F458946

General Info

Members Datasets Scaffolds Average Seq Length
523 265 521 99

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100098451|Ga0070714_1000984512
Length 120
Sequence MTEAATAMPGAAAKGATRVVRVVLPGPLRQLARVSGEVLVDAVPDADGRVTQRALLDAVEARYPMLKGTMRDQDTKIRRAYVRFYGCERDLSPQSADTPLPDAVTDGREPFLVVGALAGG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
3 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
4 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
203 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
204 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
205 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
206 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 1.53
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 5.74
Rhizosphere 93.12
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_291498 2162886007 Bacteria 1688
2 Ga0065703_1019513 3300005272 Bacteria 2808
3 Ga0065712_10098998 3300005290 Bacteria 2087
4 Ga0065715_10684539 3300005293 Unclassified 661
5 Ga0065707_10012222 3300005295 Bacteria 1932
6 Ga0065707_10139243 3300005295 Bacteria 1795
7 Ga0070658_10098792 3300005327 Bacteria 2412
8 Ga0070676_10031165 3300005328 Bacteria 3045
9 Ga0070676_10184903 3300005328 Bacteria 1357
10 Ga0070676_10551825 3300005328 Unclassified 825
11 Ga0070676_10737358 3300005328 Unclassified 722
12 Ga0070683_100602617 3300005329 Bacteria 1051
13 Ga0070690_100125050 3300005330 Bacteria 1730
14 Ga0070670_100001743 3300005331 Bacteria 17718
15 Ga0070670_100199386 3300005331 Bacteria 1739
16 Ga0070670_100342826 3300005331 Bacteria 1312
17 Ga0070670_100791461 3300005331 Bacteria 856
18 Ga0070666_10017143 3300005335 Bacteria 4642
19 Ga0070666_10027760 3300005335 Bacteria 3709
20 Ga0070666_10061740 3300005335 Bacteria 2538
21 Ga0070682_101171375 3300005337 Bacteria 647
22 Ga0068868_100102598 3300005338 Bacteria 2316
23 Ga0068868_100187050 3300005338 Bacteria 1721
24 Ga0068868_100734882 3300005338 Bacteria 886
25 Ga0068868_101710032 3300005338 Bacteria 593
26 Ga0068868_101765770 3300005338 Unclassified 584
27 Ga0070660_101193151 3300005339 Bacteria 645
28 Ga0070689_100756485 3300005340 Bacteria 852
29 Ga0070687_100108935 3300005343 Bacteria 1564
30 Ga0070661_100020606 3300005344 Bacteria 4704
31 Ga0070692_10188767 3300005345 Bacteria 1199
32 Ga0070668_100024862 3300005347 Bacteria 4540
33 Ga0070669_100021430 3300005353 Bacteria 4618
34 Ga0070669_101358691 3300005353 Bacteria 616
35 Ga0070669_101749583 3300005353 Bacteria 542
36 Ga0070675_100039523 3300005354 Bacteria 3850
37 Ga0070675_100076060 3300005354 Bacteria 2792
38 Ga0070675_100088747 3300005354 Bacteria 2588
39 Ga0070675_100539773 3300005354 Bacteria 1054
40 Ga0070675_100894031 3300005354 Bacteria 814
41 Ga0070671_100012342 3300005355 Bacteria 6879
42 Ga0070671_100500119 3300005355 Unclassified 1046
43 Ga0070671_100697313 3300005355 Unclassified 880
44 Ga0070674_100004778 3300005356 Bacteria 7762
45 Ga0070674_100283825 3300005356 Bacteria 1313
46 Ga0070674_101021237 3300005356 Unclassified 726
47 Ga0070673_100059339 3300005364 Bacteria 3028
48 Ga0070688_100004677 3300005365 Bacteria 7145
49 Ga0070667_100070574 3300005367 Bacteria 2973
50 Ga0070667_100282585 3300005367 Bacteria 1490
51 Ga0070667_100365884 3300005367 Bacteria 1308
52 Ga0070667_101152247 3300005367 Unclassified 725
53 Ga0070667_101628978 3300005367 Unclassified 607
54 Ga0070709_10004736 3300005434 Bacteria 7347
55 Ga0070709_10727672 3300005434 Bacteria 774
56 Ga0070709_10830182 3300005434 Bacteria 727
57 Ga0070709_11697228 3300005434 Bacteria 516
58 Ga0070714_100098451 3300005435 Bacteria 2573
59 Ga0070714_100173623 3300005435 Bacteria 1957
60 Ga0070714_100659601 3300005435 Bacteria 1007
61 Ga0070713_100125072 3300005436 Bacteria 2260
62 Ga0070713_100204425 3300005436 Bacteria 1785
63 Ga0070713_100383777 3300005436 Bacteria 1309
64 Ga0070713_100438049 3300005436 Bacteria 1226
65 Ga0070713_100856721 3300005436 Bacteria 873
66 Ga0070710_10079551 3300005437 Bacteria 1910
67 Ga0070710_10177518 3300005437 Unclassified 1331
68 Ga0070710_10213876 3300005437 Bacteria 1223
69 Ga0070710_10222095 3300005437 Bacteria 1202
70 Ga0070710_10379977 3300005437 Unclassified 942
71 Ga0070711_100010802 3300005439 Bacteria 5662
72 Ga0070711_100146807 3300005439 Bacteria 1775
73 Ga0070711_100518628 3300005439 Bacteria 985
74 Ga0070705_100004129 3300005440 Bacteria 7095
75 Ga0070705_100061196 3300005440 Bacteria 2237
76 Ga0070705_100871144 3300005440 Bacteria 722
77 Ga0070700_100494078 3300005441 Bacteria 940
78 Ga0070708_100011864 3300005445 Bacteria 7093
79 Ga0070708_100066383 3300005445 Bacteria 3239
80 Ga0070708_100133100 3300005445 Bacteria 2302
81 Ga0070708_100300069 3300005445 Unclassified 1513
82 Ga0070708_100491614 3300005445 Bacteria 1157
83 Ga0070708_100965398 3300005445 Unclassified 799
84 Ga0070708_101710966 3300005445 Bacteria 584
85 Ga0070708_102034214 3300005445 Unclassified 532
86 Ga0070663_100058646 3300005455 Bacteria 2765
87 Ga0070663_100460392 3300005455 Bacteria 1050
88 Ga0070678_100035823 3300005456 Bacteria 3469
89 Ga0070678_100038155 3300005456 Bacteria 3380
90 Ga0070678_100054297 3300005456 Bacteria 2918
91 Ga0070678_100072832 3300005456 Bacteria 2577
92 Ga0070678_100274664 3300005456 Bacteria 1423
93 Ga0070681_10078561 3300005458 Bacteria 3257
94 Ga0070681_10157540 3300005458 Bacteria 2195
95 Ga0070681_10829295 3300005458 Bacteria 842
96 Ga0068867_100207638 3300005459 Bacteria 1571
97 Ga0068867_102261981 3300005459 Unclassified 516
98 Ga0070685_10020253 3300005466 Bacteria 3600
99 Ga0070706_100009596 3300005467 Bacteria 8999
100 Ga0070706_100095870 3300005467 Unclassified 2754
101 Ga0070706_100192123 3300005467 Bacteria 1907
102 Ga0070707_100008884 3300005468 Bacteria 9320
103 Ga0070707_100103964 3300005468 Bacteria 2753
104 Ga0070698_100010100 3300005471 Bacteria 10083
105 Ga0070698_100333092 3300005471 Bacteria 1449
106 Ga0070698_100381147 3300005471 Bacteria 1343
107 Ga0070698_101194977 3300005471 Unclassified 710
108 Ga0070699_100111599 3300005518 Bacteria 2401
109 Ga0070699_100155133 3300005518 Bacteria 2026
110 Ga0070679_100805444 3300005530 Bacteria 883
111 Ga0070684_101047288 3300005535 Bacteria 766
112 Ga0070697_100221228 3300005536 Bacteria 1613
113 Ga0070697_100314442 3300005536 Bacteria 1348
114 Ga0070697_100528126 3300005536 Bacteria 1033
115 Ga0070697_100623886 3300005536 Unclassified 948
116 Ga0070697_101545418 3300005536 Unclassified 593
117 Ga0070697_101989260 3300005536 Bacteria 520
118 Ga0068853_100516278 3300005539 Bacteria 1129
119 Ga0068853_100737205 3300005539 Bacteria 941
120 Ga0070672_100009621 3300005543 Bacteria 6671
121 Ga0070672_100346407 3300005543 Bacteria 1266
122 Ga0070695_100037157 3300005545 Bacteria 3068
123 Ga0070695_100957686 3300005545 Bacteria 694
124 Ga0070696_100030703 3300005546 Bacteria 3681
125 Ga0070696_100206138 3300005546 Bacteria 1470
126 Ga0070696_100504795 3300005546 Bacteria 963
127 Ga0070696_100711988 3300005546 Bacteria 819
128 Ga0070696_101203560 3300005546 Bacteria 640
129 Ga0070693_100295553 3300005547 Unclassified 1090
130 Ga0070665_100236700 3300005548 Unclassified 1826
131 Ga0070665_100543627 3300005548 Bacteria 1174
132 Ga0070665_101813220 3300005548 Unclassified 617
133 Ga0068855_100175383 3300005563 Bacteria 2426
134 Ga0068855_100302894 3300005563 Bacteria 1770
135 Ga0068854_100000001 3300005578 Bacteria 608908
136 Ga0068854_100706440 3300005578 Bacteria 871
137 Ga0068854_101570187 3300005578 Bacteria 599
138 Ga0068856_100005936 3300005614 Bacteria 12021
139 Ga0068856_100193535 3300005614 Bacteria 2047
140 Ga0070702_100611646 3300005615 Unclassified 818
141 Ga0068852_100504726 3300005616 Bacteria 1205
142 Ga0068852_100588823 3300005616 Bacteria 1116
143 Ga0068852_101444794 3300005616 Bacteria 710
144 Ga0068866_10228375 3300005718 Bacteria 1127
145 Ga0068861_102481785 3300005719 Bacteria 522
146 Ga0068863_100001650 3300005841 Bacteria 22068
147 Ga0068863_100692980 3300005841 Bacteria 1012
148 Ga0068863_100869234 3300005841 Bacteria 901
149 Ga0068858_101435399 3300005842 Bacteria 680
150 Ga0081539_10155149 3300005985 Bacteria 1097
151 Ga0070717_10015357 3300006028 Bacteria 5914
152 Ga0070717_10121787 3300006028 Bacteria 2235
153 Ga0070717_11799196 3300006028 Bacteria 554
154 Ga0070715_10031606 3300006163 Bacteria 2150
155 Ga0070716_100047306 3300006173 Bacteria 2426
156 Ga0070716_100090831 3300006173 Bacteria 1848
157 Ga0070716_100181288 3300006173 Unclassified 1383
158 Ga0070712_100010137 3300006175 Bacteria 5940
159 Ga0070712_100050131 3300006175 Unclassified 2902
160 Ga0070712_100093583 3300006175 Bacteria 2206
161 Ga0070712_100113267 3300006175 Bacteria 2028
162 Ga0070712_101114429 3300006175 Unclassified 685
163 Ga0075367_10589843 3300006178 Bacteria 706
164 Ga0075366_10855952 3300006195 Bacteria 566
165 Ga0097621_100306792 3300006237 Bacteria 1403
166 Ga0097621_101835897 3300006237 Bacteria 578
167 Ga0068871_100033180 3300006358 Bacteria 4085
168 Ga0068871_100650977 3300006358 Unclassified 962
169 Ga0068871_101460139 3300006358 Bacteria 646
170 Ga0075428_100517064 3300006844 Bacteria 1277
171 Ga0075431_100696407 3300006847 Bacteria 994
172 Ga0075431_101019322 3300006847 Bacteria 794
173 Ga0075433_10866858 3300006852 Unclassified 788
174 Ga0075434_100147164 3300006871 Bacteria 2376
175 Ga0075429_101422370 3300006880 Bacteria 604
176 Ga0068865_102160632 3300006881 Unclassified 506
177 Ga0075436_100021339 3300006914 Bacteria 4446
178 Ga0075435_100376116 3300007076 Bacteria 1220
179 Ga0075435_101239903 3300007076 Bacteria 653
180 Ga0099794_10438609 3300007265 Unclassified 684
181 Ga0105240_10013461 3300009093 Bacteria 11234
182 Ga0105240_10345316 3300009093 Bacteria 1690
183 Ga0105240_10361824 3300009093 Unclassified 1643
184 Ga0105240_11131245 3300009093 Bacteria 832
185 Ga0111539_10004383 3300009094 Bacteria 18467
186 Ga0105245_10009908 3300009098 Bacteria 8299
187 Ga0105245_10128762 3300009098 Bacteria 2372
188 Ga0114129_10485488 3300009147 Bacteria 1616
189 Ga0105243_11559169 3300009148 Bacteria 686
190 Ga0105241_10734851 3300009174 Bacteria 904
191 Ga0105248_10858980 3300009177 Bacteria 1024
192 Ga0105248_11189404 3300009177 Bacteria 862
193 Ga0105238_10388168 3300009551 Unclassified 1388
194 Ga0105238_12576979 3300009551 Bacteria 545
195 Ga0105249_12208552 3300009553 Bacteria 623
196 Ga0105239_12402153 3300010375 Bacteria 614
197 Ga0105246_10583254 3300011119 Unclassified 963
198 Ga0105246_11701085 3300011119 Unclassified 599
199 Ga0157339_1011526 3300012505 Bacteria 816
200 Ga0157373_10702951 3300013100 Bacteria 741
201 Ga0157373_10853575 3300013100 Unclassified 674
202 Ga0157374_10003649 3300013296 Bacteria 12952
203 Ga0157374_10008509 3300013296 Bacteria 8778
204 Ga0157374_10038850 3300013296 Bacteria 4377
205 Ga0157374_10054885 3300013296 Bacteria 3717
206 Ga0157374_10372141 3300013296 Unclassified 1422
207 Ga0157374_10413842 3300013296 Bacteria 1346
208 Ga0157378_10037489 3300013297 Bacteria 4294
209 Ga0157378_10106094 3300013297 Bacteria 2570
210 Ga0157378_10199194 3300013297 Unclassified 1893
211 Ga0157378_10219477 3300013297 Bacteria 1807
212 Ga0157378_10303075 3300013297 Unclassified 1547
213 Ga0157378_10534524 3300013297 Bacteria 1176
214 Ga0157378_10760748 3300013297 Bacteria 992
215 Ga0157378_11511488 3300013297 Bacteria 716
216 Ga0157378_11744346 3300013297 Bacteria 670
217 Ga0163162_10025857 3300013306 Bacteria 5802
218 Ga0163162_10047376 3300013306 Bacteria 4308
219 Ga0163162_10220004 3300013306 Bacteria 2029
220 Ga0163162_10457768 3300013306 Bacteria 1407
221 Ga0163162_11976223 3300013306 Unclassified 668
222 Ga0157372_10285973 3300013307 Bacteria 1917
223 Ga0157372_11808853 3300013307 Unclassified 702
224 Ga0157375_10025531 3300013308 Bacteria 5492
225 Ga0157375_10408046 3300013308 Bacteria 1525
226 Ga0157375_10595176 3300013308 Bacteria 1265
227 Ga0157375_13173947 3300013308 Unclassified 548
228 Ga0157375_13750981 3300013308 Bacteria 505
229 Ga0163163_10121974 3300014325 Bacteria 2641
230 Ga0163163_11098612 3300014325 Bacteria 858
231 Ga0157377_10711411 3300014745 Bacteria 730
232 Ga0157377_11711172 3300014745 Bacteria 508
233 Ga0157376_10021880 3300014969 Bacteria 4972
234 Ga0157376_10566368 3300014969 Bacteria 1126
235 Ga0157376_11254106 3300014969 Unclassified 770
236 Ga0163161_10008101 3300017792 Bacteria 7267
237 Ga0197907_10288390 3300020069 Bacteria 519
238 Ga0197907_10850257 3300020069 Bacteria 1735
239 Ga0206356_11686282 3300020070 Bacteria 9572
240 Ga0206356_11841930 3300020070 Bacteria 2614
241 Ga0206352_10241420 3300020078 Bacteria 772
242 Ga0206354_10340800 3300020081 Bacteria 3101
243 Ga0206353_11011302 3300020082 Bacteria 5437
244 Ga0224712_10036212 3300022467 Bacteria 1827
245 Ga0207697_10000854 3300025315 Bacteria 17240
246 Ga0207692_10034745 3300025898 Bacteria 2443
247 Ga0207692_10471613 3300025898 Unclassified 793
248 Ga0207688_10055143 3300025901 Bacteria 2230
249 Ga0207680_10015145 3300025903 Bacteria 4017
250 Ga0207680_10040413 3300025903 Bacteria 2714
251 Ga0207680_10277805 3300025903 Bacteria 1163
252 Ga0207685_10630247 3300025905 Bacteria 578
253 Ga0207699_10009049 3300025906 Bacteria 4942
254 Ga0207699_10174652 3300025906 Bacteria 1440
255 Ga0207699_11111605 3300025906 Unclassified 585
256 Ga0207645_10009259 3300025907 Bacteria 6823
257 Ga0207645_10397833 3300025907 Bacteria 926
258 Ga0207645_10490314 3300025907 Bacteria 831
259 Ga0207705_10003728 3300025909 Bacteria 11600
260 Ga0207705_10583935 3300025909 Bacteria 869
261 Ga0207684_10000236 3300025910 Bacteria 83977
262 Ga0207684_10003260 3300025910 Bacteria 15924
263 Ga0207684_10004441 3300025910 Bacteria 13222
264 Ga0207684_10088592 3300025910 Unclassified 2637
265 Ga0207684_10099417 3300025910 Bacteria 2485
266 Ga0207684_10110691 3300025910 Bacteria 2351
267 Ga0207684_10461391 3300025910 Bacteria 1090
268 Ga0207684_10786058 3300025910 Bacteria 805
269 Ga0207707_10001020 3300025912 Bacteria 26893
270 Ga0207707_10064367 3300025912 Bacteria 3192
271 Ga0207707_10200109 3300025912 Bacteria 1742
272 Ga0207695_10410718 3300025913 Unclassified 1238
273 Ga0207695_10720608 3300025913 Bacteria 878
274 Ga0207695_10773759 3300025913 Bacteria 840
275 Ga0207693_10005749 3300025915 Bacteria 10291
276 Ga0207693_10012762 3300025915 Bacteria 6781
277 Ga0207693_10019355 3300025915 Bacteria 5416
278 Ga0207693_10030131 3300025915 Bacteria 4284
279 Ga0207693_10118606 3300025915 Bacteria 2078
280 Ga0207663_10016144 3300025916 Bacteria 4134
281 Ga0207663_10024800 3300025916 Bacteria 3458
282 Ga0207663_10092620 3300025916 Bacteria 2009
283 Ga0207663_10239624 3300025916 Bacteria 1330
284 Ga0207660_10003998 3300025917 Bacteria 9610
285 Ga0207657_10207015 3300025919 Bacteria 1576
286 Ga0207657_10809110 3300025919 Bacteria 724
287 Ga0207649_10673743 3300025920 Bacteria 801
288 Ga0207652_10004326 3300025921 Bacteria 11571
289 Ga0207646_10120873 3300025922 Bacteria 2353
290 Ga0207646_10182544 3300025922 Bacteria 1895
291 Ga0207646_10732427 3300025922 Bacteria 883
292 Ga0207681_10027734 3300025923 Bacteria 3664
293 Ga0207681_10188203 3300025923 Bacteria 1577
294 Ga0207694_10548544 3300025924 Bacteria 970
295 Ga0207650_10003332 3300025925 Bacteria 11053
296 Ga0207650_10146898 3300025925 Bacteria 1858
297 Ga0207650_10564475 3300025925 Bacteria 955
298 Ga0207650_10818206 3300025925 Bacteria 790
299 Ga0207659_10022477 3300025926 Bacteria 4199
300 Ga0207659_10562425 3300025926 Unclassified 970
301 Ga0207659_10620267 3300025926 Bacteria 923
302 Ga0207659_11316672 3300025926 Unclassified 620
303 Ga0207687_10012150 3300025927 Bacteria 5632
304 Ga0207687_10415139 3300025927 Bacteria 1110
305 Ga0207700_10022927 3300025928 Bacteria 4292
306 Ga0207700_10123482 3300025928 Bacteria 2103
307 Ga0207700_10589759 3300025928 Unclassified 989
308 Ga0207664_10080060 3300025929 Bacteria 2654
309 Ga0207644_10049703 3300025931 Bacteria 3003
310 Ga0207644_10055802 3300025931 Bacteria 2848
311 Ga0207644_10603798 3300025931 Unclassified 911
312 Ga0207644_10710843 3300025931 Unclassified 838
313 Ga0207690_10176375 3300025932 Bacteria 1605
314 Ga0207706_10116308 3300025933 Bacteria 2352
315 Ga0207706_11532755 3300025933 Unclassified 542
316 Ga0207670_10627840 3300025936 Bacteria 884
317 Ga0207669_10404303 3300025937 Bacteria 1070
318 Ga0207669_11384852 3300025937 Bacteria 599
319 Ga0207704_11065146 3300025938 Bacteria 686
320 Ga0207665_10064527 3300025939 Bacteria 2489
321 Ga0207691_10007536 3300025940 Bacteria 10474
322 Ga0207691_11735759 3300025940 Bacteria 504
323 Ga0207711_10591775 3300025941 Bacteria 1035
324 Ga0207711_11147710 3300025941 Bacteria 718
325 Ga0207661_10456818 3300025944 Bacteria 1164
326 Ga0207661_10572993 3300025944 Bacteria 1035
327 Ga0207667_10240347 3300025949 Bacteria 1853
328 Ga0207667_10247462 3300025949 Bacteria 1824
329 Ga0207651_10104849 3300025960 Bacteria 2107
330 Ga0207651_10506960 3300025960 Unclassified 1044
331 Ga0207651_11426643 3300025960 Unclassified 623
332 Ga0207668_10256977 3300025972 Bacteria 1422
333 Ga0207668_10277815 3300025972 Bacteria 1372
334 Ga0207640_10000003 3300025981 Bacteria 505282
335 Ga0207640_10415509 3300025981 Bacteria 1099
336 Ga0207658_10009327 3300025986 Bacteria 6655
337 Ga0207658_10235579 3300025986 Bacteria 1548
338 Ga0207658_10284461 3300025986 Bacteria 1419
339 Ga0207658_10391341 3300025986 Unclassified 1220
340 Ga0207658_10549787 3300025986 Bacteria 1033
341 Ga0207677_10044878 3300026023 Bacteria 2948
342 Ga0207677_11387381 3300026023 Bacteria 647
343 Ga0207703_10037885 3300026035 Bacteria 3844
344 Ga0207703_11578354 3300026035 Bacteria 631
345 Ga0207639_10022648 3300026041 Bacteria 4527
346 Ga0207678_10083083 3300026067 Bacteria 2740
347 Ga0207678_10121977 3300026067 Bacteria 2224
348 Ga0207702_10077387 3300026078 Bacteria 2877
349 Ga0207641_10009942 3300026088 Bacteria 7829
350 Ga0207641_10150179 3300026088 Bacteria 2110
351 Ga0207641_10589848 3300026088 Bacteria 1087
352 Ga0207641_12137596 3300026088 Unclassified 560
353 Ga0207675_100216823 3300026118 Bacteria 1843
354 Ga0207675_100492844 3300026118 Bacteria 1219
355 Ga0207675_101904472 3300026118 Bacteria 613
356 Ga0207675_102623842 3300026118 Bacteria 513
357 Ga0207683_10012242 3300026121 Bacteria 7323
358 Ga0207683_10108782 3300026121 Bacteria 2481
359 Ga0207683_10325701 3300026121 Bacteria 1408
360 Ga0207683_10463769 3300026121 Bacteria 1168
361 Ga0207698_12572878 3300026142 Bacteria 519
362 Ga0268266_10038515 3300028379 Bacteria 4069
363 Ga0268266_10770610 3300028379 Bacteria 929
364 Ga0268266_11894612 3300028379 Unclassified 570
365 Ga0268265_11571858 3300028380 Bacteria 662
366 Ga0268265_11725446 3300028380 Bacteria 632
367 Ga0268265_12080723 3300028380 Bacteria 575
368 Ga0268265_12620311 3300028380 Unclassified 510
369 Ga0268264_10182601 3300028381 Bacteria 1906
370 Ga0265330_10188941 3300031235 Bacteria 872
371 Ga0265332_10006760 3300031238 Bacteria 5197
372 Ga0265332_10331568 3300031238 Bacteria 628
373 Ga0265329_10269673 3300031242 Bacteria 570
374 Ga0265339_10001696 3300031249 Bacteria 16254
375 Ga0265331_10059800 3300031250 Bacteria 1801
376 Ga0265327_10006819 3300031251 Bacteria 9002
377 Ga0307509_10008868 3300031507 Bacteria 12688
378 Ga0265313_10430084 3300031595 Bacteria 515
379 Ga0265314_10020409 3300031711 Bacteria 5113
380 Ga0265342_10012485 3300031712 Bacteria 5752
381 Ga0316576_10261265 3300031727 Bacteria 1299
382 Ga0316578_10299713 3300031728 Bacteria 961
383 Ga0307516_10470430 3300031730 Bacteria 912
384 Ga0307405_10410701 3300031731 Bacteria 1062
385 Ga0307405_11038490 3300031731 Bacteria 701
386 Ga0307410_11084345 3300031852 Bacteria 694
387 Ga0307407_10492982 3300031903 Bacteria 897
388 Ga0307412_10237838 3300031911 Bacteria 1407
389 Ga0307409_101161695 3300031995 Bacteria 794
390 Ga0307416_100896928 3300032002 Bacteria 986
391 Ga0307414_10230729 3300032004 Bacteria 1526
392 Ga0307411_10115466 3300032005 Bacteria 1931
393 Ga0307411_10368193 3300032005 Bacteria 1178
394 Ga0373926_0055700 3300035083 Bacteria 1433
395 Ga0373926_0180875 3300035083 Unclassified 808
396 Ga0373944_0048002 3300035089 Bacteria 1339
397 Ga0373944_0278878 3300035089 Bacteria 623
398 Ga0373923_0485581 3300035111 Unclassified 601
399 Ga0373936_0285219 3300035113 Bacteria 743
400 Ga0373945_0013206 3300035116 Bacteria 2753
401 Ga0373945_0071093 3300035116 Bacteria 1317
402 Ga0373945_0302552 3300035116 Bacteria 685
403 Ga0373960_0314457 3300035121 Bacteria 586
404 Ga0373943_0027007 3300035170 Bacteria 2694
405 Ga0373943_0306730 3300035170 Unclassified 902
406 Ga0373943_0379536 3300035170 Bacteria 813
407 Ga0373946_0066937 3300035171 Bacteria 1541
408 Ga0373946_0109569 3300035171 Bacteria 1248
409 Ga0373946_0562527 3300035171 Unclassified 589
410 Ga0373946_0675508 3300035171 Unclassified 539
411 Ga0373935_0017087 3300035692 Bacteria 4395
412 Ga0373935_0047170 3300035692 Bacteria 2723
413 Ga0373935_0060339 3300035692 Bacteria 2426
414 Ga0373935_0138338 3300035692 Bacteria 1643
415 Ga0373935_1198635 3300035692 Unclassified 566
416 Ga0373927_0023279 3300035695 Bacteria 4057
417 Ga0373947_0006717 3300035725 Bacteria 6674
418 Ga0373947_0047497 3300035725 Bacteria 2572
419 Ga0373947_0253550 3300035725 Bacteria 1164
420 Ga0373947_0358549 3300035725 Unclassified 979
421 Ga0373947_0729662 3300035725 Unclassified 676
422 Ga0373937_0567388 3300036401 Unclassified 1078
423 Ga0373937_0607591 3300036401 Bacteria 1038
424 Ga0373937_0770387 3300036401 Bacteria 910
425 Ga0316584_0027028 3300036712 Bacteria 4221
426 Ga0373925_0002783 3300037068 Bacteria 13812
427 Ga0373925_0079995 3300037068 Bacteria 2484
428 Ga0373925_0423863 3300037068 Bacteria 1087
429 Ga0395900_0004019 3300037418 Bacteria 15697
430 Ga0395898_1406019 3300037466 Unclassified 625
431 Ga0395905_1157971 3300037471 Bacteria 677
432 Ga0395901_0651595 3300038443 Bacteria 1056
433 Ga0436362_0501654 3300039453 Unclassified 759
434 Ga0451789_0456917 3300041443 Bacteria 531
435 Ga0451791_1817682 3300041451 Bacteria 973
436 Ga0451843_0502551 3300041509 Bacteria 1017
437 Ga0450923_119487 3300042125 Bacteria 621
438 Ga0450907_012539 3300042146 Bacteria 1412
439 Ga0439458_0201842 3300042157 Bacteria 544
440 Ga0450908_000945 3300042184 Bacteria 5597
441 Ga0439464_0081901 3300042439 Bacteria 965
442 Ga0466966_0048017 3300044684 Bacteria 2720
443 Ga0466966_0272853 3300044684 Bacteria 1018
444 Ga0466961_0023664 3300044693 Bacteria 3952
445 Ga0466961_0675380 3300044693 Bacteria 619
446 Ga0466963_0064857 3300044694 Bacteria 2448
447 Ga0466964_0898205 3300044706 Unclassified 507
448 Ga0466957_0139280 3300044842 Bacteria 1562
449 Ga0466959_0173447 3300045049 Bacteria 1511
450 Ga0466959_0592667 3300045049 Bacteria 746
451 Ga0466958_0022098 3300045836 Bacteria 3723
452 Ga0495580_0538199 3300046472 Bacteria 777
453 Ga0495639_0120376 3300046475 Bacteria 1252
454 Ga0495584_0263680 3300046491 Unclassified 876
455 Ga0495608_0195373 3300046511 Bacteria 1276
456 Ga0495630_0040776 3300046517 Bacteria 3469
457 Ga0495630_0389378 3300046517 Bacteria 1068
458 Ga0495637_0117193 3300046520 Bacteria 1028
459 Ga0495663_0334260 3300046525 Unclassified 550
460 Ga0495666_0053589 3300046526 Bacteria 1935
461 Ga0495642_0030910 3300046528 Bacteria 2145
462 Ga0495665_0335630 3300046531 Bacteria 771
463 Ga0495640_0792770 3300046533 Unclassified 565
464 Ga0495598_0004342 3300046537 Bacteria 3063
465 Ga0495667_0034908 3300046559 Bacteria 3363
466 Ga0495668_0512914 3300046616 Unclassified 661
467 Ga0495659_0032152 3300046664 Bacteria 1835
468 Ga0495647_0152861 3300046681 Bacteria 990
469 Ga0495669_0020388 3300046684 Bacteria 2868
470 Ga0495613_0596179 3300046689 Unclassified 736
471 Ga0495624_0217010 3300046690 Bacteria 1160
472 Ga0495670_0603896 3300046691 Unclassified 598
473 Ga0495581_0151576 3300047315 Bacteria 1354
474 Ga0495681_0203819 3300047470 Bacteria 801
475 Ga0495593_0605656 3300047673 Bacteria 550
476 Ga0496101_0013434 3300048904 Bacteria 5486
477 Ga0496101_1116857 3300048904 Unclassified 619
478 Ga0496102_0767373 3300048905 Unclassified 887
479 Ga0496102_1068300 3300048905 Bacteria 727
480 Ga0496103_0023018 3300048906 Bacteria 3755
481 Ga0496104_0047881 3300048907 Bacteria 4030
482 Ga0496104_0511238 3300048907 Bacteria 1112
483 Ga0496104_1550098 3300048907 Unclassified 565
484 Ga0496105_0170611 3300048908 Bacteria 1783
485 Ga0496105_0211488 3300048908 Bacteria 1581
486 Ga0496105_0651287 3300048908 Unclassified 813
487 Ga0496106_0002638 3300048909 Bacteria 13335
488 Ga0496107_0048627 3300048910 Bacteria 3056
489 Ga0496107_0593043 3300048910 Bacteria 819
490 Ga0496108_0453670 3300048911 Bacteria 1120
491 Ga0496108_1076739 3300048911 Unclassified 684
492 Ga0496109_0007022 3300048912 Bacteria 9500
493 Ga0496110_0789089 3300048913 Bacteria 854
494 Ga0496111_0211411 3300048914 Unclassified 1441
495 Ga0496112_0034922 3300048915 Bacteria 4893
496 Ga0496112_0035434 3300048915 Bacteria 4862
497 Ga0496112_0259561 3300048915 Bacteria 1687
498 Ga0496112_0846542 3300048915 Bacteria 838
499 Ga0496113_0195347 3300048916 Bacteria 1607
500 Ga0496113_0486083 3300048916 Unclassified 992
501 Ga0496113_1280319 3300048916 Bacteria 571
502 Ga0496115_0018207 3300048918 Bacteria 5388
503 Ga0496115_0085759 3300048918 Bacteria 2569
504 Ga0501080_0168015 3300049742 Bacteria 2024
505 nmdc:mga0k408_86168_c1 3300050493 Bacteria 1843
506 nmdc:mga05p37_356344_c1 3300050507 Bacteria 1721
507 nmdc:mga05p37_455653_c1 3300050507 Bacteria 1479
508 nmdc:mga09592_1160413_c1 3300050508 Bacteria 640
509 nmdc:mga0qj67_839081_c1 3300050509 Bacteria 726
510 nmdc:mga06r32_472417_c1 3300050510 Bacteria 1232
511 nmdc:mga06r32_664444_c1 3300050510 Bacteria 1009
512 nmdc:mga08y16_3320_c1 3300050511 Bacteria 16654
513 nmdc:mga0n895_360307_c1 3300050512 Bacteria 1472
514 nmdc:mga0rr50_1839988_c1 3300050513 Unclassified 509
515 nmdc:mga0rr50_204524_c1 3300050513 Bacteria 1624
516 nmdc:mga0rr50_330307_c1 3300050513 Bacteria 1280
517 nmdc:mga08x19_14882_c1 3300050514 Bacteria 4725
518 nmdc:mga08x19_414956_c1 3300050514 Unclassified 945
519 nmdc:mga08x19_54641_c1 3300050514 Bacteria 2572
520 nmdc:mga0a205_400368_c1 3300050515 Bacteria 1236
521 Ga0495655_0037124 3300053083 Bacteria 1222

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10855952 Ga0075366_108559522 85
2 iso_pu_bacteria 2827628540 2827634422 90
3 3300041443 Ga0451789_0456917 Ga0451789_0456917_31_441 93
4 3300005563 Ga0068855_100175383 Ga0068855_1001753832 94
5 3300025949 Ga0207667_10240347 Ga0207667_102403472 94
6 3300041451 Ga0451791_1817682 Ga0451791_1817682_267_662 94
7 iso_pu_bacteria 2675903058 2676477662 94
8 3300031911 Ga0307412_10237838 Ga0307412_102378382 95
9 3300032005 Ga0307411_10368193 Ga0307411_103681931 95
10 3300050493 nmdc:mga0k408_86168_c1 nmdc:mga0k408_86168_c1_1480_1785 95
11 3300005614 Ga0068856_100193535 Ga0068856_1001935351 96
12 3300005616 Ga0068852_100504726 Ga0068852_1005047262 96
13 3300009098 Ga0105245_10009908 Ga0105245_100099086 96
14 3300009177 Ga0105248_11189404 Ga0105248_111894042 96
15 3300025927 Ga0207687_10012150 Ga0207687_100121503 96
16 3300025941 Ga0207711_11147710 Ga0207711_111477102 96
17 3300005327 Ga0070658_10098792 Ga0070658_100987922 97
18 3300005841 Ga0068863_100001650 Ga0068863_10000165016 97
19 3300009093 Ga0105240_10345316 Ga0105240_103453162 97
20 3300009551 Ga0105238_12576979 Ga0105238_125769792 97
21 3300025913 Ga0207695_10720608 Ga0207695_107206081 97
22 3300025924 Ga0207694_10548544 Ga0207694_105485442 97
23 3300026088 Ga0207641_10009942 Ga0207641_100099425 97
24 3300044694 Ga0466963_0064857 Ga0466963_0064857_368_667 97
25 3300044842 Ga0466957_0139280 Ga0466957_0139280_34_333 97
26 2162886007 SwRhRL2b_contig_291498 SwRhRL2b_0718.00007980 98
27 3300005272 Ga0065703_1019513 Ga0065703_10195132 98
28 3300005290 Ga0065712_10098998 Ga0065712_100989982 98
29 3300005293 Ga0065715_10684539 Ga0065715_106845391 98
30 3300005295 Ga0065707_10012222 Ga0065707_100122222 98
31 3300005295 Ga0065707_10139243 Ga0065707_101392432 98
32 3300005328 Ga0070676_10031165 Ga0070676_100311652 98
33 3300005328 Ga0070676_10184903 Ga0070676_101849032 98
34 3300005328 Ga0070676_10551825 Ga0070676_105518252 98
35 3300005328 Ga0070676_10737358 Ga0070676_107373582 98
36 3300005329 Ga0070683_100602617 Ga0070683_1006026172 98
37 3300005330 Ga0070690_100125050 Ga0070690_1001250502 98
38 3300005331 Ga0070670_100001743 Ga0070670_1000017435 98
39 3300005331 Ga0070670_100199386 Ga0070670_1001993863 98
40 3300005331 Ga0070670_100342826 Ga0070670_1003428262 98
41 3300005331 Ga0070670_100791461 Ga0070670_1007914612 98
42 3300005335 Ga0070666_10017143 Ga0070666_100171436 98
43 3300005335 Ga0070666_10027760 Ga0070666_100277601 98
44 3300005335 Ga0070666_10061740 Ga0070666_100617401 98
45 3300005337 Ga0070682_101171375 Ga0070682_1011713752 98
46 3300005338 Ga0068868_100102598 Ga0068868_1001025982 98
47 3300005338 Ga0068868_100187050 Ga0068868_1001870501 98
48 3300005338 Ga0068868_100734882 Ga0068868_1007348822 98
49 3300005338 Ga0068868_101710032 Ga0068868_1017100322 98
50 3300005338 Ga0068868_101765770 Ga0068868_1017657702 98
51 3300005339 Ga0070660_101193151 Ga0070660_1011931512 98
52 3300005340 Ga0070689_100756485 Ga0070689_1007564852 98
53 3300005343 Ga0070687_100108935 Ga0070687_1001089352 98
54 3300005344 Ga0070661_100020606 Ga0070661_1000206062 98
55 3300005345 Ga0070692_10188767 Ga0070692_101887672 98
56 3300005347 Ga0070668_100024862 Ga0070668_1000248624 98
57 3300005353 Ga0070669_100021430 Ga0070669_1000214301 98
58 3300005353 Ga0070669_101358691 Ga0070669_1013586911 98
59 3300005353 Ga0070669_101749583 Ga0070669_1017495831 98
60 3300005354 Ga0070675_100039523 Ga0070675_1000395235 98
61 3300005354 Ga0070675_100076060 Ga0070675_1000760603 98
62 3300005354 Ga0070675_100088747 Ga0070675_1000887474 98
63 3300005354 Ga0070675_100539773 Ga0070675_1005397732 98
64 3300005354 Ga0070675_100894031 Ga0070675_1008940312 98
65 3300005355 Ga0070671_100012342 Ga0070671_1000123424 98
66 3300005355 Ga0070671_100500119 Ga0070671_1005001192 98
67 3300005355 Ga0070671_100697313 Ga0070671_1006973132 98
68 3300005356 Ga0070674_100004778 Ga0070674_1000047788 98
69 3300005356 Ga0070674_100283825 Ga0070674_1002838252 98
70 3300005356 Ga0070674_101021237 Ga0070674_1010212372 98
71 3300005364 Ga0070673_100059339 Ga0070673_1000593392 98
72 3300005365 Ga0070688_100004677 Ga0070688_1000046772 98
73 3300005367 Ga0070667_100070574 Ga0070667_1000705744 98
74 3300005367 Ga0070667_100282585 Ga0070667_1002825852 98
75 3300005367 Ga0070667_100365884 Ga0070667_1003658842 98
76 3300005367 Ga0070667_101152247 Ga0070667_1011522471 98
77 3300005367 Ga0070667_101628978 Ga0070667_1016289782 98
78 3300005434 Ga0070709_10004736 Ga0070709_100047365 98
79 3300005434 Ga0070709_10727672 Ga0070709_107276722 98
80 3300005434 Ga0070709_10830182 Ga0070709_108301822 98
81 3300005434 Ga0070709_11697228 Ga0070709_116972281 98
82 3300005435 Ga0070714_100098451 Ga0070714_1000984512 98
83 3300005435 Ga0070714_100173623 Ga0070714_1001736232 98
84 3300005435 Ga0070714_100659601 Ga0070714_1006596012 98
85 3300005436 Ga0070713_100125072 Ga0070713_1001250722 98
86 3300005436 Ga0070713_100204425 Ga0070713_1002044252 98
87 3300005436 Ga0070713_100383777 Ga0070713_1003837772 98
88 3300005436 Ga0070713_100438049 Ga0070713_1004380493 98
89 3300005436 Ga0070713_100856721 Ga0070713_1008567212 98
90 3300005437 Ga0070710_10079551 Ga0070710_100795512 98
91 3300005437 Ga0070710_10177518 Ga0070710_101775182 98
92 3300005437 Ga0070710_10213876 Ga0070710_102138762 98
93 3300005437 Ga0070710_10222095 Ga0070710_102220951 98
94 3300005437 Ga0070710_10379977 Ga0070710_103799771 98
95 3300005439 Ga0070711_100010802 Ga0070711_1000108027 98
96 3300005439 Ga0070711_100146807 Ga0070711_1001468073 98
97 3300005439 Ga0070711_100518628 Ga0070711_1005186281 98
98 3300005440 Ga0070705_100004129 Ga0070705_1000041296 98
99 3300005440 Ga0070705_100061196 Ga0070705_1000611963 98
100 3300005440 Ga0070705_100871144 Ga0070705_1008711442 98
101 3300005441 Ga0070700_100494078 Ga0070700_1004940781 98
102 3300005445 Ga0070708_100011864 Ga0070708_1000118646 98
103 3300005445 Ga0070708_100066383 Ga0070708_1000663832 98
104 3300005445 Ga0070708_100133100 Ga0070708_1001331004 98
105 3300005445 Ga0070708_100300069 Ga0070708_1003000692 98
106 3300005445 Ga0070708_100491614 Ga0070708_1004916142 98
107 3300005445 Ga0070708_100965398 Ga0070708_1009653982 98
108 3300005445 Ga0070708_101710966 Ga0070708_1017109662 98
109 3300005445 Ga0070708_102034214 Ga0070708_1020342142 98
110 3300005455 Ga0070663_100058646 Ga0070663_1000586462 98
111 3300005455 Ga0070663_100460392 Ga0070663_1004603922 98
112 3300005456 Ga0070678_100035823 Ga0070678_1000358231 98
113 3300005456 Ga0070678_100038155 Ga0070678_1000381554 98
114 3300005456 Ga0070678_100054297 Ga0070678_1000542974 98
115 3300005456 Ga0070678_100072832 Ga0070678_1000728322 98
116 3300005456 Ga0070678_100274664 Ga0070678_1002746642 98
117 3300005458 Ga0070681_10078561 Ga0070681_100785612 98
118 3300005458 Ga0070681_10157540 Ga0070681_101575402 98
119 3300005458 Ga0070681_10829295 Ga0070681_108292951 98
120 3300005459 Ga0068867_100207638 Ga0068867_1002076382 98
121 3300005459 Ga0068867_102261981 Ga0068867_1022619811 98
122 3300005466 Ga0070685_10020253 Ga0070685_100202532 98
123 3300005467 Ga0070706_100009596 Ga0070706_1000095969 98
124 3300005467 Ga0070706_100095870 Ga0070706_1000958705 98
125 3300005467 Ga0070706_100192123 Ga0070706_1001921232 98
126 3300005468 Ga0070707_100008884 Ga0070707_1000088843 98
127 3300005468 Ga0070707_100103964 Ga0070707_1001039644 98
128 3300005471 Ga0070698_100010100 Ga0070698_10001010011 98
129 3300005471 Ga0070698_100333092 Ga0070698_1003330923 98
130 3300005471 Ga0070698_100381147 Ga0070698_1003811472 98
131 3300005471 Ga0070698_101194977 Ga0070698_1011949772 98
132 3300005518 Ga0070699_100111599 Ga0070699_1001115993 98
133 3300005518 Ga0070699_100155133 Ga0070699_1001551332 98
134 3300005530 Ga0070679_100805444 Ga0070679_1008054442 98
135 3300005535 Ga0070684_101047288 Ga0070684_1010472882 98
136 3300005536 Ga0070697_100221228 Ga0070697_1002212282 98
137 3300005536 Ga0070697_100314442 Ga0070697_1003144422 98
138 3300005536 Ga0070697_100528126 Ga0070697_1005281262 98
139 3300005536 Ga0070697_100623886 Ga0070697_1006238862 98
140 3300005536 Ga0070697_101545418 Ga0070697_1015454182 98
141 3300005536 Ga0070697_101989260 Ga0070697_1019892601 98
142 3300005539 Ga0068853_100516278 Ga0068853_1005162781 98
143 3300005539 Ga0068853_100737205 Ga0068853_1007372052 98
144 3300005543 Ga0070672_100009621 Ga0070672_1000096218 98
145 3300005543 Ga0070672_100346407 Ga0070672_1003464072 98
146 3300005545 Ga0070695_100037157 Ga0070695_1000371573 98
147 3300005545 Ga0070695_100957686 Ga0070695_1009576862 98
148 3300005546 Ga0070696_100030703 Ga0070696_1000307032 98
149 3300005546 Ga0070696_100206138 Ga0070696_1002061382 98
150 3300005546 Ga0070696_100504795 Ga0070696_1005047951 98
151 3300005546 Ga0070696_100711988 Ga0070696_1007119881 98
152 3300005546 Ga0070696_101203560 Ga0070696_1012035601 98
153 3300005547 Ga0070693_100295553 Ga0070693_1002955532 98
154 3300005548 Ga0070665_100236700 Ga0070665_1002367001 98
155 3300005548 Ga0070665_100543627 Ga0070665_1005436272 98
156 3300005548 Ga0070665_101813220 Ga0070665_1018132202 98
157 3300005563 Ga0068855_100302894 Ga0068855_1003028942 98
158 3300005578 Ga0068854_100000001 Ga0068854_100000001390 98
159 3300005578 Ga0068854_100706440 Ga0068854_1007064401 98
160 3300005578 Ga0068854_101570187 Ga0068854_1015701871 98
161 3300005614 Ga0068856_100005936 Ga0068856_1000059368 98
162 3300005615 Ga0070702_100611646 Ga0070702_1006116461 98
163 3300005616 Ga0068852_100588823 Ga0068852_1005888232 98
164 3300005616 Ga0068852_101444794 Ga0068852_1014447942 98
165 3300005718 Ga0068866_10228375 Ga0068866_102283752 98
166 3300005719 Ga0068861_102481785 Ga0068861_1024817852 98
167 3300005841 Ga0068863_100692980 Ga0068863_1006929802 98
168 3300005841 Ga0068863_100869234 Ga0068863_1008692342 98
169 3300005842 Ga0068858_101435399 Ga0068858_1014353992 98
170 3300005985 Ga0081539_10155149 Ga0081539_101551492 98
171 3300006028 Ga0070717_10015357 Ga0070717_100153573 98
172 3300006028 Ga0070717_10121787 Ga0070717_101217872 98
173 3300006028 Ga0070717_11799196 Ga0070717_117991962 98
174 3300006163 Ga0070715_10031606 Ga0070715_100316062 98
175 3300006173 Ga0070716_100047306 Ga0070716_1000473064 98
176 3300006173 Ga0070716_100090831 Ga0070716_1000908312 98
177 3300006173 Ga0070716_100181288 Ga0070716_1001812882 98
178 3300006175 Ga0070712_100010137 Ga0070712_1000101372 98
179 3300006175 Ga0070712_100050131 Ga0070712_1000501312 98
180 3300006175 Ga0070712_100093583 Ga0070712_1000935834 98
181 3300006175 Ga0070712_100113267 Ga0070712_1001132672 98
182 3300006175 Ga0070712_101114429 Ga0070712_1011144291 98
183 3300006178 Ga0075367_10589843 Ga0075367_105898432 98
184 3300006237 Ga0097621_100306792 Ga0097621_1003067923 98
185 3300006237 Ga0097621_101835897 Ga0097621_1018358972 98
186 3300006358 Ga0068871_100033180 Ga0068871_1000331802 98
187 3300006358 Ga0068871_100650977 Ga0068871_1006509772 98
188 3300006358 Ga0068871_101460139 Ga0068871_1014601392 98
189 3300006844 Ga0075428_100517064 Ga0075428_1005170643 98
190 3300006847 Ga0075431_100696407 Ga0075431_1006964072 98
191 3300006847 Ga0075431_101019322 Ga0075431_1010193222 98
192 3300006852 Ga0075433_10866858 Ga0075433_108668582 98
193 3300006871 Ga0075434_100147164 Ga0075434_1001471641 98
194 3300006880 Ga0075429_101422370 Ga0075429_1014223701 98
195 3300006881 Ga0068865_102160632 Ga0068865_1021606322 98
196 3300006914 Ga0075436_100021339 Ga0075436_1000213392 98
197 3300007076 Ga0075435_100376116 Ga0075435_1003761161 98
198 3300007076 Ga0075435_101239903 Ga0075435_1012399032 98
199 3300007265 Ga0099794_10438609 Ga0099794_104386092 98
200 3300009093 Ga0105240_10013461 Ga0105240_100134617 98
201 3300009093 Ga0105240_10361824 Ga0105240_103618242 98
202 3300009093 Ga0105240_11131245 Ga0105240_111312452 98
203 3300009094 Ga0111539_10004383 Ga0111539_1000438315 98
204 3300009098 Ga0105245_10128762 Ga0105245_101287623 98
205 3300009147 Ga0114129_10485488 Ga0114129_104854882 98
206 3300009148 Ga0105243_11559169 Ga0105243_115591692 98
207 3300009174 Ga0105241_10734851 Ga0105241_107348512 98
208 3300009177 Ga0105248_10858980 Ga0105248_108589802 98
209 3300009551 Ga0105238_10388168 Ga0105238_103881683 98
210 3300009553 Ga0105249_12208552 Ga0105249_122085521 98
211 3300010375 Ga0105239_12402153 Ga0105239_124021531 98
212 3300011119 Ga0105246_10583254 Ga0105246_105832542 98
213 3300011119 Ga0105246_11701085 Ga0105246_117010851 98
214 3300012505 Ga0157339_1011526 Ga0157339_10115262 98
215 3300013100 Ga0157373_10702951 Ga0157373_107029511 98
216 3300013100 Ga0157373_10853575 Ga0157373_108535752 98
217 3300013296 Ga0157374_10003649 Ga0157374_1000364911 98
218 3300013296 Ga0157374_10008509 Ga0157374_100085095 98
219 3300013296 Ga0157374_10038850 Ga0157374_100388504 98
220 3300013296 Ga0157374_10054885 Ga0157374_100548853 98
221 3300013296 Ga0157374_10372141 Ga0157374_103721412 98
222 3300013296 Ga0157374_10413842 Ga0157374_104138422 98
223 3300013297 Ga0157378_10037489 Ga0157378_100374893 98
224 3300013297 Ga0157378_10106094 Ga0157378_101060942 98
225 3300013297 Ga0157378_10199194 Ga0157378_101991942 98
226 3300013297 Ga0157378_10219477 Ga0157378_102194772 98
227 3300013297 Ga0157378_10303075 Ga0157378_103030751 98
228 3300013297 Ga0157378_10534524 Ga0157378_105345242 98
229 3300013297 Ga0157378_10760748 Ga0157378_107607481 98
230 3300013297 Ga0157378_11511488 Ga0157378_115114883 98
231 3300013297 Ga0157378_11744346 Ga0157378_117443462 98
232 3300013306 Ga0163162_10025857 Ga0163162_100258572 98
233 3300013306 Ga0163162_10047376 Ga0163162_100473767 98
234 3300013306 Ga0163162_10220004 Ga0163162_102200044 98
235 3300013306 Ga0163162_10457768 Ga0163162_104577682 98
236 3300013306 Ga0163162_11976223 Ga0163162_119762232 98
237 3300013307 Ga0157372_10285973 Ga0157372_102859732 98
238 3300013307 Ga0157372_11808853 Ga0157372_118088531 98
239 3300013308 Ga0157375_10025531 Ga0157375_100255312 98
240 3300013308 Ga0157375_10408046 Ga0157375_104080462 98
241 3300013308 Ga0157375_10595176 Ga0157375_105951761 98
242 3300013308 Ga0157375_13173947 Ga0157375_131739471 98
243 3300013308 Ga0157375_13750981 Ga0157375_137509811 98
244 3300014325 Ga0163163_10121974 Ga0163163_101219743 98
245 3300014325 Ga0163163_11098612 Ga0163163_110986122 98
246 3300014745 Ga0157377_10711411 Ga0157377_107114112 98
247 3300014745 Ga0157377_11711172 Ga0157377_117111721 98
248 3300014969 Ga0157376_10021880 Ga0157376_100218802 98
249 3300014969 Ga0157376_10566368 Ga0157376_105663682 98
250 3300014969 Ga0157376_11254106 Ga0157376_112541061 98
251 3300017792 Ga0163161_10008101 Ga0163161_100081014 98
252 3300020069 Ga0197907_10288390 Ga0197907_102883902 98
253 3300020069 Ga0197907_10850257 Ga0197907_108502571 98
254 3300020070 Ga0206356_11686282 Ga0206356_116862824 98
255 3300020070 Ga0206356_11841930 Ga0206356_118419302 98
256 3300020078 Ga0206352_10241420 Ga0206352_102414201 98
257 3300020081 Ga0206354_10340800 Ga0206354_103408003 98
258 3300020082 Ga0206353_11011302 Ga0206353_110113023 98
259 3300022467 Ga0224712_10036212 Ga0224712_100362123 98
260 3300025315 Ga0207697_10000854 Ga0207697_100008546 98
261 3300025898 Ga0207692_10034745 Ga0207692_100347451 98
262 3300025898 Ga0207692_10471613 Ga0207692_104716132 98
263 3300025901 Ga0207688_10055143 Ga0207688_100551432 98
264 3300025903 Ga0207680_10015145 Ga0207680_100151455 98
265 3300025903 Ga0207680_10040413 Ga0207680_100404133 98
266 3300025903 Ga0207680_10277805 Ga0207680_102778052 98
267 3300025905 Ga0207685_10630247 Ga0207685_106302471 98
268 3300025906 Ga0207699_10009049 Ga0207699_100090495 98
269 3300025906 Ga0207699_10174652 Ga0207699_101746522 98
270 3300025906 Ga0207699_11111605 Ga0207699_111116052 98
271 3300025907 Ga0207645_10009259 Ga0207645_100092594 98
272 3300025907 Ga0207645_10397833 Ga0207645_103978332 98
273 3300025907 Ga0207645_10490314 Ga0207645_104903142 98
274 3300025909 Ga0207705_10003728 Ga0207705_1000372811 98
275 3300025909 Ga0207705_10583935 Ga0207705_105839351 98
276 3300025910 Ga0207684_10000236 Ga0207684_1000023658 98
277 3300025910 Ga0207684_10003260 Ga0207684_100032607 98
278 3300025910 Ga0207684_10004441 Ga0207684_100044411 98
279 3300025910 Ga0207684_10088592 Ga0207684_100885922 98
280 3300025910 Ga0207684_10099417 Ga0207684_100994172 98
281 3300025910 Ga0207684_10110691 Ga0207684_101106912 98
282 3300025910 Ga0207684_10461391 Ga0207684_104613912 98
283 3300025910 Ga0207684_10786058 Ga0207684_107860582 98
284 3300025912 Ga0207707_10001020 Ga0207707_1000102026 98
285 3300025912 Ga0207707_10064367 Ga0207707_100643673 98
286 3300025912 Ga0207707_10200109 Ga0207707_102001092 98
287 3300025913 Ga0207695_10410718 Ga0207695_104107182 98
288 3300025913 Ga0207695_10773759 Ga0207695_107737592 98
289 3300025915 Ga0207693_10005749 Ga0207693_100057498 98
290 3300025915 Ga0207693_10012762 Ga0207693_100127621 98
291 3300025915 Ga0207693_10019355 Ga0207693_100193552 98
292 3300025915 Ga0207693_10030131 Ga0207693_100301312 98
293 3300025915 Ga0207693_10118606 Ga0207693_101186061 98
294 3300025916 Ga0207663_10016144 Ga0207663_100161443 98
295 3300025916 Ga0207663_10024800 Ga0207663_100248002 98
296 3300025916 Ga0207663_10092620 Ga0207663_100926203 98
297 3300025916 Ga0207663_10239624 Ga0207663_102396242 98
298 3300025917 Ga0207660_10003998 Ga0207660_100039989 98
299 3300025919 Ga0207657_10207015 Ga0207657_102070152 98
300 3300025919 Ga0207657_10809110 Ga0207657_108091102 98
301 3300025920 Ga0207649_10673743 Ga0207649_106737432 98
302 3300025921 Ga0207652_10004326 Ga0207652_1000432611 98
303 3300025922 Ga0207646_10120873 Ga0207646_101208734 98
304 3300025922 Ga0207646_10182544 Ga0207646_101825443 98
305 3300025922 Ga0207646_10732427 Ga0207646_107324271 98
306 3300025923 Ga0207681_10027734 Ga0207681_100277341 98
307 3300025923 Ga0207681_10188203 Ga0207681_101882032 98
308 3300025925 Ga0207650_10003332 Ga0207650_1000333210 98
309 3300025925 Ga0207650_10146898 Ga0207650_101468982 98
310 3300025925 Ga0207650_10564475 Ga0207650_105644752 98
311 3300025925 Ga0207650_10818206 Ga0207650_108182061 98
312 3300025926 Ga0207659_10022477 Ga0207659_100224775 98
313 3300025926 Ga0207659_10562425 Ga0207659_105624252 98
314 3300025926 Ga0207659_10620267 Ga0207659_106202672 98
315 3300025926 Ga0207659_11316672 Ga0207659_113166721 98
316 3300025927 Ga0207687_10415139 Ga0207687_104151392 98
317 3300025928 Ga0207700_10022927 Ga0207700_100229274 98
318 3300025928 Ga0207700_10123482 Ga0207700_101234822 98
319 3300025928 Ga0207700_10589759 Ga0207700_105897592 98
320 3300025929 Ga0207664_10080060 Ga0207664_100800605 98
321 3300025931 Ga0207644_10049703 Ga0207644_100497032 98
322 3300025931 Ga0207644_10055802 Ga0207644_100558022 98
323 3300025931 Ga0207644_10603798 Ga0207644_106037981 98
324 3300025931 Ga0207644_10710843 Ga0207644_107108432 98
325 3300025932 Ga0207690_10176375 Ga0207690_101763751 98
326 3300025933 Ga0207706_10116308 Ga0207706_101163083 98
327 3300025933 Ga0207706_11532755 Ga0207706_115327552 98
328 3300025936 Ga0207670_10627840 Ga0207670_106278402 98
329 3300025937 Ga0207669_10404303 Ga0207669_104043032 98
330 3300025937 Ga0207669_11384852 Ga0207669_113848522 98
331 3300025938 Ga0207704_11065146 Ga0207704_110651462 98
332 3300025939 Ga0207665_10064527 Ga0207665_100645272 98
333 3300025940 Ga0207691_10007536 Ga0207691_1000753611 98
334 3300025940 Ga0207691_11735759 Ga0207691_117357591 98
335 3300025941 Ga0207711_10591775 Ga0207711_105917752 98
336 3300025944 Ga0207661_10456818 Ga0207661_104568182 98
337 3300025944 Ga0207661_10572993 Ga0207661_105729932 98
338 3300025949 Ga0207667_10247462 Ga0207667_102474622 98
339 3300025960 Ga0207651_10104849 Ga0207651_101048493 98
340 3300025960 Ga0207651_10506960 Ga0207651_105069601 98
341 3300025960 Ga0207651_11426643 Ga0207651_114266431 98
342 3300025972 Ga0207668_10256977 Ga0207668_102569772 98
343 3300025972 Ga0207668_10277815 Ga0207668_102778152 98
344 3300025981 Ga0207640_10000003 Ga0207640_10000003162 98
345 3300025981 Ga0207640_10415509 Ga0207640_104155092 98
346 3300025986 Ga0207658_10009327 Ga0207658_100093277 98
347 3300025986 Ga0207658_10235579 Ga0207658_102355792 98
348 3300025986 Ga0207658_10284461 Ga0207658_102844611 98
349 3300025986 Ga0207658_10391341 Ga0207658_103913411 98
350 3300025986 Ga0207658_10549787 Ga0207658_105497871 98
351 3300026023 Ga0207677_10044878 Ga0207677_100448784 98
352 3300026023 Ga0207677_11387381 Ga0207677_113873811 98
353 3300026035 Ga0207703_10037885 Ga0207703_100378853 98
354 3300026035 Ga0207703_11578354 Ga0207703_115783542 98
355 3300026041 Ga0207639_10022648 Ga0207639_100226483 98
356 3300026067 Ga0207678_10083083 Ga0207678_100830833 98
357 3300026067 Ga0207678_10121977 Ga0207678_101219774 98
358 3300026078 Ga0207702_10077387 Ga0207702_100773874 98
359 3300026088 Ga0207641_10150179 Ga0207641_101501791 98
360 3300026088 Ga0207641_10589848 Ga0207641_105898482 98
361 3300026088 Ga0207641_12137596 Ga0207641_121375962 98
362 3300026118 Ga0207675_100216823 Ga0207675_1002168231 98
363 3300026118 Ga0207675_100492844 Ga0207675_1004928442 98
364 3300026118 Ga0207675_101904472 Ga0207675_1019044722 98
365 3300026118 Ga0207675_102623842 Ga0207675_1026238421 98
366 3300026121 Ga0207683_10012242 Ga0207683_100122422 98
367 3300026121 Ga0207683_10108782 Ga0207683_101087823 98
368 3300026121 Ga0207683_10325701 Ga0207683_103257012 98
369 3300026121 Ga0207683_10463769 Ga0207683_104637692 98
370 3300026142 Ga0207698_12572878 Ga0207698_125728782 98
371 3300028379 Ga0268266_10038515 Ga0268266_100385153 98
372 3300028379 Ga0268266_10770610 Ga0268266_107706102 98
373 3300028379 Ga0268266_11894612 Ga0268266_118946122 98
374 3300028380 Ga0268265_11571858 Ga0268265_115718582 98
375 3300028380 Ga0268265_11725446 Ga0268265_117254462 98
376 3300028380 Ga0268265_12080723 Ga0268265_120807231 98
377 3300028380 Ga0268265_12620311 Ga0268265_126203112 98
378 3300028381 Ga0268264_10182601 Ga0268264_101826013 98
379 3300031235 Ga0265330_10188941 Ga0265330_101889412 98
380 3300031238 Ga0265332_10006760 Ga0265332_100067601 98
381 3300031238 Ga0265332_10331568 Ga0265332_103315682 98
382 3300031242 Ga0265329_10269673 Ga0265329_102696732 98
383 3300031249 Ga0265339_10001696 Ga0265339_1000169610 98
384 3300031250 Ga0265331_10059800 Ga0265331_100598002 98
385 3300031251 Ga0265327_10006819 Ga0265327_100068193 98
386 3300031507 Ga0307509_10008868 Ga0307509_100088687 98
387 3300031595 Ga0265313_10430084 Ga0265313_104300842 98
388 3300031711 Ga0265314_10020409 Ga0265314_100204092 98
389 3300031712 Ga0265342_10012485 Ga0265342_100124854 98
390 3300031727 Ga0316576_10261265 Ga0316576_102612651 98
391 3300031728 Ga0316578_10299713 Ga0316578_102997132 98
392 3300031730 Ga0307516_10470430 Ga0307516_104704302 98
393 3300031731 Ga0307405_10410701 Ga0307405_104107011 98
394 3300031731 Ga0307405_11038490 Ga0307405_110384902 98
395 3300031852 Ga0307410_11084345 Ga0307410_110843452 98
396 3300031903 Ga0307407_10492982 Ga0307407_104929821 98
397 3300031995 Ga0307409_101161695 Ga0307409_1011616952 98
398 3300032002 Ga0307416_100896928 Ga0307416_1008969282 98
399 3300032004 Ga0307414_10230729 Ga0307414_102307292 98
400 3300032005 Ga0307411_10115466 Ga0307411_101154663 98
401 3300035083 Ga0373926_0055700 Ga0373926_0055700_377_673 98
402 3300035083 Ga0373926_0180875 Ga0373926_0180875_327_623 98
403 3300035089 Ga0373944_0048002 Ga0373944_0048002_38_334 98
404 3300035089 Ga0373944_0278878 Ga0373944_0278878_120_416 98
405 3300035111 Ga0373923_0485581 Ga0373923_0485581_107_403 98
406 3300035113 Ga0373936_0285219 Ga0373936_0285219_418_714 98
407 3300035116 Ga0373945_0013206 Ga0373945_0013206_1591_1887 98
408 3300035116 Ga0373945_0071093 Ga0373945_0071093_338_634 98
409 3300035116 Ga0373945_0302552 Ga0373945_0302552_85_381 98
410 3300035121 Ga0373960_0314457 Ga0373960_0314457_187_531 98
411 3300035170 Ga0373943_0027007 Ga0373943_0027007_1572_1868 98
412 3300035170 Ga0373943_0306730 Ga0373943_0306730_281_577 98
413 3300035170 Ga0373943_0379536 Ga0373943_0379536_24_320 98
414 3300035171 Ga0373946_0066937 Ga0373946_0066937_818_1114 98
415 3300035171 Ga0373946_0109569 Ga0373946_0109569_181_477 98
416 3300035171 Ga0373946_0562527 Ga0373946_0562527_40_336 98
417 3300035171 Ga0373946_0675508 Ga0373946_0675508_179_475 98
418 3300035692 Ga0373935_0017087 Ga0373935_0017087_667_963 98
419 3300035692 Ga0373935_0047170 Ga0373935_0047170_1948_2244 98
420 3300035692 Ga0373935_0060339 Ga0373935_0060339_13_309 98
421 3300035692 Ga0373935_0138338 Ga0373935_0138338_849_1145 98
422 3300035692 Ga0373935_1198635 Ga0373935_1198635_166_462 98
423 3300035695 Ga0373927_0023279 Ga0373927_0023279_1008_1304 98
424 3300035725 Ga0373947_0006717 Ga0373947_0006717_3926_4222 98
425 3300035725 Ga0373947_0047497 Ga0373947_0047497_251_547 98
426 3300035725 Ga0373947_0253550 Ga0373947_0253550_494_790 98
427 3300035725 Ga0373947_0358549 Ga0373947_0358549_244_540 98
428 3300035725 Ga0373947_0729662 Ga0373947_0729662_294_590 98
429 3300036401 Ga0373937_0567388 Ga0373937_0567388_103_399 98
430 3300036401 Ga0373937_0607591 Ga0373937_0607591_278_574 98
431 3300036401 Ga0373937_0770387 Ga0373937_0770387_299_604 98
432 3300036712 Ga0316584_0027028 Ga0316584_0027028_91_387 98
433 3300037068 Ga0373925_0002783 Ga0373925_0002783_4904_5200 98
434 3300037068 Ga0373925_0079995 Ga0373925_0079995_1232_1528 98
435 3300037068 Ga0373925_0423863 Ga0373925_0423863_725_1021 98
436 3300037418 Ga0395900_0004019 Ga0395900_0004019_4331_4627 98
437 3300037466 Ga0395898_1406019 Ga0395898_1406019_152_448 98
438 3300037471 Ga0395905_1157971 Ga0395905_1157971_11_307 98
439 3300038443 Ga0395901_0651595 Ga0395901_0651595_746_1042 98
440 3300039453 Ga0436362_0501654 Ga0436362_0501654_243_539 98
441 3300041509 Ga0451843_0502551 Ga0451843_0502551_389_685 98
442 3300042125 Ga0450923_119487 Ga0450923_119487_315_611 98
443 3300042146 Ga0450907_012539 Ga0450907_012539_575_895 98
444 3300042157 Ga0439458_0201842 Ga0439458_0201842_85_387 98
445 3300042184 Ga0450908_000945 Ga0450908_000945_1579_1899 98
446 3300042439 Ga0439464_0081901 Ga0439464_0081901_519_818 98
447 3300044684 Ga0466966_0048017 Ga0466966_0048017_173_478 98
448 3300044684 Ga0466966_0272853 Ga0466966_0272853_593_910 98
449 3300044693 Ga0466961_0023664 Ga0466961_0023664_3078_3383 98
450 3300044693 Ga0466961_0675380 Ga0466961_0675380_95_391 98
451 3300044706 Ga0466964_0898205 Ga0466964_0898205_198_494 98
452 3300045049 Ga0466959_0173447 Ga0466959_0173447_780_1085 98
453 3300045049 Ga0466959_0592667 Ga0466959_0592667_428_724 98
454 3300045836 Ga0466958_0022098 Ga0466958_0022098_366_671 98
455 3300046472 Ga0495580_0538199 Ga0495580_0538199_401_697 98
456 3300046475 Ga0495639_0120376 Ga0495639_0120376_741_1037 98
457 3300046491 Ga0495584_0263680 Ga0495584_0263680_79_375 98
458 3300046511 Ga0495608_0195373 Ga0495608_0195373_301_597 98
459 3300046517 Ga0495630_0040776 Ga0495630_0040776_2281_2577 98
460 3300046517 Ga0495630_0389378 Ga0495630_0389378_49_345 98
461 3300046520 Ga0495637_0117193 Ga0495637_0117193_48_344 98
462 3300046525 Ga0495663_0334260 Ga0495663_0334260_110_406 98
463 3300046526 Ga0495666_0053589 Ga0495666_0053589_255_551 98
464 3300046528 Ga0495642_0030910 Ga0495642_0030910_1660_1956 98
465 3300046531 Ga0495665_0335630 Ga0495665_0335630_419_715 98
466 3300046533 Ga0495640_0792770 Ga0495640_0792770_219_524 98
467 3300046537 Ga0495598_0004342 Ga0495598_0004342_2689_2985 98
468 3300046559 Ga0495667_0034908 Ga0495667_0034908_2360_2656 98
469 3300046616 Ga0495668_0512914 Ga0495668_0512914_142_438 98
470 3300046664 Ga0495659_0032152 Ga0495659_0032152_30_326 98
471 3300046681 Ga0495647_0152861 Ga0495647_0152861_363_659 98
472 3300046684 Ga0495669_0020388 Ga0495669_0020388_2059_2355 98
473 3300046689 Ga0495613_0596179 Ga0495613_0596179_130_426 98
474 3300046690 Ga0495624_0217010 Ga0495624_0217010_342_638 98
475 3300046691 Ga0495670_0603896 Ga0495670_0603896_83_379 98
476 3300047315 Ga0495581_0151576 Ga0495581_0151576_827_1123 98
477 3300047470 Ga0495681_0203819 Ga0495681_0203819_133_429 98
478 3300047673 Ga0495593_0605656 Ga0495593_0605656_18_314 98
479 3300048904 Ga0496101_0013434 Ga0496101_0013434_1258_1602 98
480 3300048904 Ga0496101_1116857 Ga0496101_1116857_142_438 98
481 3300048905 Ga0496102_0767373 Ga0496102_0767373_295_621 98
482 3300048905 Ga0496102_1068300 Ga0496102_1068300_55_351 98
483 3300048906 Ga0496103_0023018 Ga0496103_0023018_2700_3044 98
484 3300048907 Ga0496104_0047881 Ga0496104_0047881_1568_1912 98
485 3300048907 Ga0496104_0511238 Ga0496104_0511238_58_354 98
486 3300048907 Ga0496104_1550098 Ga0496104_1550098_57_401 98
487 3300048908 Ga0496105_0170611 Ga0496105_0170611_976_1320 98
488 3300048908 Ga0496105_0211488 Ga0496105_0211488_248_544 98
489 3300048908 Ga0496105_0651287 Ga0496105_0651287_380_676 98
490 3300048909 Ga0496106_0002638 Ga0496106_0002638_6028_6372 98
491 3300048910 Ga0496107_0048627 Ga0496107_0048627_547_843 98
492 3300048910 Ga0496107_0593043 Ga0496107_0593043_468_764 98
493 3300048911 Ga0496108_0453670 Ga0496108_0453670_248_544 98
494 3300048911 Ga0496108_1076739 Ga0496108_1076739_309_605 98
495 3300048912 Ga0496109_0007022 Ga0496109_0007022_5966_6262 98
496 3300048913 Ga0496110_0789089 Ga0496110_0789089_409_705 98
497 3300048914 Ga0496111_0211411 Ga0496111_0211411_1045_1341 98
498 3300048915 Ga0496112_0034922 Ga0496112_0034922_892_1188 98
499 3300048915 Ga0496112_0035434 Ga0496112_0035434_139_483 98
500 3300048915 Ga0496112_0259561 Ga0496112_0259561_287_583 98
501 3300048915 Ga0496112_0846542 Ga0496112_0846542_192_488 98
502 3300048916 Ga0496113_0195347 Ga0496113_0195347_698_1042 98
503 3300048916 Ga0496113_0486083 Ga0496113_0486083_266_562 98
504 3300048916 Ga0496113_1280319 Ga0496113_1280319_221_547 98
505 3300048918 Ga0496115_0018207 Ga0496115_0018207_3140_3484 98
506 3300048918 Ga0496115_0085759 Ga0496115_0085759_687_983 98
507 3300049742 Ga0501080_0168015 Ga0501080_0168015_170_466 98
508 3300050507 nmdc:mga05p37_356344_c1 nmdc:mga05p37_356344_c1_354_650 98
509 3300050507 nmdc:mga05p37_455653_c1 nmdc:mga05p37_455653_c1_799_1095 98
510 3300050508 nmdc:mga09592_1160413_c1 nmdc:mga09592_1160413_c1_243_539 98
511 3300050509 nmdc:mga0qj67_839081_c1 nmdc:mga0qj67_839081_c1_418_714 98
512 3300050510 nmdc:mga06r32_472417_c1 nmdc:mga06r32_472417_c1_575_874 98
513 3300050510 nmdc:mga06r32_664444_c1 nmdc:mga06r32_664444_c1_635_931 98
514 3300050511 nmdc:mga08y16_3320_c1 nmdc:mga08y16_3320_c1_12290_12589 98
515 3300050512 nmdc:mga0n895_360307_c1 nmdc:mga0n895_360307_c1_955_1251 98
516 3300050513 nmdc:mga0rr50_1839988_c1 nmdc:mga0rr50_1839988_c1_77_373 98
517 3300050513 nmdc:mga0rr50_204524_c1 nmdc:mga0rr50_204524_c1_454_750 98
518 3300050513 nmdc:mga0rr50_330307_c1 nmdc:mga0rr50_330307_c1_107_403 98
519 3300050514 nmdc:mga08x19_14882_c1 nmdc:mga08x19_14882_c1_3880_4176 98
520 3300050514 nmdc:mga08x19_414956_c1 nmdc:mga08x19_414956_c1_28_324 98
521 3300050514 nmdc:mga08x19_54641_c1 nmdc:mga08x19_54641_c1_34_330 98
522 3300050515 nmdc:mga0a205_400368_c1 nmdc:mga0a205_400368_c1_66_362 98
523 3300053083 Ga0495655_0037124 Ga0495655_0037124_138_434 98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8687 3 95
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8418 3 98
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8368 3 95
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8246 3 95
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8078 3 98
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8687 3 95 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8246 3 95 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8073 1 98 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8007 3 93 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7988 1 98 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9893 1 67
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9885 1 47
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9853 1 84
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9826 1 94
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9788 1 85

Feature Viewer

pLDDT pTM Quality
91.69 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map