteria | 4187 |
| 434 | Ga0496102_0070572 | 3300048905 | Bacteria | 3208 |
| 435 | Ga0496102_0129742 | 3300048905 | Bacteria | 2358 |
| 436 | Ga0496103_0005938 | 3300048906 | Bacteria | 7299 |
| 437 | Ga0496103_0062350 | 3300048906 | Bacteria | 2320 |
| 438 | Ga0496104_0004332 | 3300048907 | Bacteria | 12345 |
| 439 | Ga0496104_0054969 | 3300048907 | Bacteria | 3763 |
| 440 | Ga0496104_0057574 | 3300048907 | Bacteria | 3677 |
| 441 | Ga0496104_0062109 | 3300048907 | Bacteria | 3542 |
| 442 | Ga0496104_0075451 | 3300048907 | Bacteria | 3210 |
| 443 | Ga0496105_0016921 | 3300048908 | Bacteria | 5835 |
| 444 | Ga0496105_0050735 | 3300048908 | Bacteria | 3428 |
| 445 | Ga0496105_0071853 | 3300048908 | Bacteria | 2860 |
| 446 | Ga0496105_0100825 | 3300048908 | Bacteria | 2384 |
| 447 | Ga0496106_0004025 | 3300048909 | Bacteria | 10987 |
| 448 | Ga0496106_0041892 | 3300048909 | Bacteria | 3433 |
| 449 | Ga0496106_0075850 | 3300048909 | Bacteria | 2576 |
| 450 | Ga0496107_0018111 | 3300048910 | Bacteria | 4955 |
| 451 | Ga0496107_0100484 | 3300048910 | Bacteria | 2121 |
| 452 | Ga0496108_0001479 | 3300048911 | Bacteria | 18560 |
| 453 | Ga0496108_0038860 | 3300048911 | Bacteria | 3966 |
| 454 | Ga0496109_0031710 | 3300048912 | Bacteria | 4746 |
| 455 | Ga0496110_0002118 | 3300048913 | Bacteria | 14818 |
| 456 | Ga0496110_0020761 | 3300048913 | Bacteria | 5546 |
| 457 | Ga0496111_0024330 | 3300048914 | Bacteria | 4262 |
| 458 | Ga0496112_0006792 | 3300048915 | Bacteria | 10085 |
| 459 | Ga0496113_0008271 | 3300048916 | Bacteria | 6766 |
| 460 | Ga0496114_0157074 | 3300048917 | Bacteria | 1975 |
| 461 | Ga0496115_0028143 | 3300048918 | Bacteria | 4403 |
| 462 | Ga0496115_0041834 | 3300048918 | Bacteria | 3648 |
| 463 | Ga0496115_0076637 | 3300048918 | Bacteria | 2718 |
| 464 | Ga0496118_0062490 | 3300048921 | Bacteria | 2749 |
| 465 | Ga0501031_0020063 | 3300049568 | Bacteria | 4357 |
| 466 | Ga0501036_0035485 | 3300049572 | Bacteria | 4220 |
| 467 | Ga0501037_0016273 | 3300049573 | Bacteria | 5474 |
| 468 | Ga0501037_0098554 | 3300049573 | Bacteria | 2111 |
| 469 | Ga0501042_0023030 | 3300049578 | Bacteria | 4353 |
| 470 | Ga0501046_0015815 | 3300049580 | Bacteria | 6331 |
| 471 | Ga0501048_0015915 | 3300049582 | Bacteria | 5549 |
| 472 | Ga0501067_0007251 | 3300049583 | Bacteria | 6156 |
| 473 | Ga0501068_0007720 | 3300049584 | Bacteria | 5952 |
| 474 | Ga0501069_0003375 | 3300049585 | Bacteria | 8198 |
| 475 | Ga0501071_0021937 | 3300049587 | Bacteria | 4451 |
| 476 | Ga0501073_0003818 | 3300049589 | Bacteria | 11306 |
| 477 | Ga0501074_0005542 | 3300049590 | Bacteria | 9077 |
| 478 | Ga0501077_0019895 | 3300049593 | Bacteria | 4247 |
| 479 | Ga0501079_0002850 | 3300049741 | Bacteria | 12614 |
| 480 | Ga0501080_0019849 | 3300049742 | Bacteria | 6223 |
| 481 | Ga0501081_0045275 | 3300049743 | Bacteria | 3021 |
| 482 | Ga0501083_0011167 | 3300049744 | Bacteria | 6303 |
| 483 | Ga0501035_0088860 | 3300049822 | Bacteria | 2722 |
| 484 | nmdc:mga03683_16162_c1 | 3300050489 | Bacteria | 2798 |
| 485 | nmdc:mga03n38_1205_c1 | 3300050490 | Bacteria | 7235 |
| 486 | nmdc:mga00v17_94936_c1 | 3300050491 | Bacteria | 1877 |
| 487 | nmdc:mga0yw44_28384_c1 | 3300050492 | Bacteria | 3218 |
| 488 | nmdc:mga0k408_16229_c1 | 3300050493 | Bacteria | 4129 |
| 489 | nmdc:mga04h51_13389_c1 | 3300050495 | Bacteria | 2321 |
| 490 | nmdc:mga07m45_3035_c1 | 3300050496 | Bacteria | 8009 |
| 491 | nmdc:mga05p37_231774_c1 | 3300050507 | Bacteria | 2224 |
| 492 | nmdc:mga05p37_352466_c1 | 3300050507 | Bacteria | 1732 |
| 493 | nmdc:mga09592_117220_c1 | 3300050508 | Bacteria | 2285 |
| 494 | nmdc:mga09592_156916_c1 | 3300050508 | Bacteria | 1964 |
| 495 | nmdc:mga09592_18393_c1 | 3300050508 | Bacteria | 5732 |
| 496 | nmdc:mga0qj67_26650_c1 | 3300050509 | Bacteria | 4475 |
| 497 | nmdc:mga06r32_33119_c1 | 3300050510 | Bacteria | 4866 |
| 498 | nmdc:mga06r32_5450_c1 | 3300050510 | Bacteria | 11455 |
| 499 | nmdc:mga08y16_12308_c1 | 3300050511 | Bacteria | 8997 |
| 500 | nmdc:mga08y16_48667_c1 | 3300050511 | Bacteria | 4436 |
| 501 | nmdc:mga08y16_5847_c1 | 3300050511 | Bacteria | 12888 |
| 502 | nmdc:mga0n895_196414_c1 | 3300050512 | Bacteria | 2049 |
| 503 | nmdc:mga0n895_51784_c1 | 3300050512 | Bacteria | 4028 |
| 504 | nmdc:mga0n895_86636_c1 | 3300050512 | Bacteria | 3129 |
| 505 | nmdc:mga0rr50_3665_c1 | 3300050513 | Bacteria | 8895 |
| 506 | nmdc:mga0a205_104800_c1 | 3300050515 | Bacteria | 2727 |
| 507 | nmdc:mga0a205_13024_c1 | 3300050515 | Bacteria | 7721 |
| 508 | nmdc:mga0a205_19326_c1 | 3300050515 | Bacteria | 6422 |
| 509 | nmdc:mga0a205_3972_c1 | 3300050515 | Bacteria | 13224 |
| 510 | nmdc:mga0a205_9791_c1 | 3300050515 | Bacteria | 8788 |
| 511 | Ga0495601_0000859 | 3300053077 | Bacteria | 16562 |
| 512 | Ga0495601_0001776 | 3300053077 | Bacteria | 11950 |
| 513 | Ga0495612_0005812 | 3300053078 | Bacteria | 5093 |
| 514 | Ga0495595_0000900 | 3300053084 | Bacteria | 11443 |
| 515 | Ga0495595_0058527 | 3300053084 | Bacteria | 1800 |
| 516 | Ga0495619_0002265 | 3300053085 | Bacteria | 12716 |
| 517 | Ga0495619_0002838 | 3300053085 | Bacteria | 11285 |
| 518 | Ga0495619_0005323 | 3300053085 | Bacteria | 8146 |
| 519 | Ga0500637_0010752 | 3300053178 | Bacteria | 4704 |
| 520 | Ga0501082_0000984 | 3300060353 | Bacteria | 25133 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025928 | Ga0207700_10023916 | Ga0207700_100239162 | 455 |
| 2 | 3300025911 | Ga0207654_10033715 | Ga0207654_100337152 | 468 |
| 3 | 3300053178 | Ga0500637_0010752 | Ga0500637_0010752_329_1903 | 472 |
| 4 | 3300031691 | Ga0316579_10009838 | Ga0316579_100098382 | 476 |
| 5 | 3300031727 | Ga0316576_10021235 | Ga0316576_100212353 | 476 |
| 6 | 3300031728 | Ga0316578_10007765 | Ga0316578_100077654 | 476 |
| 7 | 3300032137 | Ga0316585_10002332 | Ga0316585_100023322 | 476 |
| 8 | 3300033524 | Ga0316592_1008423 | Ga0316592_10084232 | 476 |
| 9 | 3300049744 | Ga0501083_0011167 | Ga0501083_0011167_3359_5017 | 478 |
| 10 | 3300036712 | Ga0316584_0069178 | Ga0316584_0069178_462_2096 | 479 |
| 11 | 3300009098 | Ga0105245_10005433 | Ga0105245_100054331 | 486 |
| 12 | 3300009147 | Ga0114129_10292840 | Ga0114129_102928402 | 486 |
| 13 | 3300032133 | Ga0316583_10024835 | Ga0316583_100248352 | 486 |
| 14 | 3300032139 | Ga0316580_10003474 | Ga0316580_100034743 | 486 |
| 15 | 3300050507 | nmdc:mga05p37_231774_c1 | nmdc:mga05p37_231774_c1_181_1710 | 486 |
| 16 | iso_pu_bacteria | 2883354860 | 2883357455 | 488 |
| 17 | 3300006175 | Ga0070712_100033149 | Ga0070712_1000331493 | 489 |
| 18 | 3300050512 | nmdc:mga0n895_51784_c1 | nmdc:mga0n895_51784_c1_653_2203 | 489 |
| 19 | 3300049573 | Ga0501037_0016273 | Ga0501037_0016273_471_1985 | 492 |
| 20 | 3300049583 | Ga0501067_0007251 | Ga0501067_0007251_4136_5650 | 492 |
| 21 | 3300049585 | Ga0501069_0003375 | Ga0501069_0003375_5461_6975 | 492 |
| 22 | 3300060353 | Ga0501082_0000984 | Ga0501082_0000984_11960_13474 | 492 |
| 23 | 3300003791 | Ga0055530_10000772 | Ga0055530_1000077216 | 496 |
| 24 | 3300006175 | Ga0070712_100122831 | Ga0070712_1001228311 | 496 |
| 25 | 3300013296 | Ga0157374_10047649 | Ga0157374_100476493 | 496 |
| 26 | 3300025916 | Ga0207663_10081052 | Ga0207663_100810521 | 496 |
| 27 | 3300025961 | Ga0207712_10093508 | Ga0207712_100935082 | 496 |
| 28 | 3300046460 | Ga0495638_0014772 | Ga0495638_0014772_3209_4756 | 496 |
| 29 | 3300046533 | Ga0495640_0010409 | Ga0495640_0010409_4070_5620 | 496 |
| 30 | 3300046660 | Ga0495625_0009571 | Ga0495625_0009571_3389_4936 | 496 |
| 31 | 3300046690 | Ga0495624_0101757 | Ga0495624_0101757_206_1759 | 496 |
| 32 | 3300047317 | Ga0495604_0136546 | Ga0495604_0136546_184_1734 | 496 |
| 33 | 3300047319 | Ga0495674_0012075 | Ga0495674_0012075_1926_3476 | 496 |
| 34 | 3300047322 | Ga0495680_0053351 | Ga0495680_0053351_981_2531 | 496 |
| 35 | 3300049822 | Ga0501035_0088860 | Ga0501035_0088860_331_1902 | 496 |
| 36 | 3300053085 | Ga0495619_0002265 | Ga0495619_0002265_10153_11703 | 496 |
| 37 | 3300005457 | Ga0070662_100155056 | Ga0070662_1001550561 | 497 |
| 38 | 3300009176 | Ga0105242_10020765 | Ga0105242_100207652 | 497 |
| 39 | 3300010375 | Ga0105239_10098495 | Ga0105239_100984953 | 497 |
| 40 | 3300013297 | Ga0157378_10045594 | Ga0157378_100455942 | 497 |
| 41 | 3300014969 | Ga0157376_10015168 | Ga0157376_100151684 | 497 |
| 42 | 3300025903 | Ga0207680_10047375 | Ga0207680_100473751 | 497 |
| 43 | 3300025916 | Ga0207663_10038438 | Ga0207663_100384382 | 497 |
| 44 | 3300025933 | Ga0207706_10161653 | Ga0207706_101616531 | 497 |
| 45 | 3300025934 | Ga0207686_10012100 | Ga0207686_100121002 | 497 |
| 46 | 3300026121 | Ga0207683_10029218 | Ga0207683_100292182 | 497 |
| 47 | 3300035724 | Ga0373933_0076276 | Ga0373933_0076276_343_1890 | 497 |
| 48 | 3300036401 | Ga0373937_0164477 | Ga0373937_0164477_375_1922 | 497 |
| 49 | 3300046507 | Ga0495606_0041358 | Ga0495606_0041358_1256_2833 | 497 |
| 50 | 3300048904 | Ga0496101_0017030 | Ga0496101_0017030_1908_3521 | 497 |
| 51 | 3300048907 | Ga0496104_0004332 | Ga0496104_0004332_9503_11116 | 497 |
| 52 | 3300048908 | Ga0496105_0100825 | Ga0496105_0100825_758_2371 | 497 |
| 53 | 3300048909 | Ga0496106_0041892 | Ga0496106_0041892_705_2318 | 497 |
| 54 | 3300048910 | Ga0496107_0018111 | Ga0496107_0018111_1999_3612 | 497 |
| 55 | 3300009147 | Ga0114129_10134797 | Ga0114129_101347974 | 498 |
| 56 | 3300046522 | Ga0495643_0002439 | Ga0495643_0002439_6331_7899 | 499 |
| 57 | 3300046533 | Ga0495640_0042165 | Ga0495640_0042165_979_2553 | 499 |
| 58 | 3300046535 | Ga0495586_0042136 | Ga0495586_0042136_178_1752 | 499 |
| 59 | 3300046660 | Ga0495625_0007605 | Ga0495625_0007605_2967_4535 | 499 |
| 60 | 3300046683 | Ga0495658_0054870 | Ga0495658_0054870_180_1754 | 499 |
| 61 | 3300047319 | Ga0495674_0120577 | Ga0495674_0120577_61_1635 | 499 |
| 62 | 3300046473 | Ga0495582_0004723 | Ga0495582_0004723_541_2127 | 500 |
| 63 | 3300046477 | Ga0495664_0003799 | Ga0495664_0003799_1997_3592 | 500 |
| 64 | 3300047319 | Ga0495674_0008912 | Ga0495674_0008912_5685_7280 | 500 |
| 65 | 3300047673 | Ga0495593_0070896 | Ga0495593_0070896_176_1771 | 500 |
| 66 | 3300006358 | Ga0068871_100074223 | Ga0068871_1000742233 | 501 |
| 67 | 3300009098 | Ga0105245_10148831 | Ga0105245_101488312 | 501 |
| 68 | 3300009148 | Ga0105243_10071869 | Ga0105243_100718693 | 501 |
| 69 | 3300047321 | Ga0495676_0148708 | Ga0495676_0148708_68_1654 | 501 |
| 70 | 3300049743 | Ga0501081_0045275 | Ga0501081_0045275_441_2012 | 501 |
| 71 | 3300050508 | nmdc:mga09592_156916_c1 | nmdc:mga09592_156916_c1_67_1632 | 501 |
| 72 | 3300050511 | nmdc:mga08y16_5847_c1 | nmdc:mga08y16_5847_c1_10181_11776 | 501 |
| 73 | 3300050512 | nmdc:mga0n895_196414_c1 | nmdc:mga0n895_196414_c1_146_1729 | 501 |
| 74 | 3300050515 | nmdc:mga0a205_19326_c1 | nmdc:mga0a205_19326_c1_56_1651 | 501 |
| 75 | 3300050515 | nmdc:mga0a205_3972_c1 | nmdc:mga0a205_3972_c1_6908_8491 | 501 |
| 76 | 3300005937 | Ga0081455_10036833 | Ga0081455_100368334 | 502 |
| 77 | 3300005937 | Ga0081455_10084704 | Ga0081455_100847041 | 502 |
| 78 | 3300005983 | Ga0081540_1005093 | Ga0081540_100509311 | 502 |
| 79 | 3300031616 | Ga0307508_10109406 | Ga0307508_101094063 | 502 |
| 80 | 3300005340 | Ga0070689_100087191 | Ga0070689_1000871912 | 503 |
| 81 | 3300005341 | Ga0070691_10005763 | Ga0070691_100057632 | 503 |
| 82 | 3300005343 | Ga0070687_100013573 | Ga0070687_1000135733 | 503 |
| 83 | 3300005549 | Ga0070704_100022448 | Ga0070704_1000224483 | 503 |
| 84 | 3300005563 | Ga0068855_100189705 | Ga0068855_1001897052 | 503 |
| 85 | 3300005718 | Ga0068866_10002035 | Ga0068866_100020356 | 503 |
| 86 | 3300005842 | Ga0068858_100086640 | Ga0068858_1000866402 | 503 |
| 87 | 3300005844 | Ga0068862_100002530 | Ga0068862_10000253011 | 503 |
| 88 | 3300005937 | Ga0081455_10123836 | Ga0081455_101238362 | 503 |
| 89 | 3300009174 | Ga0105241_10080107 | Ga0105241_100801071 | 503 |
| 90 | 3300014326 | Ga0157380_10058382 | Ga0157380_100583823 | 503 |
| 91 | 3300025899 | Ga0207642_10001449 | Ga0207642_100014491 | 503 |
| 92 | 3300025901 | Ga0207688_10035643 | Ga0207688_100356432 | 503 |
| 93 | 3300025918 | Ga0207662_10064416 | Ga0207662_100644162 | 503 |
| 94 | 3300025927 | Ga0207687_10041590 | Ga0207687_100415903 | 503 |
| 95 | 3300025949 | Ga0207667_10126912 | Ga0207667_101269122 | 503 |
| 96 | 3300026035 | Ga0207703_10039372 | Ga0207703_100393722 | 503 |
| 97 | 3300026118 | Ga0207675_100151787 | Ga0207675_1001517872 | 503 |
| 98 | 3300028380 | Ga0268265_10009578 | Ga0268265_100095783 | 503 |
| 99 | 3300035691 | Ga0373931_0046566 | Ga0373931_0046566_45_1628 | 503 |
| 100 | 3300050508 | nmdc:mga09592_117220_c1 | nmdc:mga09592_117220_c1_227_1807 | 503 |
| 101 | 3300005336 | Ga0070680_100047428 | Ga0070680_1000474282 | 504 |
| 102 | 3300005338 | Ga0068868_100011672 | Ga0068868_1000116723 | 504 |
| 103 | 3300005353 | Ga0070669_100013120 | Ga0070669_1000131203 | 504 |
| 104 | 3300005438 | Ga0070701_10011707 | Ga0070701_100117072 | 504 |
| 105 | 3300005440 | Ga0070705_100002165 | Ga0070705_1000021657 | 504 |
| 106 | 3300005441 | Ga0070700_100014427 | Ga0070700_1000144273 | 504 |
| 107 | 3300005441 | Ga0070700_100056842 | Ga0070700_1000568422 | 504 |
| 108 | 3300005444 | Ga0070694_100018354 | Ga0070694_1000183543 | 504 |
| 109 | 3300005458 | Ga0070681_10027205 | Ga0070681_100272054 | 504 |
| 110 | 3300005530 | Ga0070679_100230872 | Ga0070679_1002308721 | 504 |
| 111 | 3300005546 | Ga0070696_100000102 | Ga0070696_1000001023 | 504 |
| 112 | 3300005547 | Ga0070693_100000047 | Ga0070693_10000004744 | 504 |
| 113 | 3300005577 | Ga0068857_100048364 | Ga0068857_1000483642 | 504 |
| 114 | 3300005614 | Ga0068856_100089348 | Ga0068856_1000893482 | 504 |
| 115 | 3300005615 | Ga0070702_100005312 | Ga0070702_1000053122 | 504 |
| 116 | 3300005615 | Ga0070702_100015137 | Ga0070702_1000151372 | 504 |
| 117 | 3300005719 | Ga0068861_100070118 | Ga0068861_1000701182 | 504 |
| 118 | 3300005719 | Ga0068861_100111386 | Ga0068861_1001113862 | 504 |
| 119 | 3300005844 | Ga0068862_100022589 | Ga0068862_1000225896 | 504 |
| 120 | 3300006237 | Ga0097621_100000882 | Ga0097621_1000008822 | 504 |
| 121 | 3300006358 | Ga0068871_100001763 | Ga0068871_1000017633 | 504 |
| 122 | 3300006358 | Ga0068871_100055591 | Ga0068871_1000555912 | 504 |
| 123 | 3300006881 | Ga0068865_100029827 | Ga0068865_1000298273 | 504 |
| 124 | 3300007076 | Ga0075435_100021597 | Ga0075435_1000215973 | 504 |
| 125 | 3300009094 | Ga0111539_10061824 | Ga0111539_100618243 | 504 |
| 126 | 3300009553 | Ga0105249_10034516 | Ga0105249_100345163 | 504 |
| 127 | 3300013297 | Ga0157378_10122497 | Ga0157378_101224972 | 504 |
| 128 | 3300014968 | Ga0157379_10120107 | Ga0157379_101201072 | 504 |
| 129 | 3300014969 | Ga0157376_10029778 | Ga0157376_100297785 | 504 |
| 130 | 3300025904 | Ga0207647_10041878 | Ga0207647_100418783 | 504 |
| 131 | 3300025912 | Ga0207707_10084818 | Ga0207707_100848183 | 504 |
| 132 | 3300025917 | Ga0207660_10013544 | Ga0207660_100135444 | 504 |
| 133 | 3300025933 | Ga0207706_10002877 | Ga0207706_1000287717 | 504 |
| 134 | 3300025934 | Ga0207686_10002158 | Ga0207686_100021584 | 504 |
| 135 | 3300025935 | Ga0207709_10009666 | Ga0207709_100096664 | 504 |
| 136 | 3300025938 | Ga0207704_10027987 | Ga0207704_100279872 | 504 |
| 137 | 3300025940 | Ga0207691_10138318 | Ga0207691_101383182 | 504 |
| 138 | 3300025942 | Ga0207689_10059789 | Ga0207689_100597892 | 504 |
| 139 | 3300025961 | Ga0207712_10084526 | Ga0207712_100845262 | 504 |
| 140 | 3300026023 | Ga0207677_10074340 | Ga0207677_100743403 | 504 |
| 141 | 3300026035 | Ga0207703_10056590 | Ga0207703_100565902 | 504 |
| 142 | 3300026075 | Ga0207708_10036476 | Ga0207708_100364763 | 504 |
| 143 | 3300026075 | Ga0207708_10044601 | Ga0207708_100446014 | 504 |
| 144 | 3300026078 | Ga0207702_10079341 | Ga0207702_100793412 | 504 |
| 145 | 3300026089 | Ga0207648_10037259 | Ga0207648_100372593 | 504 |
| 146 | 3300026116 | Ga0207674_10052231 | Ga0207674_100522315 | 504 |
| 147 | 3300026118 | Ga0207675_100155720 | Ga0207675_1001557202 | 504 |
| 148 | 3300026142 | Ga0207698_10143721 | Ga0207698_101437211 | 504 |
| 149 | 3300028380 | Ga0268265_10000839 | Ga0268265_1000083910 | 504 |
| 150 | 3300035088 | Ga0373940_0000745 | Ga0373940_0000745_2690_4297 | 504 |
| 151 | 3300035111 | Ga0373923_0030264 | Ga0373923_0030264_38_1645 | 504 |
| 152 | 3300035112 | Ga0373932_0006812 | Ga0373932_0006812_1073_2680 | 504 |
| 153 | 3300035118 | Ga0373954_0005480 | Ga0373954_0005480_2014_3624 | 504 |
| 154 | 3300035119 | Ga0373956_0013972 | Ga0373956_0013972_492_2102 | 504 |
| 155 | 3300035119 | Ga0373956_0046157 | Ga0373956_0046157_137_1747 | 504 |
| 156 | 3300035120 | Ga0373957_0012793 | Ga0373957_0012793_1150_2760 | 504 |
| 157 | 3300035172 | Ga0373955_0007664 | Ga0373955_0007664_1855_3465 | 504 |
| 158 | 3300035172 | Ga0373955_0028015 | Ga0373955_0028015_254_1864 | 504 |
| 159 | 3300035207 | Ga0373942_0002202 | Ga0373942_0002202_343_1950 | 504 |
| 160 | 3300035242 | Ga0373962_0014836 | Ga0373962_0014836_112_1719 | 504 |
| 161 | 3300035692 | Ga0373935_0006524 | Ga0373935_0006524_802_2409 | 504 |
| 162 | 3300035695 | Ga0373927_0007639 | Ga0373927_0007639_4502_6109 | 504 |
| 163 | 3300035724 | Ga0373933_0008589 | Ga0373933_0008589_1795_3405 | 504 |
| 164 | 3300035725 | Ga0373947_0033249 | Ga0373947_0033249_1070_2677 | 504 |
| 165 | 3300036401 | Ga0373937_0001801 | Ga0373937_0001801_13397_15007 | 504 |
| 166 | 3300036401 | Ga0373937_0086258 | Ga0373937_0086258_840_2447 | 504 |
| 167 | 3300036401 | Ga0373937_0234069 | Ga0373937_0234069_42_1634 | 504 |
| 168 | 3300045051 | Ga0451576_0011826 | Ga0451576_0011826_5791_7392 | 504 |
| 169 | 3300045051 | Ga0451576_0024507 | Ga0451576_0024507_2214_3821 | 504 |
| 170 | 3300046454 | Ga0495592_0010557 | Ga0495592_0010557_483_2090 | 504 |
| 171 | 3300046472 | Ga0495580_0025165 | Ga0495580_0025165_2570_4177 | 504 |
| 172 | 3300046475 | Ga0495639_0001757 | Ga0495639_0001757_229_1836 | 504 |
| 173 | 3300046476 | Ga0495662_0023730 | Ga0495662_0023730_483_2090 | 504 |
| 174 | 3300046499 | Ga0495594_0004523 | Ga0495594_0004523_67_1674 | 504 |
| 175 | 3300046511 | Ga0495608_0047834 | Ga0495608_0047834_1054_2664 | 504 |
| 176 | 3300046514 | Ga0495618_0063698 | Ga0495618_0063698_478_2088 | 504 |
| 177 | 3300046516 | Ga0495628_0058601 | Ga0495628_0058601_97_1704 | 504 |
| 178 | 3300046517 | Ga0495630_0015635 | Ga0495630_0015635_1054_2661 | 504 |
| 179 | 3300046531 | Ga0495665_0010611 | Ga0495665_0010611_2046_3653 | 504 |
| 180 | 3300046533 | Ga0495640_0009293 | Ga0495640_0009293_1670_3277 | 504 |
| 181 | 3300046642 | Ga0495634_0011584 | Ga0495634_0011584_3492_5099 | 504 |
| 182 | 3300046680 | Ga0495646_0022874 | Ga0495646_0022874_1181_2788 | 504 |
| 183 | 3300046681 | Ga0495647_0001153 | Ga0495647_0001153_5487_7094 | 504 |
| 184 | 3300046683 | Ga0495658_0018942 | Ga0495658_0018942_961_2568 | 504 |
| 185 | 3300046690 | Ga0495624_0006586 | Ga0495624_0006586_5547_7154 | 504 |
| 186 | 3300046690 | Ga0495624_0035544 | Ga0495624_0035544_892_2508 | 504 |
| 187 | 3300047315 | Ga0495581_0006366 | Ga0495581_0006366_4744_6351 | 504 |
| 188 | 3300047317 | Ga0495604_0044782 | Ga0495604_0044782_178_1788 | 504 |
| 189 | 3300047319 | Ga0495674_0012043 | Ga0495674_0012043_1013_2620 | 504 |
| 190 | 3300047321 | Ga0495676_0075304 | Ga0495676_0075304_591_2198 | 504 |
| 191 | 3300047471 | Ga0495684_0042652 | Ga0495684_0042652_152_1759 | 504 |
| 192 | 3300047471 | Ga0495684_0045884 | Ga0495684_0045884_1213_2823 | 504 |
| 193 | 3300047471 | Ga0495684_0105322 | Ga0495684_0105322_452_2062 | 504 |
| 194 | 3300047673 | Ga0495593_0013362 | Ga0495593_0013362_2948_4555 | 504 |
| 195 | 3300048088 | Ga0495602_0052458 | Ga0495602_0052458_1239_2849 | 504 |
| 196 | 3300049568 | Ga0501031_0020063 | Ga0501031_0020063_1359_2969 | 504 |
| 197 | 3300049572 | Ga0501036_0035485 | Ga0501036_0035485_654_2264 | 504 |
| 198 | 3300049573 | Ga0501037_0098554 | Ga0501037_0098554_117_1727 | 504 |
| 199 | 3300049578 | Ga0501042_0023030 | Ga0501042_0023030_1408_3018 | 504 |
| 200 | 3300049580 | Ga0501046_0015815 | Ga0501046_0015815_1301_2911 | 504 |
| 201 | 3300049582 | Ga0501048_0015915 | Ga0501048_0015915_3551_5161 | 504 |
| 202 | 3300049584 | Ga0501068_0007720 | Ga0501068_0007720_2953_4536 | 504 |
| 203 | 3300049587 | Ga0501071_0021937 | Ga0501071_0021937_1276_2859 | 504 |
| 204 | 3300049589 | Ga0501073_0003818 | Ga0501073_0003818_2905_4488 | 504 |
| 205 | 3300049590 | Ga0501074_0005542 | Ga0501074_0005542_5777_7360 | 504 |
| 206 | 3300049593 | Ga0501077_0019895 | Ga0501077_0019895_1431_3014 | 504 |
| 207 | 3300049741 | Ga0501079_0002850 | Ga0501079_0002850_4013_5596 | 504 |
| 208 | 3300049742 | Ga0501080_0019849 | Ga0501080_0019849_532_2115 | 504 |
| 209 | 3300050511 | nmdc:mga08y16_48667_c1 | nmdc:mga08y16_48667_c1_1879_3477 | 504 |
| 210 | iso_pu_bacteria | 2906610324 | 2906614822 | 504 |
| 211 | iso_pu_bacteria | 2922425934 | 2922433290 | 504 |
| 212 | 3300005434 | Ga0070709_10001799 | Ga0070709_1000179910 | 505 |
| 213 | 3300005437 | Ga0070710_10005029 | Ga0070710_100050292 | 505 |
| 214 | 3300005842 | Ga0068858_100024518 | Ga0068858_1000245184 | 505 |
| 215 | 3300005983 | Ga0081540_1034919 | Ga0081540_10349192 | 505 |
| 216 | 3300006173 | Ga0070716_100002533 | Ga0070716_1000025332 | 505 |
| 217 | 3300006175 | Ga0070712_100009149 | Ga0070712_1000091495 | 505 |
| 218 | 3300006237 | Ga0097621_100010060 | Ga0097621_1000100603 | 505 |
| 219 | 3300006358 | Ga0068871_100029949 | Ga0068871_1000299495 | 505 |
| 220 | 3300009177 | Ga0105248_10055812 | Ga0105248_100558122 | 505 |
| 221 | 3300013296 | Ga0157374_10003302 | Ga0157374_100033028 | 505 |
| 222 | 3300013297 | Ga0157378_10019103 | Ga0157378_100191035 | 505 |
| 223 | 3300013306 | Ga0163162_10013586 | Ga0163162_100135863 | 505 |
| 224 | 3300013308 | Ga0157375_10003981 | Ga0157375_100039818 | 505 |
| 225 | 3300014968 | Ga0157379_10031754 | Ga0157379_100317542 | 505 |
| 226 | 3300014969 | Ga0157376_10002629 | Ga0157376_100026295 | 505 |
| 227 | 3300025898 | Ga0207692_10003085 | Ga0207692_100030857 | 505 |
| 228 | 3300025915 | Ga0207693_10015774 | Ga0207693_100157742 | 505 |
| 229 | 3300025936 | Ga0207670_10093682 | Ga0207670_100936821 | 505 |
| 230 | 3300025939 | Ga0207665_10033458 | Ga0207665_100334582 | 505 |
| 231 | 3300025941 | Ga0207711_10035097 | Ga0207711_100350972 | 505 |
| 232 | 3300025986 | Ga0207658_10015221 | Ga0207658_100152215 | 505 |
| 233 | 3300026035 | Ga0207703_10027177 | Ga0207703_100271772 | 505 |
| 234 | 3300031238 | Ga0265332_10000096 | Ga0265332_100000967 | 505 |
| 235 | 3300031239 | Ga0265328_10007779 | Ga0265328_100077794 | 505 |
| 236 | 3300031242 | Ga0265329_10005325 | Ga0265329_100053254 | 505 |
| 237 | 3300031250 | Ga0265331_10000184 | Ga0265331_1000018459 | 505 |
| 238 | 3300031344 | Ga0265316_10000620 | Ga0265316_1000062030 | 505 |
| 239 | 3300031711 | Ga0265314_10001965 | Ga0265314_100019658 | 505 |
| 240 | 3300031712 | Ga0265342_10001874 | Ga0265342_1000187415 | 505 |
| 241 | 3300046660 | Ga0495625_0000182 | Ga0495625_0000182_76469_78082 | 505 |
| 242 | 3300048907 | Ga0496104_0062109 | Ga0496104_0062109_75_1685 | 505 |
| 243 | 3300048908 | Ga0496105_0071853 | Ga0496105_0071853_1159_2769 | 505 |
| 244 | 3300048918 | Ga0496115_0076637 | Ga0496115_0076637_130_1740 | 505 |
| 245 | 3300031247 | Ga0265340_10031213 | Ga0265340_100312131 | 506 |
| 246 | 3300035692 | Ga0373935_0038744 | Ga0373935_0038744_1356_2960 | 506 |
| 247 | 3300035695 | Ga0373927_0011114 | Ga0373927_0011114_2550_4154 | 506 |
| 248 | 3300045051 | Ga0451576_0033809 | Ga0451576_0033809_3208_4794 | 506 |
| 249 | 3300047317 | Ga0495604_0005073 | Ga0495604_0005073_3526_5139 | 506 |
| 250 | 3300006847 | Ga0075431_100006700 | Ga0075431_1000067006 | 507 |
| 251 | 3300007076 | Ga0075435_100015161 | Ga0075435_1000151612 | 507 |
| 252 | 3300009094 | Ga0111539_10008802 | Ga0111539_100088021 | 507 |
| 253 | 3300027907 | Ga0207428_10004626 | Ga0207428_100046261 | 507 |
| 254 | 3300035112 | Ga0373932_0008631 | Ga0373932_0008631_456_2030 | 507 |
| 255 | 3300048905 | Ga0496102_0070572 | Ga0496102_0070572_572_2176 | 507 |
| 256 | 3300048906 | Ga0496103_0062350 | Ga0496103_0062350_182_1756 | 507 |
| 257 | 3300048907 | Ga0496104_0054969 | Ga0496104_0054969_483_2087 | 507 |
| 258 | 3300048908 | Ga0496105_0050735 | Ga0496105_0050735_1172_2776 | 507 |
| 259 | 3300048917 | Ga0496114_0157074 | Ga0496114_0157074_137_1741 | 507 |
| 260 | 3300050510 | nmdc:mga06r32_5450_c1 | nmdc:mga06r32_5450_c1_4214_5815 | 507 |
| 261 | 3300050511 | nmdc:mga08y16_12308_c1 | nmdc:mga08y16_12308_c1_372_1994 | 507 |
| 262 | 3300050512 | nmdc:mga0n895_86636_c1 | nmdc:mga0n895_86636_c1_233_1822 | 507 |
| 263 | 3300050513 | nmdc:mga0rr50_3665_c1 | nmdc:mga0rr50_3665_c1_3019_4608 | 507 |
| 264 | 3300050515 | nmdc:mga0a205_9791_c1 | nmdc:mga0a205_9791_c1_7031_8620 | 507 |
| 265 | 3300005295 | Ga0065707_10104037 | Ga0065707_101040372 | 508 |
| 266 | 3300006852 | Ga0075433_10011372 | Ga0075433_100113723 | 508 |
| 267 | 3300006871 | Ga0075434_100096823 | Ga0075434_1000968232 | 508 |
| 268 | 3300009011 | Ga0105251_10023425 | Ga0105251_100234251 | 508 |
| 269 | 3300031241 | Ga0265325_10000520 | Ga0265325_100005208 | 508 |
| 270 | 3300031249 | Ga0265339_10006085 | Ga0265339_100060852 | 508 |
| 271 | 3300031250 | Ga0265331_10000175 | Ga0265331_1000017569 | 508 |
| 272 | 3300031711 | Ga0265314_10000310 | Ga0265314_1000031065 | 508 |
| 273 | 3300035692 | Ga0373935_0006381 | Ga0373935_0006381_1747_3372 | 508 |
| 274 | 3300038443 | Ga0395901_0048377 | Ga0395901_0048377_2244_4196 | 508 |
| 275 | 3300050515 | nmdc:mga0a205_13024_c1 | nmdc:mga0a205_13024_c1_2938_4548 | 508 |
| 276 | 3300002070 | JGI24750J21931_1000805 | JGI24750J21931_10008053 | 509 |
| 277 | 3300003659 | JGI25404J52841_10001818 | JGI25404J52841_100018182 | 509 |
| 278 | 3300005293 | Ga0065715_10127930 | Ga0065715_101279301 | 509 |
| 279 | 3300005295 | Ga0065707_10128452 | Ga0065707_101284521 | 509 |
| 280 | 3300005328 | Ga0070676_10022795 | Ga0070676_100227951 | 509 |
| 281 | 3300005330 | Ga0070690_100071878 | Ga0070690_1000718781 | 509 |
| 282 | 3300005331 | Ga0070670_100004932 | Ga0070670_1000049326 | 509 |
| 283 | 3300005334 | Ga0068869_100018568 | Ga0068869_1000185682 | 509 |
| 284 | 3300005336 | Ga0070680_100032845 | Ga0070680_1000328454 | 509 |
| 285 | 3300005339 | Ga0070660_100018168 | Ga0070660_1000181684 | 509 |
| 286 | 3300005340 | Ga0070689_100016960 | Ga0070689_1000169604 | 509 |
| 287 | 3300005347 | Ga0070668_100018833 | Ga0070668_1000188335 | 509 |
| 288 | 3300005353 | Ga0070669_100050048 | Ga0070669_1000500483 | 509 |
| 289 | 3300005364 | Ga0070673_100003866 | Ga0070673_1000038664 | 509 |
| 290 | 3300005364 | Ga0070673_100052173 | Ga0070673_1000521731 | 509 |
| 291 | 3300005366 | Ga0070659_100055335 | Ga0070659_1000553352 | 509 |
| 292 | 3300005367 | Ga0070667_100016350 | Ga0070667_1000163504 | 509 |
| 293 | 3300005434 | Ga0070709_10018957 | Ga0070709_100189572 | 509 |
| 294 | 3300005435 | Ga0070714_100037354 | Ga0070714_1000373542 | 509 |
| 295 | 3300005436 | Ga0070713_100013734 | Ga0070713_1000137342 | 509 |
| 296 | 3300005440 | Ga0070705_100115943 | Ga0070705_1001159431 | 509 |
| 297 | 3300005441 | Ga0070700_100040353 | Ga0070700_1000403533 | 509 |
| 298 | 3300005444 | Ga0070694_100046682 | Ga0070694_1000466821 | 509 |
| 299 | 3300005455 | Ga0070663_100002602 | Ga0070663_1000026028 | 509 |
| 300 | 3300005455 | Ga0070663_100010426 | Ga0070663_1000104265 | 509 |
| 301 | 3300005456 | Ga0070678_100028092 | Ga0070678_1000280925 | 509 |
| 302 | 3300005456 | Ga0070678_100037457 | Ga0070678_1000374572 | 509 |
| 303 | 3300005457 | Ga0070662_100042070 | Ga0070662_1000420703 | 509 |
| 304 | 3300005459 | Ga0068867_100022822 | Ga0068867_1000228223 | 509 |
| 305 | 3300005466 | Ga0070685_10007483 | Ga0070685_100074833 | 509 |
| 306 | 3300005466 | Ga0070685_10029958 | Ga0070685_100299582 | 509 |
| 307 | 3300005518 | Ga0070699_100038139 | Ga0070699_1000381392 | 509 |
| 308 | 3300005535 | Ga0070684_100019408 | Ga0070684_1000194081 | 509 |
| 309 | 3300005535 | Ga0070684_100041500 | Ga0070684_1000415002 | 509 |
| 310 | 3300005539 | Ga0068853_100171713 | Ga0068853_1001717131 | 509 |
| 311 | 3300005544 | Ga0070686_100112851 | Ga0070686_1001128511 | 509 |
| 312 | 3300005545 | Ga0070695_100045648 | Ga0070695_1000456482 | 509 |
| 313 | 3300005547 | Ga0070693_100020072 | Ga0070693_1000200722 | 509 |
| 314 | 3300005548 | Ga0070665_100036167 | Ga0070665_1000361672 | 509 |
| 315 | 3300005563 | Ga0068855_100059733 | Ga0068855_1000597333 | 509 |
| 316 | 3300005578 | Ga0068854_100086846 | Ga0068854_1000868463 | 509 |
| 317 | 3300005616 | Ga0068852_100116116 | Ga0068852_1001161163 | 509 |
| 318 | 3300005617 | Ga0068859_100072533 | Ga0068859_1000725332 | 509 |
| 319 | 3300005618 | Ga0068864_100022592 | Ga0068864_1000225922 | 509 |
| 320 | 3300005618 | Ga0068864_100027765 | Ga0068864_1000277651 | 509 |
| 321 | 3300005719 | Ga0068861_100049768 | Ga0068861_1000497683 | 509 |
| 322 | 3300005719 | Ga0068861_100062578 | Ga0068861_1000625781 | 509 |
| 323 | 3300005840 | Ga0068870_10000839 | Ga0068870_1000083910 | 509 |
| 324 | 3300005841 | Ga0068863_100124278 | Ga0068863_1001242782 | 509 |
| 325 | 3300005841 | Ga0068863_100129809 | Ga0068863_1001298091 | 509 |
| 326 | 3300005841 | Ga0068863_100135733 | Ga0068863_1001357331 | 509 |
| 327 | 3300005842 | Ga0068858_100035223 | Ga0068858_1000352232 | 509 |
| 328 | 3300005842 | Ga0068858_100073135 | Ga0068858_1000731352 | 509 |
| 329 | 3300005843 | Ga0068860_100023260 | Ga0068860_1000232604 | 509 |
| 330 | 3300005843 | Ga0068860_100041626 | Ga0068860_1000416262 | 509 |
| 331 | 3300005843 | Ga0068860_100134682 | Ga0068860_1001346823 | 509 |
| 332 | 3300005844 | Ga0068862_100035208 | Ga0068862_1000352081 | 509 |
| 333 | 3300005983 | Ga0081540_1002128 | Ga0081540_10021287 | 509 |
| 334 | 3300005983 | Ga0081540_1004473 | Ga0081540_10044735 | 509 |
| 335 | 3300005983 | Ga0081540_1005381 | Ga0081540_10053814 | 509 |
| 336 | 3300005983 | Ga0081540_1038843 | Ga0081540_10388432 | 509 |
| 337 | 3300006028 | Ga0070717_10067029 | Ga0070717_100670292 | 509 |
| 338 | 3300006038 | Ga0075365_10022919 | Ga0075365_100229194 | 509 |
| 339 | 3300006051 | Ga0075364_10020684 | Ga0075364_100206841 | 509 |
| 340 | 3300006163 | Ga0070715_10041065 | Ga0070715_100410651 | 509 |
| 341 | 3300006175 | Ga0070712_100015400 | Ga0070712_1000154002 | 509 |
| 342 | 3300006177 | Ga0075362_10019926 | Ga0075362_100199262 | 509 |
| 343 | 3300006178 | Ga0075367_10014425 | Ga0075367_100144254 | 509 |
| 344 | 3300006178 | Ga0075367_10043976 | Ga0075367_100439761 | 509 |
| 345 | 3300006186 | Ga0075369_10003558 | Ga0075369_100035583 | 509 |
| 346 | 3300006186 | Ga0075369_10051112 | Ga0075369_100511121 | 509 |
| 347 | 3300006195 | Ga0075366_10052943 | Ga0075366_100529431 | 509 |
| 348 | 3300006237 | Ga0097621_100005781 | Ga0097621_1000057819 | 509 |
| 349 | 3300006353 | Ga0075370_10015429 | Ga0075370_100154291 | 509 |
| 350 | 3300006358 | Ga0068871_100005451 | Ga0068871_1000054515 | 509 |
| 351 | 3300006358 | Ga0068871_100059950 | Ga0068871_1000599503 | 509 |
| 352 | 3300006871 | Ga0075434_100099559 | Ga0075434_1000995592 | 509 |
| 353 | 3300006881 | Ga0068865_100071256 | Ga0068865_1000712562 | 509 |
| 354 | 3300006931 | Ga0097620_100072533 | Ga0097620_1000725332 | 509 |
| 355 | 3300009092 | Ga0105250_10022309 | Ga0105250_100223093 | 509 |
| 356 | 3300009098 | Ga0105245_10012782 | Ga0105245_100127826 | 509 |
| 357 | 3300009147 | Ga0114129_10024876 | Ga0114129_1002487611 | 509 |
| 358 | 3300009174 | Ga0105241_10005406 | Ga0105241_100054064 | 509 |
| 359 | 3300009174 | Ga0105241_10045709 | Ga0105241_100457093 | 509 |
| 360 | 3300009176 | Ga0105242_10003659 | Ga0105242_100036592 | 509 |
| 361 | 3300009176 | Ga0105242_10181536 | Ga0105242_101815361 | 509 |
| 362 | 3300009177 | Ga0105248_10008408 | Ga0105248_100084088 | 509 |
| 363 | 3300009177 | Ga0105248_10027007 | Ga0105248_100270075 | 509 |
| 364 | 3300009545 | Ga0105237_10022221 | Ga0105237_100222212 | 509 |
| 365 | 3300010375 | Ga0105239_10025578 | Ga0105239_100255786 | 509 |
| 366 | 3300010375 | Ga0105239_10109967 | Ga0105239_101099672 | 509 |
| 367 | 3300011119 | Ga0105246_10133486 | Ga0105246_101334861 | 509 |
| 368 | 3300013296 | Ga0157374_10047297 | Ga0157374_100472973 | 509 |
| 369 | 3300013297 | Ga0157378_10024710 | Ga0157378_100247105 | 509 |
| 370 | 3300013297 | Ga0157378_10029534 | Ga0157378_100295342 | 509 |
| 371 | 3300013306 | Ga0163162_10043427 | Ga0163162_100434274 | 509 |
| 372 | 3300014325 | Ga0163163_10046035 | Ga0163163_100460354 | 509 |
| 373 | 3300014325 | Ga0163163_10085243 | Ga0163163_100852432 | 509 |
| 374 | 3300014326 | Ga0157380_10179324 | Ga0157380_101793241 | 509 |
| 375 | 3300014968 | Ga0157379_10054072 | Ga0157379_100540723 | 509 |
| 376 | 3300014968 | Ga0157379_10148866 | Ga0157379_101488661 | 509 |
| 377 | 3300014969 | Ga0157376_10002379 | Ga0157376_1000237912 | 509 |
| 378 | 3300014969 | Ga0157376_10018085 | Ga0157376_100180853 | 509 |
| 379 | 3300014969 | Ga0157376_10058643 | Ga0157376_100586433 | 509 |
| 380 | 3300017792 | Ga0163161_10039279 | Ga0163161_100392791 | 509 |
| 381 | 3300025271 | Ga0207666_1000064 | Ga0207666_10000641 | 509 |
| 382 | 3300025711 | Ga0207696_1016932 | Ga0207696_10169321 | 509 |
| 383 | 3300025900 | Ga0207710_10001979 | Ga0207710_100019795 | 509 |
| 384 | 3300025906 | Ga0207699_10007364 | Ga0207699_100073643 | 509 |
| 385 | 3300025907 | Ga0207645_10017820 | Ga0207645_100178203 | 509 |
| 386 | 3300025911 | Ga0207654_10003273 | Ga0207654_100032734 | 509 |
| 387 | 3300025911 | Ga0207654_10060150 | Ga0207654_100601502 | 509 |
| 388 | 3300025915 | Ga0207693_10004125 | Ga0207693_100041255 | 509 |
| 389 | 3300025915 | Ga0207693_10018993 | Ga0207693_100189934 | 509 |
| 390 | 3300025916 | Ga0207663_10011825 | Ga0207663_100118254 | 509 |
| 391 | 3300025917 | Ga0207660_10095067 | Ga0207660_100950673 | 509 |
| 392 | 3300025920 | Ga0207649_10069394 | Ga0207649_100693943 | 509 |
| 393 | 3300025923 | Ga0207681_10111143 | Ga0207681_101111431 | 509 |
| 394 | 3300025925 | Ga0207650_10002016 | Ga0207650_100020164 | 509 |
| 395 | 3300025927 | Ga0207687_10013910 | Ga0207687_100139102 | 509 |
| 396 | 3300025928 | Ga0207700_10007998 | Ga0207700_100079986 | 509 |
| 397 | 3300025931 | Ga0207644_10081738 | Ga0207644_100817381 | 509 |
| 398 | 3300025932 | Ga0207690_10012193 | Ga0207690_100121934 | 509 |
| 399 | 3300025933 | Ga0207706_10025291 | Ga0207706_100252912 | 509 |
| 400 | 3300025933 | Ga0207706_10031111 | Ga0207706_100311113 | 509 |
| 401 | 3300025935 | Ga0207709_10113749 | Ga0207709_101137491 | 509 |
| 402 | 3300025936 | Ga0207670_10035216 | Ga0207670_100352164 | 509 |
| 403 | 3300025937 | Ga0207669_10033709 | Ga0207669_100337093 | 509 |
| 404 | 3300025942 | Ga0207689_10013624 | Ga0207689_100136242 | 509 |
| 405 | 3300025942 | Ga0207689_10023117 | Ga0207689_100231173 | 509 |
| 406 | 3300025942 | Ga0207689_10072443 | Ga0207689_100724433 | 509 |
| 407 | 3300025949 | Ga0207667_10113101 | Ga0207667_101131012 | 509 |
| 408 | 3300025960 | Ga0207651_10056318 | Ga0207651_100563182 | 509 |
| 409 | 3300025961 | Ga0207712_10015086 | Ga0207712_100150863 | 509 |
| 410 | 3300025961 | Ga0207712_10034675 | Ga0207712_100346753 | 509 |
| 411 | 3300025972 | Ga0207668_10006761 | Ga0207668_100067617 | 509 |
| 412 | 3300025972 | Ga0207668_10014835 | Ga0207668_100148353 | 509 |
| 413 | 3300025986 | Ga0207658_10018489 | Ga0207658_100184891 | 509 |
| 414 | 3300025986 | Ga0207658_10076641 | Ga0207658_100766411 | 509 |
| 415 | 3300026035 | Ga0207703_10020753 | Ga0207703_100207532 | 509 |
| 416 | 3300026035 | Ga0207703_10022951 | Ga0207703_100229514 | 509 |
| 417 | 3300026035 | Ga0207703_10081308 | Ga0207703_100813082 | 509 |
| 418 | 3300026035 | Ga0207703_10169598 | Ga0207703_101695981 | 509 |
| 419 | 3300026067 | Ga0207678_10004916 | Ga0207678_100049162 | 509 |
| 420 | 3300026067 | Ga0207678_10025389 | Ga0207678_100253894 | 509 |
| 421 | 3300026067 | Ga0207678_10034620 | Ga0207678_100346202 | 509 |
| 422 | 3300026075 | Ga0207708_10005065 | Ga0207708_100050652 | 509 |
| 423 | 3300026078 | Ga0207702_10052830 | Ga0207702_100528302 | 509 |
| 424 | 3300026089 | Ga0207648_10027089 | Ga0207648_100270891 | 509 |
| 425 | 3300026095 | Ga0207676_10140675 | Ga0207676_101406751 | 509 |
| 426 | 3300026116 | Ga0207674_10015139 | Ga0207674_100151396 | 509 |
| 427 | 3300026118 | Ga0207675_100026056 | Ga0207675_1000260561 | 509 |
| 428 | 3300026118 | Ga0207675_100026914 | Ga0207675_1000269143 | 509 |
| 429 | 3300026121 | Ga0207683_10006298 | Ga0207683_100062987 | 509 |
| 430 | 3300026121 | Ga0207683_10022292 | Ga0207683_100222922 | 509 |
| 431 | 3300027717 | Ga0209998_10007947 | Ga0209998_100079472 | 509 |
| 432 | 3300027866 | Ga0209813_10016402 | Ga0209813_100164021 | 509 |
| 433 | 3300027907 | Ga0207428_10000160 | Ga0207428_1000016087 | 509 |
| 434 | 3300028379 | Ga0268266_10001098 | Ga0268266_1000109814 | 509 |
| 435 | 3300028379 | Ga0268266_10025697 | Ga0268266_100256975 | 509 |
| 436 | 3300028380 | Ga0268265_10010066 | Ga0268265_100100663 | 509 |
| 437 | 3300028380 | Ga0268265_10028814 | Ga0268265_100288143 | 509 |
| 438 | 3300028380 | Ga0268265_10069356 | Ga0268265_100693562 | 509 |
| 439 | 3300028381 | Ga0268264_10046840 | Ga0268264_100468401 | 509 |
| 440 | 3300035117 | Ga0373953_0000879 | Ga0373953_0000879_2046_3794 | 509 |
| 441 | 3300035118 | Ga0373954_0000261 | Ga0373954_0000261_3813_5561 | 509 |
| 442 | 3300035119 | Ga0373956_0003139 | Ga0373956_0003139_4936_6573 | 509 |
| 443 | 3300035171 | Ga0373946_0016709 | Ga0373946_0016709_1141_2751 | 509 |
| 444 | 3300035172 | Ga0373955_0000455 | Ga0373955_0000455_10334_12082 | 509 |
| 445 | 3300035692 | Ga0373935_0032478 | Ga0373935_0032478_1560_3176 | 509 |
| 446 | 3300035695 | Ga0373927_0012295 | Ga0373927_0012295_836_2452 | 509 |
| 447 | 3300035724 | Ga0373933_0000346 | Ga0373933_0000346_15420_17057 | 509 |
| 448 | 3300035725 | Ga0373947_0017970 | Ga0373947_0017970_2134_3750 | 509 |
| 449 | 3300036401 | Ga0373937_0001412 | Ga0373937_0001412_12400_14148 | 509 |
| 450 | 3300037068 | Ga0373925_0044581 | Ga0373925_0044581_39_1655 | 509 |
| 451 | 3300037471 | Ga0395905_0058698 | Ga0395905_0058698_739_2346 | 509 |
| 452 | 3300045051 | Ga0451576_0017147 | Ga0451576_0017147_2821_4485 | 509 |
| 453 | 3300046454 | Ga0495592_0003017 | Ga0495592_0003017_9808_11556 | 509 |
| 454 | 3300046459 | Ga0495629_0017952 | Ga0495629_0017952_291_2039 | 509 |
| 455 | 3300046459 | Ga0495629_0029634 | Ga0495629_0029634_1234_2850 | 509 |
| 456 | 3300046459 | Ga0495629_0093222 | Ga0495629_0093222_103_1704 | 509 |
| 457 | 3300046462 | Ga0495651_0001035 | Ga0495651_0001035_9120_10868 | 509 |
| 458 | 3300046463 | Ga0495653_0000572 | Ga0495653_0000572_15831_17579 | 509 |
| 459 | 3300046511 | Ga0495608_0002256 | Ga0495608_0002256_1416_3053 | 509 |
| 460 | 3300046514 | Ga0495618_0028875 | Ga0495618_0028875_959_2575 | 509 |
| 461 | 3300046516 | Ga0495628_0069896 | Ga0495628_0069896_265_1881 | 509 |
| 462 | 3300046516 | Ga0495628_0075538 | Ga0495628_0075538_883_2520 | 509 |
| 463 | 3300046529 | Ga0495652_0002502 | Ga0495652_0002502_7437_9074 | 509 |
| 464 | 3300046536 | Ga0495587_0006519 | Ga0495587_0006519_2046_3794 | 509 |
| 465 | 3300046559 | Ga0495667_0011111 | Ga0495667_0011111_4357_5994 | 509 |
| 466 | 3300046616 | Ga0495668_0088374 | Ga0495668_0088374_68_1663 | 509 |
| 467 | 3300046663 | Ga0495635_0000241 | Ga0495635_0000241_9998_11746 | 509 |
| 468 | 3300046663 | Ga0495635_0032155 | Ga0495635_0032155_1340_2956 | 509 |
| 469 | 3300046675 | Ga0495657_0004360 | Ga0495657_0004360_7845_9593 | 509 |
| 470 | 3300046678 | Ga0495599_0000148 | Ga0495599_0000148_14536_16284 | 509 |
| 471 | 3300046678 | Ga0495599_0049182 | Ga0495599_0049182_44_1654 | 509 |
| 472 | 3300046680 | Ga0495646_0004040 | Ga0495646_0004040_5151_6899 | 509 |
| 473 | 3300046683 | Ga0495658_0013073 | Ga0495658_0013073_593_2194 | 509 |
| 474 | 3300046694 | Ga0495649_0088374 | Ga0495649_0088374_20_1615 | 509 |
| 475 | 3300046809 | Ga0495600_0009200 | Ga0495600_0009200_4359_5996 | 509 |
| 476 | 3300047317 | Ga0495604_0001413 | Ga0495604_0001413_2174_3922 | 509 |
| 477 | 3300047319 | Ga0495674_0014103 | Ga0495674_0014103_2180_3796 | 509 |
| 478 | 3300047322 | Ga0495680_0002177 | Ga0495680_0002177_16742_18379 | 509 |
| 479 | 3300047444 | Ga0495675_0001603 | Ga0495675_0001603_2174_3922 | 509 |
| 480 | 3300047471 | Ga0495684_0001447 | Ga0495684_0001447_9984_11732 | 509 |
| 481 | 3300047673 | Ga0495593_0021216 | Ga0495593_0021216_1561_3198 | 509 |
| 482 | 3300048088 | Ga0495602_0003318 | Ga0495602_0003318_10646_12394 | 509 |
| 483 | 3300048904 | Ga0496101_0063591 | Ga0496101_0063591_925_2520 | 509 |
| 484 | 3300048904 | Ga0496101_0156513 | Ga0496101_0156513_50_1645 | 509 |
| 485 | 3300048905 | Ga0496102_0041102 | Ga0496102_0041102_1061_2656 | 509 |
| 486 | 3300048905 | Ga0496102_0129742 | Ga0496102_0129742_312_1907 | 509 |
| 487 | 3300048906 | Ga0496103_0005938 | Ga0496103_0005938_5110_6720 | 509 |
| 488 | 3300048907 | Ga0496104_0057574 | Ga0496104_0057574_1632_3263 | 509 |
| 489 | 3300048907 | Ga0496104_0075451 | Ga0496104_0075451_936_2546 | 509 |
| 490 | 3300048908 | Ga0496105_0016921 | Ga0496105_0016921_1879_3510 | 509 |
| 491 | 3300048909 | Ga0496106_0004025 | Ga0496106_0004025_3147_4757 | 509 |
| 492 | 3300048909 | Ga0496106_0075850 | Ga0496106_0075850_394_1989 | 509 |
| 493 | 3300048910 | Ga0496107_0100484 | Ga0496107_0100484_244_1839 | 509 |
| 494 | 3300048911 | Ga0496108_0001479 | Ga0496108_0001479_13406_15037 | 509 |
| 495 | 3300048911 | Ga0496108_0038860 | Ga0496108_0038860_816_2411 | 509 |
| 496 | 3300048912 | Ga0496109_0031710 | Ga0496109_0031710_2092_3687 | 509 |
| 497 | 3300048913 | Ga0496110_0002118 | Ga0496110_0002118_5287_6918 | 509 |
| 498 | 3300048913 | Ga0496110_0020761 | Ga0496110_0020761_1008_2618 | 509 |
| 499 | 3300048914 | Ga0496111_0024330 | Ga0496111_0024330_2569_4179 | 509 |
| 500 | 3300048915 | Ga0496112_0006792 | Ga0496112_0006792_326_1957 | 509 |
| 501 | 3300048916 | Ga0496113_0008271 | Ga0496113_0008271_1937_3568 | 509 |
| 502 | 3300048918 | Ga0496115_0028143 | Ga0496115_0028143_2034_3662 | 509 |
| 503 | 3300048918 | Ga0496115_0041834 | Ga0496115_0041834_1893_3503 | 509 |
| 504 | 3300048921 | Ga0496118_0062490 | Ga0496118_0062490_1125_2720 | 509 |
| 505 | 3300050489 | nmdc:mga03683_16162_c1 | nmdc:mga03683_16162_c1_876_2555 | 509 |
| 506 | 3300050490 | nmdc:mga03n38_1205_c1 | nmdc:mga03n38_1205_c1_1716_3311 | 509 |
| 507 | 3300050491 | nmdc:mga00v17_94936_c1 | nmdc:mga00v17_94936_c1_67_1662 | 509 |
| 508 | 3300050492 | nmdc:mga0yw44_28384_c1 | nmdc:mga0yw44_28384_c1_847_2442 | 509 |
| 509 | 3300050493 | nmdc:mga0k408_16229_c1 | nmdc:mga0k408_16229_c1_1520_3115 | 509 |
| 510 | 3300050495 | nmdc:mga04h51_13389_c1 | nmdc:mga04h51_13389_c1_663_2258 | 509 |
| 511 | 3300050496 | nmdc:mga07m45_3035_c1 | nmdc:mga07m45_3035_c1_874_2469 | 509 |
| 512 | 3300050507 | nmdc:mga05p37_352466_c1 | nmdc:mga05p37_352466_c1_78_1685 | 509 |
| 513 | 3300050508 | nmdc:mga09592_18393_c1 | nmdc:mga09592_18393_c1_1138_2748 | 509 |
| 514 | 3300050509 | nmdc:mga0qj67_26650_c1 | nmdc:mga0qj67_26650_c1_812_2422 | 509 |
| 515 | 3300050510 | nmdc:mga06r32_33119_c1 | nmdc:mga06r32_33119_c1_2499_4109 | 509 |
| 516 | 3300050515 | nmdc:mga0a205_104800_c1 | nmdc:mga0a205_104800_c1_832_2508 | 509 |
| 517 | 3300053077 | Ga0495601_0000859 | Ga0495601_0000859_1982_3583 | 509 |
| 518 | 3300053077 | Ga0495601_0001776 | Ga0495601_0001776_8173_9789 | 509 |
| 519 | 3300053078 | Ga0495612_0005812 | Ga0495612_0005812_1832_3448 | 509 |
| 520 | 3300053084 | Ga0495595_0000900 | Ga0495595_0000900_2173_3921 | 509 |
| 521 | 3300053084 | Ga0495595_0058527 | Ga0495595_0058527_161_1777 | 509 |
| 522 | 3300053085 | Ga0495619_0002838 | Ga0495619_0002838_7267_9015 | 509 |
| 523 | 3300053085 | Ga0495619_0005323 | Ga0495619_0005323_3658_5274 | 509 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7aj0-assembly1.cif.gz_F | crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. | 0.8701 | 10 | 493 |
| 7aj0-assembly1.cif.gz_F | crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. | 0.8011 | 10 | 493 |
| 6bia-assembly1.cif.gz_C | crystal structure of ps i-cgsb | 0.7946 | 10 | 502 |
| 6b0j-assembly1.cif.gz_B | crystal structure of ps i-cgsb in complex with k-i-k-neocarrahexaose | 0.7907 | 10 | 502 |
| 1e1z-assembly1.cif.gz_P-2 | crystal structure of an arylsulfatase a mutant c69s | 0.788 | 10 | 469 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1e1zP01 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.8269 | 10 | 393 | 3.40.720.10 |
| af_Q32KJ6_30_387_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.8173 | 10 | 388 | 3.40.720.10 |
| 1p49A01 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.8026 | 8 | 385 | 3.40.720.10 |
| af_Q8SZ72_26_377_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7909 | 10 | 393 | 3.40.720.10 |
| af_Q32KJ6_30_387_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7896 | 10 | 388 | 3.40.720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656SH01-F1-model_v4 | deleted | 0.9812 | 15 | 136 |
|
| AF-A0A521L2S4-F1-model_v4 | Arylsulfatase | 0.9764 | 10 | 291 |
|
| AF-A0A349EIJ6-F1-model_v4 | Arylsulfatase | 0.9709 | 10 | 227 |
|
| AF-A0A4R1W9X4-F1-model_v4 | Sulfatase-like protein | 0.97 | 10 | 240 |
|
| AF-A0A2V5WHS8-F1-model_v4 | Arylsulfatase | 0.9667 | 10 | 242 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar