F459015

General Info

Members Datasets Scaffolds Average Seq Length
523 297 520 528

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0048377|Ga0395901_0048377_2244_4196
Length 626
Sequence MAEQGRNANFVAVSLIGHGALVAGATIWNQTELLAVLAPWPLLRVFFLHGSVKPGVLTATQPQDASEVSEQHFDFLRDRAGLQQITLGAMSTLKGSKKLWYCLFSFDHPTEVKVVSKTTVSKILPGLAAWFWGDDVGQSNISAYSRGVMGYTTPTIDRLAGEGVMFTDYYAEQSCTAGRASFITGQSGLRTGMTKVGLPGATLGLQKEDPTIAELLKPLGYATGQFGKNHLGDRNEFLPTVHGFDEFYGNLYHLNAEEEPELPDYPKDPSFRAKYGPRGVMDCKASDRDDPTVDPRFGKVGKQVCTDTGPLTKARMVGIDDDIQSRAVDFIQRQRQAGKPFFIWVNFTHMHFRTHAKPQSIGQSGPFQSPYHDTMIDHDKNVGAVLKALDDLGIADNTFVMYGTDNGPHMNSWPDAGMTPFRSEKNSNWEGAYRVPAIFRWPGRIRAGLVSNEIVSHLDMLPTILAIAGDPQVTNKLLTGHRVGDLTYKVHLDGYNLVPYLTGQAAKSPRDSFFYINDDQQLTSLRYDNWKFVFLEQRAPGQLLIWANPFTNLRVPKIFNLRTDPYERADVTSNTYYDWLIDHVFLLVPAQEYVGQFLATFRDFPPRQKAATFNMDEVLSKLKDAM

Samples

Sample ID Description Type Environment
1 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
174 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
175 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
176 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0
Rhizoplane 6.5
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1000805 3300002070 Bacteria 4360
2 JGI25404J52841_10001818 3300003659 Bacteria 3874
3 Ga0055530_10000772 3300003791 Bacteria 26697
4 Ga0065715_10127930 3300005293 Bacteria 2076
5 Ga0065707_10104037 3300005295 Bacteria 2717
6 Ga0065707_10128452 3300005295 Bacteria 1965
7 Ga0070676_10022795 3300005328 Bacteria 3514
8 Ga0070690_100071878 3300005330 Bacteria 2248
9 Ga0070670_100004932 3300005331 Bacteria 11231
10 Ga0068869_100018568 3300005334 Bacteria 4735
11 Ga0070680_100032845 3300005336 Bacteria 4178
12 Ga0070680_100047428 3300005336 Bacteria 3498
13 Ga0068868_100011672 3300005338 Bacteria 6398
14 Ga0070660_100018168 3300005339 Bacteria 5133
15 Ga0070689_100016960 3300005340 Bacteria 5341
16 Ga0070689_100087191 3300005340 Bacteria 2455
17 Ga0070691_10005763 3300005341 Bacteria 5650
18 Ga0070687_100013573 3300005343 Bacteria 3633
19 Ga0070668_100018833 3300005347 Bacteria 5186
20 Ga0070669_100013120 3300005353 Bacteria 5888
21 Ga0070669_100050048 3300005353 Bacteria 3051
22 Ga0070673_100003866 3300005364 Bacteria 9404
23 Ga0070673_100052173 3300005364 Bacteria 3208
24 Ga0070659_100055335 3300005366 Bacteria 3126
25 Ga0070667_100016350 3300005367 Bacteria 6139
26 Ga0070709_10001799 3300005434 Bacteria 11629
27 Ga0070709_10018957 3300005434 Bacteria 3970
28 Ga0070714_100037354 3300005435 Bacteria 4081
29 Ga0070713_100013734 3300005436 Bacteria 5988
30 Ga0070710_10005029 3300005437 Bacteria 6257
31 Ga0070701_10011707 3300005438 Bacteria 3935
32 Ga0070705_100002165 3300005440 Bacteria 9985
33 Ga0070705_100115943 3300005440 Bacteria 1721
34 Ga0070700_100014427 3300005441 Bacteria 4461
35 Ga0070700_100040353 3300005441 Bacteria 2856
36 Ga0070700_100056842 3300005441 Bacteria 2454
37 Ga0070694_100018354 3300005444 Bacteria 4439
38 Ga0070694_100046682 3300005444 Bacteria 2909
39 Ga0070663_100002602 3300005455 Bacteria 10204
40 Ga0070663_100010426 3300005455 Bacteria 5791
41 Ga0070678_100028092 3300005456 Bacteria 3831
42 Ga0070678_100037457 3300005456 Bacteria 3406
43 Ga0070662_100042070 3300005457 Bacteria 3262
44 Ga0070662_100155056 3300005457 Bacteria 1787
45 Ga0070681_10027205 3300005458 Bacteria 5750
46 Ga0068867_100022822 3300005459 Bacteria 4477
47 Ga0070685_10007483 3300005466 Bacteria 5589
48 Ga0070685_10029958 3300005466 Bacteria 3027
49 Ga0070699_100038139 3300005518 Bacteria 4161
50 Ga0070679_100230872 3300005530 Bacteria 1810
51 Ga0070684_100019408 3300005535 Bacteria 5623
52 Ga0070684_100041500 3300005535 Bacteria 3967
53 Ga0068853_100171713 3300005539 Bacteria 1962
54 Ga0070686_100112851 3300005544 Bacteria 1854
55 Ga0070695_100045648 3300005545 Bacteria 2794
56 Ga0070696_100000102 3300005546 Bacteria 43346
57 Ga0070693_100000047 3300005547 Bacteria 46631
58 Ga0070693_100020072 3300005547 Bacteria 3517
59 Ga0070665_100036167 3300005548 Bacteria 4968
60 Ga0070704_100022448 3300005549 Bacteria 4107
61 Ga0068855_100059733 3300005563 Bacteria 4460
62 Ga0068855_100189705 3300005563 Bacteria 2319
63 Ga0068857_100048364 3300005577 Bacteria 3776
64 Ga0068854_100086846 3300005578 Bacteria 2319
65 Ga0068856_100089348 3300005614 Bacteria 3064
66 Ga0070702_100005312 3300005615 Bacteria 5983
67 Ga0070702_100015137 3300005615 Bacteria 3931
68 Ga0068852_100116116 3300005616 Bacteria 2441
69 Ga0068859_100072533 3300005617 Bacteria 3480
70 Ga0068864_100022592 3300005618 Bacteria 5275
71 Ga0068864_100027765 3300005618 Bacteria 4782
72 Ga0068866_10002035 3300005718 Bacteria 8422
73 Ga0068861_100049768 3300005719 Bacteria 3174
74 Ga0068861_100062578 3300005719 Bacteria 2859
75 Ga0068861_100070118 3300005719 Bacteria 2713
76 Ga0068861_100111386 3300005719 Bacteria 2193
77 Ga0068870_10000839 3300005840 Bacteria 11969
78 Ga0068863_100124278 3300005841 Bacteria 2461
79 Ga0068863_100129809 3300005841 Bacteria 2406
80 Ga0068863_100135733 3300005841 Bacteria 2350
81 Ga0068858_100024518 3300005842 Bacteria 5620
82 Ga0068858_100035223 3300005842 Bacteria 4643
83 Ga0068858_100073135 3300005842 Bacteria 3182
84 Ga0068858_100086640 3300005842 Bacteria 2913
85 Ga0068860_100023260 3300005843 Bacteria 5988
86 Ga0068860_100041626 3300005843 Bacteria 4388
87 Ga0068860_100134682 3300005843 Bacteria 2372
88 Ga0068862_100002530 3300005844 Bacteria 16185
89 Ga0068862_100022589 3300005844 Bacteria 5263
90 Ga0068862_100035208 3300005844 Bacteria 4238
91 Ga0081455_10036833 3300005937 Bacteria 4350
92 Ga0081455_10084704 3300005937 Bacteria 2586
93 Ga0081455_10123836 3300005937 Bacteria 2033
94 Ga0081540_1002128 3300005983 Bacteria 16489
95 Ga0081540_1004473 3300005983 Bacteria 10641
96 Ga0081540_1005093 3300005983 Bacteria 9859
97 Ga0081540_1005381 3300005983 Bacteria 9570
98 Ga0081540_1034919 3300005983 Bacteria 2703
99 Ga0081540_1038843 3300005983 Bacteria 2503
100 Ga0070717_10067029 3300006028 Bacteria 2986
101 Ga0075365_10022919 3300006038 Bacteria 3920
102 Ga0075364_10020684 3300006051 Bacteria 4141
103 Ga0070715_10041065 3300006163 Bacteria 1937
104 Ga0070716_100002533 3300006173 Bacteria 8459
105 Ga0070712_100009149 3300006175 Bacteria 6238
106 Ga0070712_100015400 3300006175 Bacteria 4925
107 Ga0070712_100033149 3300006175 Bacteria 3493
108 Ga0070712_100122831 3300006175 Bacteria 1956
109 Ga0075362_10019926 3300006177 Bacteria 2797
110 Ga0075367_10014425 3300006178 Bacteria 4278
111 Ga0075367_10043976 3300006178 Bacteria 2616
112 Ga0075369_10003558 3300006186 Bacteria 5678
113 Ga0075369_10051112 3300006186 Bacteria 1789
114 Ga0075366_10052943 3300006195 Bacteria 2411
115 Ga0097621_100000882 3300006237 Bacteria 21034
116 Ga0097621_100005781 3300006237 Bacteria 8733
117 Ga0097621_100010060 3300006237 Bacteria 6898
118 Ga0075370_10015429 3300006353 Bacteria 4091
119 Ga0068871_100001763 3300006358 Bacteria 14569
120 Ga0068871_100005451 3300006358 Bacteria 8921
121 Ga0068871_100029949 3300006358 Bacteria 4281
122 Ga0068871_100055591 3300006358 Bacteria 3214
123 Ga0068871_100059950 3300006358 Bacteria 3102
124 Ga0068871_100074223 3300006358 Bacteria 2805
125 Ga0075431_100006700 3300006847 Bacteria 11436
126 Ga0075433_10011372 3300006852 Bacteria 7165
127 Ga0075434_100096823 3300006871 Bacteria 2956
128 Ga0075434_100099559 3300006871 Bacteria 2912
129 Ga0068865_100029827 3300006881 Bacteria 3623
130 Ga0068865_100071256 3300006881 Bacteria 2465
131 Ga0097620_100072533 3300006931 Bacteria 3480
132 Ga0075435_100015161 3300007076 Bacteria 5787
133 Ga0075435_100021597 3300007076 Bacteria 4953
134 Ga0105251_10023425 3300009011 Bacteria 3187
135 Ga0105250_10022309 3300009092 Bacteria 2553
136 Ga0111539_10008802 3300009094 Bacteria 12802
137 Ga0111539_10061824 3300009094 Bacteria 4436
138 Ga0105245_10005433 3300009098 Bacteria 11193
139 Ga0105245_10012782 3300009098 Bacteria 7313
140 Ga0105245_10148831 3300009098 Bacteria 2212
141 Ga0114129_10024876 3300009147 Bacteria 8489
142 Ga0114129_10134797 3300009147 Bacteria 3389
143 Ga0114129_10292840 3300009147 Bacteria 2172
144 Ga0105243_10071869 3300009148 Bacteria 2799
145 Ga0105241_10005406 3300009174 Bacteria 9441
146 Ga0105241_10045709 3300009174 Bacteria 3324
147 Ga0105241_10080107 3300009174 Bacteria 2555
148 Ga0105242_10003659 3300009176 Bacteria 11964
149 Ga0105242_10020765 3300009176 Bacteria 5151
150 Ga0105242_10181536 3300009176 Bacteria 1857
151 Ga0105248_10008408 3300009177 Bacteria 11327
152 Ga0105248_10027007 3300009177 Bacteria 6386
153 Ga0105248_10055812 3300009177 Bacteria 4431
154 Ga0105237_10022221 3300009545 Bacteria 6510
155 Ga0105249_10034516 3300009553 Bacteria 4585
156 Ga0105239_10025578 3300010375 Bacteria 6498
157 Ga0105239_10098495 3300010375 Bacteria 3232
158 Ga0105239_10109967 3300010375 Bacteria 3055
159 Ga0105246_10133486 3300011119 Bacteria 1857
160 Ga0157374_10003302 3300013296 Bacteria 13547
161 Ga0157374_10047297 3300013296 Bacteria 3988
162 Ga0157374_10047649 3300013296 Bacteria 3974
163 Ga0157378_10019103 3300013297 Bacteria 6022
164 Ga0157378_10024710 3300013297 Bacteria 5289
165 Ga0157378_10029534 3300013297 Bacteria 4841
166 Ga0157378_10045594 3300013297 Bacteria 3896
167 Ga0157378_10122497 3300013297 Bacteria 2399
168 Ga0163162_10013586 3300013306 Bacteria 7955
169 Ga0163162_10043427 3300013306 Bacteria 4501
170 Ga0157375_10003981 3300013308 Bacteria 12818
171 Ga0163163_10046035 3300014325 Bacteria 4284
172 Ga0163163_10085243 3300014325 Bacteria 3167
173 Ga0157380_10058382 3300014326 Bacteria 3076
174 Ga0157380_10179324 3300014326 Bacteria 1859
175 Ga0157379_10031754 3300014968 Bacteria 4705
176 Ga0157379_10054072 3300014968 Bacteria 3587
177 Ga0157379_10120107 3300014968 Bacteria 2364
178 Ga0157379_10148866 3300014968 Bacteria 2112
179 Ga0157376_10002379 3300014969 Bacteria 12701
180 Ga0157376_10002629 3300014969 Bacteria 12215
181 Ga0157376_10015168 3300014969 Bacteria 5812
182 Ga0157376_10018085 3300014969 Bacteria 5393
183 Ga0157376_10029778 3300014969 Bacteria 4352
184 Ga0157376_10058643 3300014969 Bacteria 3226
185 Ga0163161_10039279 3300017792 Bacteria 3397
186 Ga0207666_1000064 3300025271 Bacteria 19030
187 Ga0207696_1016932 3300025711 Bacteria 2426
188 Ga0207692_10003085 3300025898 Bacteria 6470
189 Ga0207642_10001449 3300025899 Bacteria 7352
190 Ga0207710_10001979 3300025900 Bacteria 9783
191 Ga0207688_10035643 3300025901 Bacteria 2757
192 Ga0207680_10047375 3300025903 Bacteria 2547
193 Ga0207647_10041878 3300025904 Bacteria 2876
194 Ga0207699_10007364 3300025906 Bacteria 5381
195 Ga0207645_10017820 3300025907 Bacteria 4682
196 Ga0207654_10003273 3300025911 Bacteria 8190
197 Ga0207654_10033715 3300025911 Bacteria 2840
198 Ga0207654_10060150 3300025911 Bacteria 2218
199 Ga0207707_10084818 3300025912 Bacteria 2767
200 Ga0207693_10004125 3300025915 Bacteria 12334
201 Ga0207693_10015774 3300025915 Bacteria 6054
202 Ga0207693_10018993 3300025915 Bacteria 5471
203 Ga0207663_10011825 3300025916 Bacteria 4699
204 Ga0207663_10038438 3300025916 Bacteria 2893
205 Ga0207663_10081052 3300025916 Bacteria 2124
206 Ga0207660_10013544 3300025917 Bacteria 5346
207 Ga0207660_10095067 3300025917 Bacteria 2216
208 Ga0207662_10064416 3300025918 Bacteria 2205
209 Ga0207649_10069394 3300025920 Bacteria 2244
210 Ga0207681_10111143 3300025923 Bacteria 1993
211 Ga0207650_10002016 3300025925 Bacteria 14219
212 Ga0207687_10013910 3300025927 Bacteria 5258
213 Ga0207687_10041590 3300025927 Bacteria 3157
214 Ga0207700_10007998 3300025928 Bacteria 6514
215 Ga0207700_10023916 3300025928 Bacteria 4222
216 Ga0207644_10081738 3300025931 Bacteria 2388
217 Ga0207690_10012193 3300025932 Bacteria 5144
218 Ga0207706_10002877 3300025933 Bacteria 16672
219 Ga0207706_10025291 3300025933 Bacteria 5321
220 Ga0207706_10031111 3300025933 Bacteria 4756
221 Ga0207706_10161653 3300025933 Bacteria 1968
222 Ga0207686_10002158 3300025934 Bacteria 10830
223 Ga0207686_10012100 3300025934 Bacteria 4741
224 Ga0207709_10009666 3300025935 Bacteria 5313
225 Ga0207709_10113749 3300025935 Bacteria 1815
226 Ga0207670_10035216 3300025936 Bacteria 3244
227 Ga0207670_10093682 3300025936 Bacteria 2129
228 Ga0207669_10033709 3300025937 Bacteria 2893
229 Ga0207704_10027987 3300025938 Bacteria 3120
230 Ga0207665_10033458 3300025939 Bacteria 3407
231 Ga0207691_10138318 3300025940 Bacteria 2147
232 Ga0207711_10035097 3300025941 Bacteria 4250
233 Ga0207689_10013624 3300025942 Bacteria 6933
234 Ga0207689_10023117 3300025942 Bacteria 5221
235 Ga0207689_10059789 3300025942 Bacteria 3134
236 Ga0207689_10072443 3300025942 Bacteria 2831
237 Ga0207667_10113101 3300025949 Bacteria 2799
238 Ga0207667_10126912 3300025949 Bacteria 2628
239 Ga0207651_10056318 3300025960 Bacteria 2705
240 Ga0207712_10015086 3300025961 Bacteria 4979
241 Ga0207712_10034675 3300025961 Bacteria 3421
242 Ga0207712_10084526 3300025961 Bacteria 2319
243 Ga0207712_10093508 3300025961 Bacteria 2219
244 Ga0207668_10006761 3300025972 Bacteria 6787
245 Ga0207668_10014835 3300025972 Bacteria 4829
246 Ga0207658_10015221 3300025986 Bacteria 5277
247 Ga0207658_10018489 3300025986 Bacteria 4813
248 Ga0207658_10076641 3300025986 Bacteria 2548
249 Ga0207677_10074340 3300026023 Bacteria 2411
250 Ga0207703_10020753 3300026035 Bacteria 5140
251 Ga0207703_10022951 3300026035 Bacteria 4899
252 Ga0207703_10027177 3300026035 Bacteria 4506
253 Ga0207703_10039372 3300026035 Bacteria 3778
254 Ga0207703_10056590 3300026035 Bacteria 3195
255 Ga0207703_10081308 3300026035 Bacteria 2700
256 Ga0207703_10169598 3300026035 Bacteria 1918
257 Ga0207678_10004916 3300026067 Bacteria 12003
258 Ga0207678_10025389 3300026067 Bacteria 5172
259 Ga0207678_10034620 3300026067 Bacteria 4399
260 Ga0207708_10005065 3300026075 Bacteria 9718
261 Ga0207708_10036476 3300026075 Bacteria 3743
262 Ga0207708_10044601 3300026075 Bacteria 3379
263 Ga0207702_10052830 3300026078 Bacteria 3440
264 Ga0207702_10079341 3300026078 Bacteria 2845
265 Ga0207648_10027089 3300026089 Bacteria 5091
266 Ga0207648_10037259 3300026089 Bacteria 4283
267 Ga0207676_10140675 3300026095 Bacteria 2065
268 Ga0207674_10015139 3300026116 Bacteria 8487
269 Ga0207674_10052231 3300026116 Bacteria 4169
270 Ga0207675_100026056 3300026118 Bacteria 5442
271 Ga0207675_100026914 3300026118 Bacteria 5354
272 Ga0207675_100151787 3300026118 Bacteria 2205
273 Ga0207675_100155720 3300026118 Bacteria 2177
274 Ga0207683_10006298 3300026121 Bacteria 10169
275 Ga0207683_10022292 3300026121 Bacteria 5434
276 Ga0207683_10029218 3300026121 Bacteria 4772
277 Ga0207698_10143721 3300026142 Bacteria 2059
278 Ga0209998_10007947 3300027717 Bacteria 2201
279 Ga0209813_10016402 3300027866 Bacteria 2022
280 Ga0207428_10000160 3300027907 Bacteria 92379
281 Ga0207428_10004626 3300027907 Bacteria 13044
282 Ga0268266_10001098 3300028379 Bacteria 33929
283 Ga0268266_10025697 3300028379 Bacteria 5010
284 Ga0268265_10000839 3300028380 Bacteria 28924
285 Ga0268265_10009578 3300028380 Bacteria 6541
286 Ga0268265_10010066 3300028380 Bacteria 6382
287 Ga0268265_10028814 3300028380 Bacteria 3979
288 Ga0268265_10069356 3300028380 Bacteria 2737
289 Ga0268264_10046840 3300028381 Bacteria 3593
290 Ga0265332_10000096 3300031238 Bacteria 76689
291 Ga0265328_10007779 3300031239 Bacteria 4455
292 Ga0265325_10000520 3300031241 Bacteria 27739
293 Ga0265329_10005325 3300031242 Bacteria 5211
294 Ga0265340_10031213 3300031247 Bacteria 2666
295 Ga0265339_10006085 3300031249 Bacteria 7963
296 Ga0265331_10000175 3300031250 Bacteria 78849
297 Ga0265331_10000184 3300031250 Bacteria 76712
298 Ga0265316_10000620 3300031344 Bacteria 39538
299 Ga0307508_10109406 3300031616 Bacteria 2363
300 Ga0316579_10009838 3300031691 Bacteria 4027
301 Ga0265314_10000310 3300031711 Bacteria 69421
302 Ga0265314_10001965 3300031711 Bacteria 21875
303 Ga0265342_10001874 3300031712 Bacteria 18989
304 Ga0316576_10021235 3300031727 Bacteria 4486
305 Ga0316578_10007765 3300031728 Bacteria 5410
306 Ga0316583_10024835 3300032133 Bacteria 2140
307 Ga0316585_10002332 3300032137 Bacteria 5108
308 Ga0316580_10003474 3300032139 Bacteria 4479
309 Ga0316592_1008423 3300033524 Bacteria 2038
310 Ga0373940_0000745 3300035088 Bacteria 5310
311 Ga0373923_0030264 3300035111 Bacteria 2176
312 Ga0373932_0006812 3300035112 Bacteria 2712
313 Ga0373932_0008631 3300035112 Bacteria 2437
314 Ga0373953_0000879 3300035117 Bacteria 8428
315 Ga0373954_0000261 3300035118 Bacteria 19044
316 Ga0373954_0005480 3300035118 Bacteria 5488
317 Ga0373956_0003139 3300035119 Bacteria 6682
318 Ga0373956_0013972 3300035119 Bacteria 3347
319 Ga0373956_0046157 3300035119 Bacteria 1945
320 Ga0373957_0012793 3300035120 Bacteria 2832
321 Ga0373946_0016709 3300035171 Bacteria 2799
322 Ga0373955_0000455 3300035172 Bacteria 17320
323 Ga0373955_0007664 3300035172 Bacteria 4972
324 Ga0373955_0028015 3300035172 Bacteria 2917
325 Ga0373942_0002202 3300035207 Bacteria 4793
326 Ga0373962_0014836 3300035242 Bacteria 1990
327 Ga0373931_0046566 3300035691 Bacteria 2293
328 Ga0373935_0006381 3300035692 Bacteria 7036
329 Ga0373935_0006524 3300035692 Bacteria 6970
330 Ga0373935_0032478 3300035692 Bacteria 3244
331 Ga0373935_0038744 3300035692 Bacteria 2986
332 Ga0373927_0007639 3300035695 Bacteria 7315
333 Ga0373927_0011114 3300035695 Bacteria 5997
334 Ga0373927_0012295 3300035695 Bacteria 5695
335 Ga0373933_0000346 3300035724 Bacteria 29613
336 Ga0373933_0008589 3300035724 Bacteria 5570
337 Ga0373933_0076276 3300035724 Bacteria 2047
338 Ga0373947_0017970 3300035725 Bacteria 4069
339 Ga0373947_0033249 3300035725 Bacteria 3043
340 Ga0373937_0001412 3300036401 Bacteria 20055
341 Ga0373937_0001801 3300036401 Bacteria 18000
342 Ga0373937_0086258 3300036401 Bacteria 2905
343 Ga0373937_0164477 3300036401 Bacteria 2080
344 Ga0373937_0234069 3300036401 Bacteria 1730
345 Ga0316584_0069178 3300036712 Bacteria 2646
346 Ga0373925_0044581 3300037068 Bacteria 3293
347 Ga0395905_0058698 3300037471 Bacteria 3598
348 Ga0395901_0048377 3300038443 Bacteria 4416
349 Ga0451576_0011826 3300045051 Bacteria 9878
350 Ga0451576_0017147 3300045051 Bacteria 7967
351 Ga0451576_0024507 3300045051 Bacteria 6518
352 Ga0451576_0033809 3300045051 Bacteria 5433
353 Ga0495592_0003017 3300046454 Bacteria 11992
354 Ga0495592_0010557 3300046454 Bacteria 6966
355 Ga0495629_0017952 3300046459 Bacteria 5071
356 Ga0495629_0029634 3300046459 Bacteria 3880
357 Ga0495629_0093222 3300046459 Bacteria 2102
358 Ga0495638_0014772 3300046460 Bacteria 5266
359 Ga0495651_0001035 3300046462 Bacteria 21511
360 Ga0495653_0000572 3300046463 Bacteria 28222
361 Ga0495580_0025165 3300046472 Bacteria 4350
362 Ga0495582_0004723 3300046473 Bacteria 7656
363 Ga0495639_0001757 3300046475 Bacteria 9612
364 Ga0495662_0023730 3300046476 Bacteria 2962
365 Ga0495664_0003799 3300046477 Bacteria 8238
366 Ga0495594_0004523 3300046499 Bacteria 7155
367 Ga0495606_0041358 3300046507 Bacteria 3091
368 Ga0495608_0002256 3300046511 Bacteria 13916
369 Ga0495608_0047834 3300046511 Bacteria 2842
370 Ga0495618_0028875 3300046514 Bacteria 3458
371 Ga0495618_0063698 3300046514 Bacteria 2342
372 Ga0495628_0058601 3300046516 Bacteria 3025
373 Ga0495628_0069896 3300046516 Bacteria 2738
374 Ga0495628_0075538 3300046516 Bacteria 2624
375 Ga0495630_0015635 3300046517 Bacteria 5544
376 Ga0495643_0002439 3300046522 Bacteria 14756
377 Ga0495652_0002502 3300046529 Bacteria 18853
378 Ga0495665_0010611 3300046531 Bacteria 4988
379 Ga0495640_0009293 3300046533 Bacteria 7659
380 Ga0495640_0010409 3300046533 Bacteria 7193
381 Ga0495640_0042165 3300046533 Bacteria 3186
382 Ga0495586_0042136 3300046535 Bacteria 2459
383 Ga0495587_0006519 3300046536 Bacteria 7606
384 Ga0495667_0011111 3300046559 Bacteria 6090
385 Ga0495668_0088374 3300046616 Bacteria 1699
386 Ga0495634_0011584 3300046642 Bacteria 6415
387 Ga0495625_0000182 3300046660 Bacteria 98244
388 Ga0495625_0007605 3300046660 Bacteria 9408
389 Ga0495625_0009571 3300046660 Bacteria 8095
390 Ga0495635_0000241 3300046663 Bacteria 34839
391 Ga0495635_0032155 3300046663 Bacteria 3641
392 Ga0495657_0004360 3300046675 Bacteria 11293
393 Ga0495599_0000148 3300046678 Bacteria 45714
394 Ga0495599_0049182 3300046678 Bacteria 2643
395 Ga0495646_0004040 3300046680 Bacteria 9200
396 Ga0495646_0022874 3300046680 Bacteria 3938
397 Ga0495647_0001153 3300046681 Bacteria 8116
398 Ga0495658_0013073 3300046683 Bacteria 4221
399 Ga0495658_0018942 3300046683 Bacteria 3587
400 Ga0495658_0054870 3300046683 Bacteria 2268
401 Ga0495624_0006586 3300046690 Bacteria 8224
402 Ga0495624_0035544 3300046690 Bacteria 3217
403 Ga0495624_0101757 3300046690 Bacteria 1769
404 Ga0495649_0088374 3300046694 Bacteria 1653
405 Ga0495600_0009200 3300046809 Bacteria 6094
406 Ga0495581_0006366 3300047315 Bacteria 6848
407 Ga0495604_0001413 3300047317 Bacteria 19679
408 Ga0495604_0005073 3300047317 Bacteria 10423
409 Ga0495604_0044782 3300047317 Bacteria 3455
410 Ga0495604_0136546 3300047317 Bacteria 1757
411 Ga0495674_0008912 3300047319 Bacteria 9543
412 Ga0495674_0012043 3300047319 Bacteria 8151
413 Ga0495674_0012075 3300047319 Bacteria 8141
414 Ga0495674_0014103 3300047319 Bacteria 7488
415 Ga0495674_0120577 3300047319 Bacteria 2215
416 Ga0495676_0075304 3300047321 Bacteria 2582
417 Ga0495676_0148708 3300047321 Bacteria 1670
418 Ga0495680_0002177 3300047322 Bacteria 20274
419 Ga0495680_0053351 3300047322 Bacteria 3147
420 Ga0495675_0001603 3300047444 Bacteria 13592
421 Ga0495684_0001447 3300047471 Bacteria 18997
422 Ga0495684_0042652 3300047471 Bacteria 3474
423 Ga0495684_0045884 3300047471 Bacteria 3343
424 Ga0495684_0105322 3300047471 Bacteria 2131
425 Ga0495593_0013362 3300047673 Bacteria 4685
426 Ga0495593_0021216 3300047673 Bacteria 3631
427 Ga0495593_0070896 3300047673 Bacteria 1810
428 Ga0495602_0003318 3300048088 Bacteria 16622
429 Ga0495602_0052458 3300048088 Bacteria 3622
430 Ga0496101_0017030 3300048904 Bacteria 4921
431 Ga0496101_0063591 3300048904 Bacteria 2686
432 Ga0496101_0156513 3300048904 Bacteria 1746
433 Ga0496102_0041102 3300048905 Bacteria 4187
434 Ga0496102_0070572 3300048905 Bacteria 3208
435 Ga0496102_0129742 3300048905 Bacteria 2358
436 Ga0496103_0005938 3300048906 Bacteria 7299
437 Ga0496103_0062350 3300048906 Bacteria 2320
438 Ga0496104_0004332 3300048907 Bacteria 12345
439 Ga0496104_0054969 3300048907 Bacteria 3763
440 Ga0496104_0057574 3300048907 Bacteria 3677
441 Ga0496104_0062109 3300048907 Bacteria 3542
442 Ga0496104_0075451 3300048907 Bacteria 3210
443 Ga0496105_0016921 3300048908 Bacteria 5835
444 Ga0496105_0050735 3300048908 Bacteria 3428
445 Ga0496105_0071853 3300048908 Bacteria 2860
446 Ga0496105_0100825 3300048908 Bacteria 2384
447 Ga0496106_0004025 3300048909 Bacteria 10987
448 Ga0496106_0041892 3300048909 Bacteria 3433
449 Ga0496106_0075850 3300048909 Bacteria 2576
450 Ga0496107_0018111 3300048910 Bacteria 4955
451 Ga0496107_0100484 3300048910 Bacteria 2121
452 Ga0496108_0001479 3300048911 Bacteria 18560
453 Ga0496108_0038860 3300048911 Bacteria 3966
454 Ga0496109_0031710 3300048912 Bacteria 4746
455 Ga0496110_0002118 3300048913 Bacteria 14818
456 Ga0496110_0020761 3300048913 Bacteria 5546
457 Ga0496111_0024330 3300048914 Bacteria 4262
458 Ga0496112_0006792 3300048915 Bacteria 10085
459 Ga0496113_0008271 3300048916 Bacteria 6766
460 Ga0496114_0157074 3300048917 Bacteria 1975
461 Ga0496115_0028143 3300048918 Bacteria 4403
462 Ga0496115_0041834 3300048918 Bacteria 3648
463 Ga0496115_0076637 3300048918 Bacteria 2718
464 Ga0496118_0062490 3300048921 Bacteria 2749
465 Ga0501031_0020063 3300049568 Bacteria 4357
466 Ga0501036_0035485 3300049572 Bacteria 4220
467 Ga0501037_0016273 3300049573 Bacteria 5474
468 Ga0501037_0098554 3300049573 Bacteria 2111
469 Ga0501042_0023030 3300049578 Bacteria 4353
470 Ga0501046_0015815 3300049580 Bacteria 6331
471 Ga0501048_0015915 3300049582 Bacteria 5549
472 Ga0501067_0007251 3300049583 Bacteria 6156
473 Ga0501068_0007720 3300049584 Bacteria 5952
474 Ga0501069_0003375 3300049585 Bacteria 8198
475 Ga0501071_0021937 3300049587 Bacteria 4451
476 Ga0501073_0003818 3300049589 Bacteria 11306
477 Ga0501074_0005542 3300049590 Bacteria 9077
478 Ga0501077_0019895 3300049593 Bacteria 4247
479 Ga0501079_0002850 3300049741 Bacteria 12614
480 Ga0501080_0019849 3300049742 Bacteria 6223
481 Ga0501081_0045275 3300049743 Bacteria 3021
482 Ga0501083_0011167 3300049744 Bacteria 6303
483 Ga0501035_0088860 3300049822 Bacteria 2722
484 nmdc:mga03683_16162_c1 3300050489 Bacteria 2798
485 nmdc:mga03n38_1205_c1 3300050490 Bacteria 7235
486 nmdc:mga00v17_94936_c1 3300050491 Bacteria 1877
487 nmdc:mga0yw44_28384_c1 3300050492 Bacteria 3218
488 nmdc:mga0k408_16229_c1 3300050493 Bacteria 4129
489 nmdc:mga04h51_13389_c1 3300050495 Bacteria 2321
490 nmdc:mga07m45_3035_c1 3300050496 Bacteria 8009
491 nmdc:mga05p37_231774_c1 3300050507 Bacteria 2224
492 nmdc:mga05p37_352466_c1 3300050507 Bacteria 1732
493 nmdc:mga09592_117220_c1 3300050508 Bacteria 2285
494 nmdc:mga09592_156916_c1 3300050508 Bacteria 1964
495 nmdc:mga09592_18393_c1 3300050508 Bacteria 5732
496 nmdc:mga0qj67_26650_c1 3300050509 Bacteria 4475
497 nmdc:mga06r32_33119_c1 3300050510 Bacteria 4866
498 nmdc:mga06r32_5450_c1 3300050510 Bacteria 11455
499 nmdc:mga08y16_12308_c1 3300050511 Bacteria 8997
500 nmdc:mga08y16_48667_c1 3300050511 Bacteria 4436
501 nmdc:mga08y16_5847_c1 3300050511 Bacteria 12888
502 nmdc:mga0n895_196414_c1 3300050512 Bacteria 2049
503 nmdc:mga0n895_51784_c1 3300050512 Bacteria 4028
504 nmdc:mga0n895_86636_c1 3300050512 Bacteria 3129
505 nmdc:mga0rr50_3665_c1 3300050513 Bacteria 8895
506 nmdc:mga0a205_104800_c1 3300050515 Bacteria 2727
507 nmdc:mga0a205_13024_c1 3300050515 Bacteria 7721
508 nmdc:mga0a205_19326_c1 3300050515 Bacteria 6422
509 nmdc:mga0a205_3972_c1 3300050515 Bacteria 13224
510 nmdc:mga0a205_9791_c1 3300050515 Bacteria 8788
511 Ga0495601_0000859 3300053077 Bacteria 16562
512 Ga0495601_0001776 3300053077 Bacteria 11950
513 Ga0495612_0005812 3300053078 Bacteria 5093
514 Ga0495595_0000900 3300053084 Bacteria 11443
515 Ga0495595_0058527 3300053084 Bacteria 1800
516 Ga0495619_0002265 3300053085 Bacteria 12716
517 Ga0495619_0002838 3300053085 Bacteria 11285
518 Ga0495619_0005323 3300053085 Bacteria 8146
519 Ga0500637_0010752 3300053178 Bacteria 4704
520 Ga0501082_0000984 3300060353 Bacteria 25133

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10023916 Ga0207700_100239162 455
2 3300025911 Ga0207654_10033715 Ga0207654_100337152 468
3 3300053178 Ga0500637_0010752 Ga0500637_0010752_329_1903 472
4 3300031691 Ga0316579_10009838 Ga0316579_100098382 476
5 3300031727 Ga0316576_10021235 Ga0316576_100212353 476
6 3300031728 Ga0316578_10007765 Ga0316578_100077654 476
7 3300032137 Ga0316585_10002332 Ga0316585_100023322 476
8 3300033524 Ga0316592_1008423 Ga0316592_10084232 476
9 3300049744 Ga0501083_0011167 Ga0501083_0011167_3359_5017 478
10 3300036712 Ga0316584_0069178 Ga0316584_0069178_462_2096 479
11 3300009098 Ga0105245_10005433 Ga0105245_100054331 486
12 3300009147 Ga0114129_10292840 Ga0114129_102928402 486
13 3300032133 Ga0316583_10024835 Ga0316583_100248352 486
14 3300032139 Ga0316580_10003474 Ga0316580_100034743 486
15 3300050507 nmdc:mga05p37_231774_c1 nmdc:mga05p37_231774_c1_181_1710 486
16 iso_pu_bacteria 2883354860 2883357455 488
17 3300006175 Ga0070712_100033149 Ga0070712_1000331493 489
18 3300050512 nmdc:mga0n895_51784_c1 nmdc:mga0n895_51784_c1_653_2203 489
19 3300049573 Ga0501037_0016273 Ga0501037_0016273_471_1985 492
20 3300049583 Ga0501067_0007251 Ga0501067_0007251_4136_5650 492
21 3300049585 Ga0501069_0003375 Ga0501069_0003375_5461_6975 492
22 3300060353 Ga0501082_0000984 Ga0501082_0000984_11960_13474 492
23 3300003791 Ga0055530_10000772 Ga0055530_1000077216 496
24 3300006175 Ga0070712_100122831 Ga0070712_1001228311 496
25 3300013296 Ga0157374_10047649 Ga0157374_100476493 496
26 3300025916 Ga0207663_10081052 Ga0207663_100810521 496
27 3300025961 Ga0207712_10093508 Ga0207712_100935082 496
28 3300046460 Ga0495638_0014772 Ga0495638_0014772_3209_4756 496
29 3300046533 Ga0495640_0010409 Ga0495640_0010409_4070_5620 496
30 3300046660 Ga0495625_0009571 Ga0495625_0009571_3389_4936 496
31 3300046690 Ga0495624_0101757 Ga0495624_0101757_206_1759 496
32 3300047317 Ga0495604_0136546 Ga0495604_0136546_184_1734 496
33 3300047319 Ga0495674_0012075 Ga0495674_0012075_1926_3476 496
34 3300047322 Ga0495680_0053351 Ga0495680_0053351_981_2531 496
35 3300049822 Ga0501035_0088860 Ga0501035_0088860_331_1902 496
36 3300053085 Ga0495619_0002265 Ga0495619_0002265_10153_11703 496
37 3300005457 Ga0070662_100155056 Ga0070662_1001550561 497
38 3300009176 Ga0105242_10020765 Ga0105242_100207652 497
39 3300010375 Ga0105239_10098495 Ga0105239_100984953 497
40 3300013297 Ga0157378_10045594 Ga0157378_100455942 497
41 3300014969 Ga0157376_10015168 Ga0157376_100151684 497
42 3300025903 Ga0207680_10047375 Ga0207680_100473751 497
43 3300025916 Ga0207663_10038438 Ga0207663_100384382 497
44 3300025933 Ga0207706_10161653 Ga0207706_101616531 497
45 3300025934 Ga0207686_10012100 Ga0207686_100121002 497
46 3300026121 Ga0207683_10029218 Ga0207683_100292182 497
47 3300035724 Ga0373933_0076276 Ga0373933_0076276_343_1890 497
48 3300036401 Ga0373937_0164477 Ga0373937_0164477_375_1922 497
49 3300046507 Ga0495606_0041358 Ga0495606_0041358_1256_2833 497
50 3300048904 Ga0496101_0017030 Ga0496101_0017030_1908_3521 497
51 3300048907 Ga0496104_0004332 Ga0496104_0004332_9503_11116 497
52 3300048908 Ga0496105_0100825 Ga0496105_0100825_758_2371 497
53 3300048909 Ga0496106_0041892 Ga0496106_0041892_705_2318 497
54 3300048910 Ga0496107_0018111 Ga0496107_0018111_1999_3612 497
55 3300009147 Ga0114129_10134797 Ga0114129_101347974 498
56 3300046522 Ga0495643_0002439 Ga0495643_0002439_6331_7899 499
57 3300046533 Ga0495640_0042165 Ga0495640_0042165_979_2553 499
58 3300046535 Ga0495586_0042136 Ga0495586_0042136_178_1752 499
59 3300046660 Ga0495625_0007605 Ga0495625_0007605_2967_4535 499
60 3300046683 Ga0495658_0054870 Ga0495658_0054870_180_1754 499
61 3300047319 Ga0495674_0120577 Ga0495674_0120577_61_1635 499
62 3300046473 Ga0495582_0004723 Ga0495582_0004723_541_2127 500
63 3300046477 Ga0495664_0003799 Ga0495664_0003799_1997_3592 500
64 3300047319 Ga0495674_0008912 Ga0495674_0008912_5685_7280 500
65 3300047673 Ga0495593_0070896 Ga0495593_0070896_176_1771 500
66 3300006358 Ga0068871_100074223 Ga0068871_1000742233 501
67 3300009098 Ga0105245_10148831 Ga0105245_101488312 501
68 3300009148 Ga0105243_10071869 Ga0105243_100718693 501
69 3300047321 Ga0495676_0148708 Ga0495676_0148708_68_1654 501
70 3300049743 Ga0501081_0045275 Ga0501081_0045275_441_2012 501
71 3300050508 nmdc:mga09592_156916_c1 nmdc:mga09592_156916_c1_67_1632 501
72 3300050511 nmdc:mga08y16_5847_c1 nmdc:mga08y16_5847_c1_10181_11776 501
73 3300050512 nmdc:mga0n895_196414_c1 nmdc:mga0n895_196414_c1_146_1729 501
74 3300050515 nmdc:mga0a205_19326_c1 nmdc:mga0a205_19326_c1_56_1651 501
75 3300050515 nmdc:mga0a205_3972_c1 nmdc:mga0a205_3972_c1_6908_8491 501
76 3300005937 Ga0081455_10036833 Ga0081455_100368334 502
77 3300005937 Ga0081455_10084704 Ga0081455_100847041 502
78 3300005983 Ga0081540_1005093 Ga0081540_100509311 502
79 3300031616 Ga0307508_10109406 Ga0307508_101094063 502
80 3300005340 Ga0070689_100087191 Ga0070689_1000871912 503
81 3300005341 Ga0070691_10005763 Ga0070691_100057632 503
82 3300005343 Ga0070687_100013573 Ga0070687_1000135733 503
83 3300005549 Ga0070704_100022448 Ga0070704_1000224483 503
84 3300005563 Ga0068855_100189705 Ga0068855_1001897052 503
85 3300005718 Ga0068866_10002035 Ga0068866_100020356 503
86 3300005842 Ga0068858_100086640 Ga0068858_1000866402 503
87 3300005844 Ga0068862_100002530 Ga0068862_10000253011 503
88 3300005937 Ga0081455_10123836 Ga0081455_101238362 503
89 3300009174 Ga0105241_10080107 Ga0105241_100801071 503
90 3300014326 Ga0157380_10058382 Ga0157380_100583823 503
91 3300025899 Ga0207642_10001449 Ga0207642_100014491 503
92 3300025901 Ga0207688_10035643 Ga0207688_100356432 503
93 3300025918 Ga0207662_10064416 Ga0207662_100644162 503
94 3300025927 Ga0207687_10041590 Ga0207687_100415903 503
95 3300025949 Ga0207667_10126912 Ga0207667_101269122 503
96 3300026035 Ga0207703_10039372 Ga0207703_100393722 503
97 3300026118 Ga0207675_100151787 Ga0207675_1001517872 503
98 3300028380 Ga0268265_10009578 Ga0268265_100095783 503
99 3300035691 Ga0373931_0046566 Ga0373931_0046566_45_1628 503
100 3300050508 nmdc:mga09592_117220_c1 nmdc:mga09592_117220_c1_227_1807 503
101 3300005336 Ga0070680_100047428 Ga0070680_1000474282 504
102 3300005338 Ga0068868_100011672 Ga0068868_1000116723 504
103 3300005353 Ga0070669_100013120 Ga0070669_1000131203 504
104 3300005438 Ga0070701_10011707 Ga0070701_100117072 504
105 3300005440 Ga0070705_100002165 Ga0070705_1000021657 504
106 3300005441 Ga0070700_100014427 Ga0070700_1000144273 504
107 3300005441 Ga0070700_100056842 Ga0070700_1000568422 504
108 3300005444 Ga0070694_100018354 Ga0070694_1000183543 504
109 3300005458 Ga0070681_10027205 Ga0070681_100272054 504
110 3300005530 Ga0070679_100230872 Ga0070679_1002308721 504
111 3300005546 Ga0070696_100000102 Ga0070696_1000001023 504
112 3300005547 Ga0070693_100000047 Ga0070693_10000004744 504
113 3300005577 Ga0068857_100048364 Ga0068857_1000483642 504
114 3300005614 Ga0068856_100089348 Ga0068856_1000893482 504
115 3300005615 Ga0070702_100005312 Ga0070702_1000053122 504
116 3300005615 Ga0070702_100015137 Ga0070702_1000151372 504
117 3300005719 Ga0068861_100070118 Ga0068861_1000701182 504
118 3300005719 Ga0068861_100111386 Ga0068861_1001113862 504
119 3300005844 Ga0068862_100022589 Ga0068862_1000225896 504
120 3300006237 Ga0097621_100000882 Ga0097621_1000008822 504
121 3300006358 Ga0068871_100001763 Ga0068871_1000017633 504
122 3300006358 Ga0068871_100055591 Ga0068871_1000555912 504
123 3300006881 Ga0068865_100029827 Ga0068865_1000298273 504
124 3300007076 Ga0075435_100021597 Ga0075435_1000215973 504
125 3300009094 Ga0111539_10061824 Ga0111539_100618243 504
126 3300009553 Ga0105249_10034516 Ga0105249_100345163 504
127 3300013297 Ga0157378_10122497 Ga0157378_101224972 504
128 3300014968 Ga0157379_10120107 Ga0157379_101201072 504
129 3300014969 Ga0157376_10029778 Ga0157376_100297785 504
130 3300025904 Ga0207647_10041878 Ga0207647_100418783 504
131 3300025912 Ga0207707_10084818 Ga0207707_100848183 504
132 3300025917 Ga0207660_10013544 Ga0207660_100135444 504
133 3300025933 Ga0207706_10002877 Ga0207706_1000287717 504
134 3300025934 Ga0207686_10002158 Ga0207686_100021584 504
135 3300025935 Ga0207709_10009666 Ga0207709_100096664 504
136 3300025938 Ga0207704_10027987 Ga0207704_100279872 504
137 3300025940 Ga0207691_10138318 Ga0207691_101383182 504
138 3300025942 Ga0207689_10059789 Ga0207689_100597892 504
139 3300025961 Ga0207712_10084526 Ga0207712_100845262 504
140 3300026023 Ga0207677_10074340 Ga0207677_100743403 504
141 3300026035 Ga0207703_10056590 Ga0207703_100565902 504
142 3300026075 Ga0207708_10036476 Ga0207708_100364763 504
143 3300026075 Ga0207708_10044601 Ga0207708_100446014 504
144 3300026078 Ga0207702_10079341 Ga0207702_100793412 504
145 3300026089 Ga0207648_10037259 Ga0207648_100372593 504
146 3300026116 Ga0207674_10052231 Ga0207674_100522315 504
147 3300026118 Ga0207675_100155720 Ga0207675_1001557202 504
148 3300026142 Ga0207698_10143721 Ga0207698_101437211 504
149 3300028380 Ga0268265_10000839 Ga0268265_1000083910 504
150 3300035088 Ga0373940_0000745 Ga0373940_0000745_2690_4297 504
151 3300035111 Ga0373923_0030264 Ga0373923_0030264_38_1645 504
152 3300035112 Ga0373932_0006812 Ga0373932_0006812_1073_2680 504
153 3300035118 Ga0373954_0005480 Ga0373954_0005480_2014_3624 504
154 3300035119 Ga0373956_0013972 Ga0373956_0013972_492_2102 504
155 3300035119 Ga0373956_0046157 Ga0373956_0046157_137_1747 504
156 3300035120 Ga0373957_0012793 Ga0373957_0012793_1150_2760 504
157 3300035172 Ga0373955_0007664 Ga0373955_0007664_1855_3465 504
158 3300035172 Ga0373955_0028015 Ga0373955_0028015_254_1864 504
159 3300035207 Ga0373942_0002202 Ga0373942_0002202_343_1950 504
160 3300035242 Ga0373962_0014836 Ga0373962_0014836_112_1719 504
161 3300035692 Ga0373935_0006524 Ga0373935_0006524_802_2409 504
162 3300035695 Ga0373927_0007639 Ga0373927_0007639_4502_6109 504
163 3300035724 Ga0373933_0008589 Ga0373933_0008589_1795_3405 504
164 3300035725 Ga0373947_0033249 Ga0373947_0033249_1070_2677 504
165 3300036401 Ga0373937_0001801 Ga0373937_0001801_13397_15007 504
166 3300036401 Ga0373937_0086258 Ga0373937_0086258_840_2447 504
167 3300036401 Ga0373937_0234069 Ga0373937_0234069_42_1634 504
168 3300045051 Ga0451576_0011826 Ga0451576_0011826_5791_7392 504
169 3300045051 Ga0451576_0024507 Ga0451576_0024507_2214_3821 504
170 3300046454 Ga0495592_0010557 Ga0495592_0010557_483_2090 504
171 3300046472 Ga0495580_0025165 Ga0495580_0025165_2570_4177 504
172 3300046475 Ga0495639_0001757 Ga0495639_0001757_229_1836 504
173 3300046476 Ga0495662_0023730 Ga0495662_0023730_483_2090 504
174 3300046499 Ga0495594_0004523 Ga0495594_0004523_67_1674 504
175 3300046511 Ga0495608_0047834 Ga0495608_0047834_1054_2664 504
176 3300046514 Ga0495618_0063698 Ga0495618_0063698_478_2088 504
177 3300046516 Ga0495628_0058601 Ga0495628_0058601_97_1704 504
178 3300046517 Ga0495630_0015635 Ga0495630_0015635_1054_2661 504
179 3300046531 Ga0495665_0010611 Ga0495665_0010611_2046_3653 504
180 3300046533 Ga0495640_0009293 Ga0495640_0009293_1670_3277 504
181 3300046642 Ga0495634_0011584 Ga0495634_0011584_3492_5099 504
182 3300046680 Ga0495646_0022874 Ga0495646_0022874_1181_2788 504
183 3300046681 Ga0495647_0001153 Ga0495647_0001153_5487_7094 504
184 3300046683 Ga0495658_0018942 Ga0495658_0018942_961_2568 504
185 3300046690 Ga0495624_0006586 Ga0495624_0006586_5547_7154 504
186 3300046690 Ga0495624_0035544 Ga0495624_0035544_892_2508 504
187 3300047315 Ga0495581_0006366 Ga0495581_0006366_4744_6351 504
188 3300047317 Ga0495604_0044782 Ga0495604_0044782_178_1788 504
189 3300047319 Ga0495674_0012043 Ga0495674_0012043_1013_2620 504
190 3300047321 Ga0495676_0075304 Ga0495676_0075304_591_2198 504
191 3300047471 Ga0495684_0042652 Ga0495684_0042652_152_1759 504
192 3300047471 Ga0495684_0045884 Ga0495684_0045884_1213_2823 504
193 3300047471 Ga0495684_0105322 Ga0495684_0105322_452_2062 504
194 3300047673 Ga0495593_0013362 Ga0495593_0013362_2948_4555 504
195 3300048088 Ga0495602_0052458 Ga0495602_0052458_1239_2849 504
196 3300049568 Ga0501031_0020063 Ga0501031_0020063_1359_2969 504
197 3300049572 Ga0501036_0035485 Ga0501036_0035485_654_2264 504
198 3300049573 Ga0501037_0098554 Ga0501037_0098554_117_1727 504
199 3300049578 Ga0501042_0023030 Ga0501042_0023030_1408_3018 504
200 3300049580 Ga0501046_0015815 Ga0501046_0015815_1301_2911 504
201 3300049582 Ga0501048_0015915 Ga0501048_0015915_3551_5161 504
202 3300049584 Ga0501068_0007720 Ga0501068_0007720_2953_4536 504
203 3300049587 Ga0501071_0021937 Ga0501071_0021937_1276_2859 504
204 3300049589 Ga0501073_0003818 Ga0501073_0003818_2905_4488 504
205 3300049590 Ga0501074_0005542 Ga0501074_0005542_5777_7360 504
206 3300049593 Ga0501077_0019895 Ga0501077_0019895_1431_3014 504
207 3300049741 Ga0501079_0002850 Ga0501079_0002850_4013_5596 504
208 3300049742 Ga0501080_0019849 Ga0501080_0019849_532_2115 504
209 3300050511 nmdc:mga08y16_48667_c1 nmdc:mga08y16_48667_c1_1879_3477 504
210 iso_pu_bacteria 2906610324 2906614822 504
211 iso_pu_bacteria 2922425934 2922433290 504
212 3300005434 Ga0070709_10001799 Ga0070709_1000179910 505
213 3300005437 Ga0070710_10005029 Ga0070710_100050292 505
214 3300005842 Ga0068858_100024518 Ga0068858_1000245184 505
215 3300005983 Ga0081540_1034919 Ga0081540_10349192 505
216 3300006173 Ga0070716_100002533 Ga0070716_1000025332 505
217 3300006175 Ga0070712_100009149 Ga0070712_1000091495 505
218 3300006237 Ga0097621_100010060 Ga0097621_1000100603 505
219 3300006358 Ga0068871_100029949 Ga0068871_1000299495 505
220 3300009177 Ga0105248_10055812 Ga0105248_100558122 505
221 3300013296 Ga0157374_10003302 Ga0157374_100033028 505
222 3300013297 Ga0157378_10019103 Ga0157378_100191035 505
223 3300013306 Ga0163162_10013586 Ga0163162_100135863 505
224 3300013308 Ga0157375_10003981 Ga0157375_100039818 505
225 3300014968 Ga0157379_10031754 Ga0157379_100317542 505
226 3300014969 Ga0157376_10002629 Ga0157376_100026295 505
227 3300025898 Ga0207692_10003085 Ga0207692_100030857 505
228 3300025915 Ga0207693_10015774 Ga0207693_100157742 505
229 3300025936 Ga0207670_10093682 Ga0207670_100936821 505
230 3300025939 Ga0207665_10033458 Ga0207665_100334582 505
231 3300025941 Ga0207711_10035097 Ga0207711_100350972 505
232 3300025986 Ga0207658_10015221 Ga0207658_100152215 505
233 3300026035 Ga0207703_10027177 Ga0207703_100271772 505
234 3300031238 Ga0265332_10000096 Ga0265332_100000967 505
235 3300031239 Ga0265328_10007779 Ga0265328_100077794 505
236 3300031242 Ga0265329_10005325 Ga0265329_100053254 505
237 3300031250 Ga0265331_10000184 Ga0265331_1000018459 505
238 3300031344 Ga0265316_10000620 Ga0265316_1000062030 505
239 3300031711 Ga0265314_10001965 Ga0265314_100019658 505
240 3300031712 Ga0265342_10001874 Ga0265342_1000187415 505
241 3300046660 Ga0495625_0000182 Ga0495625_0000182_76469_78082 505
242 3300048907 Ga0496104_0062109 Ga0496104_0062109_75_1685 505
243 3300048908 Ga0496105_0071853 Ga0496105_0071853_1159_2769 505
244 3300048918 Ga0496115_0076637 Ga0496115_0076637_130_1740 505
245 3300031247 Ga0265340_10031213 Ga0265340_100312131 506
246 3300035692 Ga0373935_0038744 Ga0373935_0038744_1356_2960 506
247 3300035695 Ga0373927_0011114 Ga0373927_0011114_2550_4154 506
248 3300045051 Ga0451576_0033809 Ga0451576_0033809_3208_4794 506
249 3300047317 Ga0495604_0005073 Ga0495604_0005073_3526_5139 506
250 3300006847 Ga0075431_100006700 Ga0075431_1000067006 507
251 3300007076 Ga0075435_100015161 Ga0075435_1000151612 507
252 3300009094 Ga0111539_10008802 Ga0111539_100088021 507
253 3300027907 Ga0207428_10004626 Ga0207428_100046261 507
254 3300035112 Ga0373932_0008631 Ga0373932_0008631_456_2030 507
255 3300048905 Ga0496102_0070572 Ga0496102_0070572_572_2176 507
256 3300048906 Ga0496103_0062350 Ga0496103_0062350_182_1756 507
257 3300048907 Ga0496104_0054969 Ga0496104_0054969_483_2087 507
258 3300048908 Ga0496105_0050735 Ga0496105_0050735_1172_2776 507
259 3300048917 Ga0496114_0157074 Ga0496114_0157074_137_1741 507
260 3300050510 nmdc:mga06r32_5450_c1 nmdc:mga06r32_5450_c1_4214_5815 507
261 3300050511 nmdc:mga08y16_12308_c1 nmdc:mga08y16_12308_c1_372_1994 507
262 3300050512 nmdc:mga0n895_86636_c1 nmdc:mga0n895_86636_c1_233_1822 507
263 3300050513 nmdc:mga0rr50_3665_c1 nmdc:mga0rr50_3665_c1_3019_4608 507
264 3300050515 nmdc:mga0a205_9791_c1 nmdc:mga0a205_9791_c1_7031_8620 507
265 3300005295 Ga0065707_10104037 Ga0065707_101040372 508
266 3300006852 Ga0075433_10011372 Ga0075433_100113723 508
267 3300006871 Ga0075434_100096823 Ga0075434_1000968232 508
268 3300009011 Ga0105251_10023425 Ga0105251_100234251 508
269 3300031241 Ga0265325_10000520 Ga0265325_100005208 508
270 3300031249 Ga0265339_10006085 Ga0265339_100060852 508
271 3300031250 Ga0265331_10000175 Ga0265331_1000017569 508
272 3300031711 Ga0265314_10000310 Ga0265314_1000031065 508
273 3300035692 Ga0373935_0006381 Ga0373935_0006381_1747_3372 508
274 3300038443 Ga0395901_0048377 Ga0395901_0048377_2244_4196 508
275 3300050515 nmdc:mga0a205_13024_c1 nmdc:mga0a205_13024_c1_2938_4548 508
276 3300002070 JGI24750J21931_1000805 JGI24750J21931_10008053 509
277 3300003659 JGI25404J52841_10001818 JGI25404J52841_100018182 509
278 3300005293 Ga0065715_10127930 Ga0065715_101279301 509
279 3300005295 Ga0065707_10128452 Ga0065707_101284521 509
280 3300005328 Ga0070676_10022795 Ga0070676_100227951 509
281 3300005330 Ga0070690_100071878 Ga0070690_1000718781 509
282 3300005331 Ga0070670_100004932 Ga0070670_1000049326 509
283 3300005334 Ga0068869_100018568 Ga0068869_1000185682 509
284 3300005336 Ga0070680_100032845 Ga0070680_1000328454 509
285 3300005339 Ga0070660_100018168 Ga0070660_1000181684 509
286 3300005340 Ga0070689_100016960 Ga0070689_1000169604 509
287 3300005347 Ga0070668_100018833 Ga0070668_1000188335 509
288 3300005353 Ga0070669_100050048 Ga0070669_1000500483 509
289 3300005364 Ga0070673_100003866 Ga0070673_1000038664 509
290 3300005364 Ga0070673_100052173 Ga0070673_1000521731 509
291 3300005366 Ga0070659_100055335 Ga0070659_1000553352 509
292 3300005367 Ga0070667_100016350 Ga0070667_1000163504 509
293 3300005434 Ga0070709_10018957 Ga0070709_100189572 509
294 3300005435 Ga0070714_100037354 Ga0070714_1000373542 509
295 3300005436 Ga0070713_100013734 Ga0070713_1000137342 509
296 3300005440 Ga0070705_100115943 Ga0070705_1001159431 509
297 3300005441 Ga0070700_100040353 Ga0070700_1000403533 509
298 3300005444 Ga0070694_100046682 Ga0070694_1000466821 509
299 3300005455 Ga0070663_100002602 Ga0070663_1000026028 509
300 3300005455 Ga0070663_100010426 Ga0070663_1000104265 509
301 3300005456 Ga0070678_100028092 Ga0070678_1000280925 509
302 3300005456 Ga0070678_100037457 Ga0070678_1000374572 509
303 3300005457 Ga0070662_100042070 Ga0070662_1000420703 509
304 3300005459 Ga0068867_100022822 Ga0068867_1000228223 509
305 3300005466 Ga0070685_10007483 Ga0070685_100074833 509
306 3300005466 Ga0070685_10029958 Ga0070685_100299582 509
307 3300005518 Ga0070699_100038139 Ga0070699_1000381392 509
308 3300005535 Ga0070684_100019408 Ga0070684_1000194081 509
309 3300005535 Ga0070684_100041500 Ga0070684_1000415002 509
310 3300005539 Ga0068853_100171713 Ga0068853_1001717131 509
311 3300005544 Ga0070686_100112851 Ga0070686_1001128511 509
312 3300005545 Ga0070695_100045648 Ga0070695_1000456482 509
313 3300005547 Ga0070693_100020072 Ga0070693_1000200722 509
314 3300005548 Ga0070665_100036167 Ga0070665_1000361672 509
315 3300005563 Ga0068855_100059733 Ga0068855_1000597333 509
316 3300005578 Ga0068854_100086846 Ga0068854_1000868463 509
317 3300005616 Ga0068852_100116116 Ga0068852_1001161163 509
318 3300005617 Ga0068859_100072533 Ga0068859_1000725332 509
319 3300005618 Ga0068864_100022592 Ga0068864_1000225922 509
320 3300005618 Ga0068864_100027765 Ga0068864_1000277651 509
321 3300005719 Ga0068861_100049768 Ga0068861_1000497683 509
322 3300005719 Ga0068861_100062578 Ga0068861_1000625781 509
323 3300005840 Ga0068870_10000839 Ga0068870_1000083910 509
324 3300005841 Ga0068863_100124278 Ga0068863_1001242782 509
325 3300005841 Ga0068863_100129809 Ga0068863_1001298091 509
326 3300005841 Ga0068863_100135733 Ga0068863_1001357331 509
327 3300005842 Ga0068858_100035223 Ga0068858_1000352232 509
328 3300005842 Ga0068858_100073135 Ga0068858_1000731352 509
329 3300005843 Ga0068860_100023260 Ga0068860_1000232604 509
330 3300005843 Ga0068860_100041626 Ga0068860_1000416262 509
331 3300005843 Ga0068860_100134682 Ga0068860_1001346823 509
332 3300005844 Ga0068862_100035208 Ga0068862_1000352081 509
333 3300005983 Ga0081540_1002128 Ga0081540_10021287 509
334 3300005983 Ga0081540_1004473 Ga0081540_10044735 509
335 3300005983 Ga0081540_1005381 Ga0081540_10053814 509
336 3300005983 Ga0081540_1038843 Ga0081540_10388432 509
337 3300006028 Ga0070717_10067029 Ga0070717_100670292 509
338 3300006038 Ga0075365_10022919 Ga0075365_100229194 509
339 3300006051 Ga0075364_10020684 Ga0075364_100206841 509
340 3300006163 Ga0070715_10041065 Ga0070715_100410651 509
341 3300006175 Ga0070712_100015400 Ga0070712_1000154002 509
342 3300006177 Ga0075362_10019926 Ga0075362_100199262 509
343 3300006178 Ga0075367_10014425 Ga0075367_100144254 509
344 3300006178 Ga0075367_10043976 Ga0075367_100439761 509
345 3300006186 Ga0075369_10003558 Ga0075369_100035583 509
346 3300006186 Ga0075369_10051112 Ga0075369_100511121 509
347 3300006195 Ga0075366_10052943 Ga0075366_100529431 509
348 3300006237 Ga0097621_100005781 Ga0097621_1000057819 509
349 3300006353 Ga0075370_10015429 Ga0075370_100154291 509
350 3300006358 Ga0068871_100005451 Ga0068871_1000054515 509
351 3300006358 Ga0068871_100059950 Ga0068871_1000599503 509
352 3300006871 Ga0075434_100099559 Ga0075434_1000995592 509
353 3300006881 Ga0068865_100071256 Ga0068865_1000712562 509
354 3300006931 Ga0097620_100072533 Ga0097620_1000725332 509
355 3300009092 Ga0105250_10022309 Ga0105250_100223093 509
356 3300009098 Ga0105245_10012782 Ga0105245_100127826 509
357 3300009147 Ga0114129_10024876 Ga0114129_1002487611 509
358 3300009174 Ga0105241_10005406 Ga0105241_100054064 509
359 3300009174 Ga0105241_10045709 Ga0105241_100457093 509
360 3300009176 Ga0105242_10003659 Ga0105242_100036592 509
361 3300009176 Ga0105242_10181536 Ga0105242_101815361 509
362 3300009177 Ga0105248_10008408 Ga0105248_100084088 509
363 3300009177 Ga0105248_10027007 Ga0105248_100270075 509
364 3300009545 Ga0105237_10022221 Ga0105237_100222212 509
365 3300010375 Ga0105239_10025578 Ga0105239_100255786 509
366 3300010375 Ga0105239_10109967 Ga0105239_101099672 509
367 3300011119 Ga0105246_10133486 Ga0105246_101334861 509
368 3300013296 Ga0157374_10047297 Ga0157374_100472973 509
369 3300013297 Ga0157378_10024710 Ga0157378_100247105 509
370 3300013297 Ga0157378_10029534 Ga0157378_100295342 509
371 3300013306 Ga0163162_10043427 Ga0163162_100434274 509
372 3300014325 Ga0163163_10046035 Ga0163163_100460354 509
373 3300014325 Ga0163163_10085243 Ga0163163_100852432 509
374 3300014326 Ga0157380_10179324 Ga0157380_101793241 509
375 3300014968 Ga0157379_10054072 Ga0157379_100540723 509
376 3300014968 Ga0157379_10148866 Ga0157379_101488661 509
377 3300014969 Ga0157376_10002379 Ga0157376_1000237912 509
378 3300014969 Ga0157376_10018085 Ga0157376_100180853 509
379 3300014969 Ga0157376_10058643 Ga0157376_100586433 509
380 3300017792 Ga0163161_10039279 Ga0163161_100392791 509
381 3300025271 Ga0207666_1000064 Ga0207666_10000641 509
382 3300025711 Ga0207696_1016932 Ga0207696_10169321 509
383 3300025900 Ga0207710_10001979 Ga0207710_100019795 509
384 3300025906 Ga0207699_10007364 Ga0207699_100073643 509
385 3300025907 Ga0207645_10017820 Ga0207645_100178203 509
386 3300025911 Ga0207654_10003273 Ga0207654_100032734 509
387 3300025911 Ga0207654_10060150 Ga0207654_100601502 509
388 3300025915 Ga0207693_10004125 Ga0207693_100041255 509
389 3300025915 Ga0207693_10018993 Ga0207693_100189934 509
390 3300025916 Ga0207663_10011825 Ga0207663_100118254 509
391 3300025917 Ga0207660_10095067 Ga0207660_100950673 509
392 3300025920 Ga0207649_10069394 Ga0207649_100693943 509
393 3300025923 Ga0207681_10111143 Ga0207681_101111431 509
394 3300025925 Ga0207650_10002016 Ga0207650_100020164 509
395 3300025927 Ga0207687_10013910 Ga0207687_100139102 509
396 3300025928 Ga0207700_10007998 Ga0207700_100079986 509
397 3300025931 Ga0207644_10081738 Ga0207644_100817381 509
398 3300025932 Ga0207690_10012193 Ga0207690_100121934 509
399 3300025933 Ga0207706_10025291 Ga0207706_100252912 509
400 3300025933 Ga0207706_10031111 Ga0207706_100311113 509
401 3300025935 Ga0207709_10113749 Ga0207709_101137491 509
402 3300025936 Ga0207670_10035216 Ga0207670_100352164 509
403 3300025937 Ga0207669_10033709 Ga0207669_100337093 509
404 3300025942 Ga0207689_10013624 Ga0207689_100136242 509
405 3300025942 Ga0207689_10023117 Ga0207689_100231173 509
406 3300025942 Ga0207689_10072443 Ga0207689_100724433 509
407 3300025949 Ga0207667_10113101 Ga0207667_101131012 509
408 3300025960 Ga0207651_10056318 Ga0207651_100563182 509
409 3300025961 Ga0207712_10015086 Ga0207712_100150863 509
410 3300025961 Ga0207712_10034675 Ga0207712_100346753 509
411 3300025972 Ga0207668_10006761 Ga0207668_100067617 509
412 3300025972 Ga0207668_10014835 Ga0207668_100148353 509
413 3300025986 Ga0207658_10018489 Ga0207658_100184891 509
414 3300025986 Ga0207658_10076641 Ga0207658_100766411 509
415 3300026035 Ga0207703_10020753 Ga0207703_100207532 509
416 3300026035 Ga0207703_10022951 Ga0207703_100229514 509
417 3300026035 Ga0207703_10081308 Ga0207703_100813082 509
418 3300026035 Ga0207703_10169598 Ga0207703_101695981 509
419 3300026067 Ga0207678_10004916 Ga0207678_100049162 509
420 3300026067 Ga0207678_10025389 Ga0207678_100253894 509
421 3300026067 Ga0207678_10034620 Ga0207678_100346202 509
422 3300026075 Ga0207708_10005065 Ga0207708_100050652 509
423 3300026078 Ga0207702_10052830 Ga0207702_100528302 509
424 3300026089 Ga0207648_10027089 Ga0207648_100270891 509
425 3300026095 Ga0207676_10140675 Ga0207676_101406751 509
426 3300026116 Ga0207674_10015139 Ga0207674_100151396 509
427 3300026118 Ga0207675_100026056 Ga0207675_1000260561 509
428 3300026118 Ga0207675_100026914 Ga0207675_1000269143 509
429 3300026121 Ga0207683_10006298 Ga0207683_100062987 509
430 3300026121 Ga0207683_10022292 Ga0207683_100222922 509
431 3300027717 Ga0209998_10007947 Ga0209998_100079472 509
432 3300027866 Ga0209813_10016402 Ga0209813_100164021 509
433 3300027907 Ga0207428_10000160 Ga0207428_1000016087 509
434 3300028379 Ga0268266_10001098 Ga0268266_1000109814 509
435 3300028379 Ga0268266_10025697 Ga0268266_100256975 509
436 3300028380 Ga0268265_10010066 Ga0268265_100100663 509
437 3300028380 Ga0268265_10028814 Ga0268265_100288143 509
438 3300028380 Ga0268265_10069356 Ga0268265_100693562 509
439 3300028381 Ga0268264_10046840 Ga0268264_100468401 509
440 3300035117 Ga0373953_0000879 Ga0373953_0000879_2046_3794 509
441 3300035118 Ga0373954_0000261 Ga0373954_0000261_3813_5561 509
442 3300035119 Ga0373956_0003139 Ga0373956_0003139_4936_6573 509
443 3300035171 Ga0373946_0016709 Ga0373946_0016709_1141_2751 509
444 3300035172 Ga0373955_0000455 Ga0373955_0000455_10334_12082 509
445 3300035692 Ga0373935_0032478 Ga0373935_0032478_1560_3176 509
446 3300035695 Ga0373927_0012295 Ga0373927_0012295_836_2452 509
447 3300035724 Ga0373933_0000346 Ga0373933_0000346_15420_17057 509
448 3300035725 Ga0373947_0017970 Ga0373947_0017970_2134_3750 509
449 3300036401 Ga0373937_0001412 Ga0373937_0001412_12400_14148 509
450 3300037068 Ga0373925_0044581 Ga0373925_0044581_39_1655 509
451 3300037471 Ga0395905_0058698 Ga0395905_0058698_739_2346 509
452 3300045051 Ga0451576_0017147 Ga0451576_0017147_2821_4485 509
453 3300046454 Ga0495592_0003017 Ga0495592_0003017_9808_11556 509
454 3300046459 Ga0495629_0017952 Ga0495629_0017952_291_2039 509
455 3300046459 Ga0495629_0029634 Ga0495629_0029634_1234_2850 509
456 3300046459 Ga0495629_0093222 Ga0495629_0093222_103_1704 509
457 3300046462 Ga0495651_0001035 Ga0495651_0001035_9120_10868 509
458 3300046463 Ga0495653_0000572 Ga0495653_0000572_15831_17579 509
459 3300046511 Ga0495608_0002256 Ga0495608_0002256_1416_3053 509
460 3300046514 Ga0495618_0028875 Ga0495618_0028875_959_2575 509
461 3300046516 Ga0495628_0069896 Ga0495628_0069896_265_1881 509
462 3300046516 Ga0495628_0075538 Ga0495628_0075538_883_2520 509
463 3300046529 Ga0495652_0002502 Ga0495652_0002502_7437_9074 509
464 3300046536 Ga0495587_0006519 Ga0495587_0006519_2046_3794 509
465 3300046559 Ga0495667_0011111 Ga0495667_0011111_4357_5994 509
466 3300046616 Ga0495668_0088374 Ga0495668_0088374_68_1663 509
467 3300046663 Ga0495635_0000241 Ga0495635_0000241_9998_11746 509
468 3300046663 Ga0495635_0032155 Ga0495635_0032155_1340_2956 509
469 3300046675 Ga0495657_0004360 Ga0495657_0004360_7845_9593 509
470 3300046678 Ga0495599_0000148 Ga0495599_0000148_14536_16284 509
471 3300046678 Ga0495599_0049182 Ga0495599_0049182_44_1654 509
472 3300046680 Ga0495646_0004040 Ga0495646_0004040_5151_6899 509
473 3300046683 Ga0495658_0013073 Ga0495658_0013073_593_2194 509
474 3300046694 Ga0495649_0088374 Ga0495649_0088374_20_1615 509
475 3300046809 Ga0495600_0009200 Ga0495600_0009200_4359_5996 509
476 3300047317 Ga0495604_0001413 Ga0495604_0001413_2174_3922 509
477 3300047319 Ga0495674_0014103 Ga0495674_0014103_2180_3796 509
478 3300047322 Ga0495680_0002177 Ga0495680_0002177_16742_18379 509
479 3300047444 Ga0495675_0001603 Ga0495675_0001603_2174_3922 509
480 3300047471 Ga0495684_0001447 Ga0495684_0001447_9984_11732 509
481 3300047673 Ga0495593_0021216 Ga0495593_0021216_1561_3198 509
482 3300048088 Ga0495602_0003318 Ga0495602_0003318_10646_12394 509
483 3300048904 Ga0496101_0063591 Ga0496101_0063591_925_2520 509
484 3300048904 Ga0496101_0156513 Ga0496101_0156513_50_1645 509
485 3300048905 Ga0496102_0041102 Ga0496102_0041102_1061_2656 509
486 3300048905 Ga0496102_0129742 Ga0496102_0129742_312_1907 509
487 3300048906 Ga0496103_0005938 Ga0496103_0005938_5110_6720 509
488 3300048907 Ga0496104_0057574 Ga0496104_0057574_1632_3263 509
489 3300048907 Ga0496104_0075451 Ga0496104_0075451_936_2546 509
490 3300048908 Ga0496105_0016921 Ga0496105_0016921_1879_3510 509
491 3300048909 Ga0496106_0004025 Ga0496106_0004025_3147_4757 509
492 3300048909 Ga0496106_0075850 Ga0496106_0075850_394_1989 509
493 3300048910 Ga0496107_0100484 Ga0496107_0100484_244_1839 509
494 3300048911 Ga0496108_0001479 Ga0496108_0001479_13406_15037 509
495 3300048911 Ga0496108_0038860 Ga0496108_0038860_816_2411 509
496 3300048912 Ga0496109_0031710 Ga0496109_0031710_2092_3687 509
497 3300048913 Ga0496110_0002118 Ga0496110_0002118_5287_6918 509
498 3300048913 Ga0496110_0020761 Ga0496110_0020761_1008_2618 509
499 3300048914 Ga0496111_0024330 Ga0496111_0024330_2569_4179 509
500 3300048915 Ga0496112_0006792 Ga0496112_0006792_326_1957 509
501 3300048916 Ga0496113_0008271 Ga0496113_0008271_1937_3568 509
502 3300048918 Ga0496115_0028143 Ga0496115_0028143_2034_3662 509
503 3300048918 Ga0496115_0041834 Ga0496115_0041834_1893_3503 509
504 3300048921 Ga0496118_0062490 Ga0496118_0062490_1125_2720 509
505 3300050489 nmdc:mga03683_16162_c1 nmdc:mga03683_16162_c1_876_2555 509
506 3300050490 nmdc:mga03n38_1205_c1 nmdc:mga03n38_1205_c1_1716_3311 509
507 3300050491 nmdc:mga00v17_94936_c1 nmdc:mga00v17_94936_c1_67_1662 509
508 3300050492 nmdc:mga0yw44_28384_c1 nmdc:mga0yw44_28384_c1_847_2442 509
509 3300050493 nmdc:mga0k408_16229_c1 nmdc:mga0k408_16229_c1_1520_3115 509
510 3300050495 nmdc:mga04h51_13389_c1 nmdc:mga04h51_13389_c1_663_2258 509
511 3300050496 nmdc:mga07m45_3035_c1 nmdc:mga07m45_3035_c1_874_2469 509
512 3300050507 nmdc:mga05p37_352466_c1 nmdc:mga05p37_352466_c1_78_1685 509
513 3300050508 nmdc:mga09592_18393_c1 nmdc:mga09592_18393_c1_1138_2748 509
514 3300050509 nmdc:mga0qj67_26650_c1 nmdc:mga0qj67_26650_c1_812_2422 509
515 3300050510 nmdc:mga06r32_33119_c1 nmdc:mga06r32_33119_c1_2499_4109 509
516 3300050515 nmdc:mga0a205_104800_c1 nmdc:mga0a205_104800_c1_832_2508 509
517 3300053077 Ga0495601_0000859 Ga0495601_0000859_1982_3583 509
518 3300053077 Ga0495601_0001776 Ga0495601_0001776_8173_9789 509
519 3300053078 Ga0495612_0005812 Ga0495612_0005812_1832_3448 509
520 3300053084 Ga0495595_0000900 Ga0495595_0000900_2173_3921 509
521 3300053084 Ga0495595_0058527 Ga0495595_0058527_161_1777 509
522 3300053085 Ga0495619_0002838 Ga0495619_0002838_7267_9015 509
523 3300053085 Ga0495619_0005323 Ga0495619_0005323_3658_5274 509

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

130

470

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aj0-assembly1.cif.gz_F crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. 0.8701 10 493
7aj0-assembly1.cif.gz_F crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. 0.8011 10 493
6bia-assembly1.cif.gz_C crystal structure of ps i-cgsb 0.7946 10 502
6b0j-assembly1.cif.gz_B crystal structure of ps i-cgsb in complex with k-i-k-neocarrahexaose 0.7907 10 502
1e1z-assembly1.cif.gz_P-2 crystal structure of an arylsulfatase a mutant c69s 0.788 10 469
ID Description Score Start End Superfamily
1e1zP01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8269 10 393 3.40.720.10
af_Q32KJ6_30_387_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8173 10 388 3.40.720.10
1p49A01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8026 8 385 3.40.720.10
af_Q8SZ72_26_377_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7909 10 393 3.40.720.10
af_Q32KJ6_30_387_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7896 10 388 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A656SH01-F1-model_v4 deleted 0.9812 15 136
AF-A0A521L2S4-F1-model_v4 Arylsulfatase 0.9764 10 291
AF-A0A349EIJ6-F1-model_v4 Arylsulfatase 0.9709 10 227
AF-A0A4R1W9X4-F1-model_v4 Sulfatase-like protein 0.97 10 240
AF-A0A2V5WHS8-F1-model_v4 Arylsulfatase 0.9667 10 242

Feature Viewer

pLDDT pTM Quality
83.86 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map