F458946
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 523 | 265 | 521 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100098451|Ga0070714_1000984512 |
| Length | 120 |
| Sequence | MTEAATAMPGAAAKGATRVVRVVLPGPLRQLARVSGEVLVDAVPDADGRVTQRALLDAVEARYPMLKGTMRDQDTKIRRAYVRFYGCERDLSPQSADTPLPDAVTDGREPFLVVGALAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 3 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 4 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 173 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 174 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 205 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 206 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 209 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.09 |
| Metatranscriptomes | 1.53 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 93.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_291498 | 2162886007 | Bacteria | 1688 |
| 2 | Ga0065703_1019513 | 3300005272 | Bacteria | 2808 |
| 3 | Ga0065712_10098998 | 3300005290 | Bacteria | 2087 |
| 4 | Ga0065715_10684539 | 3300005293 | Unclassified | 661 |
| 5 | Ga0065707_10012222 | 3300005295 | Bacteria | 1932 |
| 6 | Ga0065707_10139243 | 3300005295 | Bacteria | 1795 |
| 7 | Ga0070658_10098792 | 3300005327 | Bacteria | 2412 |
| 8 | Ga0070676_10031165 | 3300005328 | Bacteria | 3045 |
| 9 | Ga0070676_10184903 | 3300005328 | Bacteria | 1357 |
| 10 | Ga0070676_10551825 | 3300005328 | Unclassified | 825 |
| 11 | Ga0070676_10737358 | 3300005328 | Unclassified | 722 |
| 12 | Ga0070683_100602617 | 3300005329 | Bacteria | 1051 |
| 13 | Ga0070690_100125050 | 3300005330 | Bacteria | 1730 |
| 14 | Ga0070670_100001743 | 3300005331 | Bacteria | 17718 |
| 15 | Ga0070670_100199386 | 3300005331 | Bacteria | 1739 |
| 16 | Ga0070670_100342826 | 3300005331 | Bacteria | 1312 |
| 17 | Ga0070670_100791461 | 3300005331 | Bacteria | 856 |
| 18 | Ga0070666_10017143 | 3300005335 | Bacteria | 4642 |
| 19 | Ga0070666_10027760 | 3300005335 | Bacteria | 3709 |
| 20 | Ga0070666_10061740 | 3300005335 | Bacteria | 2538 |
| 21 | Ga0070682_101171375 | 3300005337 | Bacteria | 647 |
| 22 | Ga0068868_100102598 | 3300005338 | Bacteria | 2316 |
| 23 | Ga0068868_100187050 | 3300005338 | Bacteria | 1721 |
| 24 | Ga0068868_100734882 | 3300005338 | Bacteria | 886 |
| 25 | Ga0068868_101710032 | 3300005338 | Bacteria | 593 |
| 26 | Ga0068868_101765770 | 3300005338 | Unclassified | 584 |
| 27 | Ga0070660_101193151 | 3300005339 | Bacteria | 645 |
| 28 | Ga0070689_100756485 | 3300005340 | Bacteria | 852 |
| 29 | Ga0070687_100108935 | 3300005343 | Bacteria | 1564 |
| 30 | Ga0070661_100020606 | 3300005344 | Bacteria | 4704 |
| 31 | Ga0070692_10188767 | 3300005345 | Bacteria | 1199 |
| 32 | Ga0070668_100024862 | 3300005347 | Bacteria | 4540 |
| 33 | Ga0070669_100021430 | 3300005353 | Bacteria | 4618 |
| 34 | Ga0070669_101358691 | 3300005353 | Bacteria | 616 |
| 35 | Ga0070669_101749583 | 3300005353 | Bacteria | 542 |
| 36 | Ga0070675_100039523 | 3300005354 | Bacteria | 3850 |
| 37 | Ga0070675_100076060 | 3300005354 | Bacteria | 2792 |
| 38 | Ga0070675_100088747 | 3300005354 | Bacteria | 2588 |
| 39 | Ga0070675_100539773 | 3300005354 | Bacteria | 1054 |
| 40 | Ga0070675_100894031 | 3300005354 | Bacteria | 814 |
| 41 | Ga0070671_100012342 | 3300005355 | Bacteria | 6879 |
| 42 | Ga0070671_100500119 | 3300005355 | Unclassified | 1046 |
| 43 | Ga0070671_100697313 | 3300005355 | Unclassified | 880 |
| 44 | Ga0070674_100004778 | 3300005356 | Bacteria | 7762 |
| 45 | Ga0070674_100283825 | 3300005356 | Bacteria | 1313 |
| 46 | Ga0070674_101021237 | 3300005356 | Unclassified | 726 |
| 47 | Ga0070673_100059339 | 3300005364 | Bacteria | 3028 |
| 48 | Ga0070688_100004677 | 3300005365 | Bacteria | 7145 |
| 49 | Ga0070667_100070574 | 3300005367 | Bacteria | 2973 |
| 50 | Ga0070667_100282585 | 3300005367 | Bacteria | 1490 |
| 51 | Ga0070667_100365884 | 3300005367 | Bacteria | 1308 |
| 52 | Ga0070667_101152247 | 3300005367 | Unclassified | 725 |
| 53 | Ga0070667_101628978 | 3300005367 | Unclassified | 607 |
| 54 | Ga0070709_10004736 | 3300005434 | Bacteria | 7347 |
| 55 | Ga0070709_10727672 | 3300005434 | Bacteria | 774 |
| 56 | Ga0070709_10830182 | 3300005434 | Bacteria | 727 |
| 57 | Ga0070709_11697228 | 3300005434 | Bacteria | 516 |
| 58 | Ga0070714_100098451 | 3300005435 | Bacteria | 2573 |
| 59 | Ga0070714_100173623 | 3300005435 | Bacteria | 1957 |
| 60 | Ga0070714_100659601 | 3300005435 | Bacteria | 1007 |
| 61 | Ga0070713_100125072 | 3300005436 | Bacteria | 2260 |
| 62 | Ga0070713_100204425 | 3300005436 | Bacteria | 1785 |
| 63 | Ga0070713_100383777 | 3300005436 | Bacteria | 1309 |
| 64 | Ga0070713_100438049 | 3300005436 | Bacteria | 1226 |
| 65 | Ga0070713_100856721 | 3300005436 | Bacteria | 873 |
| 66 | Ga0070710_10079551 | 3300005437 | Bacteria | 1910 |
| 67 | Ga0070710_10177518 | 3300005437 | Unclassified | 1331 |
| 68 | Ga0070710_10213876 | 3300005437 | Bacteria | 1223 |
| 69 | Ga0070710_10222095 | 3300005437 | Bacteria | 1202 |
| 70 | Ga0070710_10379977 | 3300005437 | Unclassified | 942 |
| 71 | Ga0070711_100010802 | 3300005439 | Bacteria | 5662 |
| 72 | Ga0070711_100146807 | 3300005439 | Bacteria | 1775 |
| 73 | Ga0070711_100518628 | 3300005439 | Bacteria | 985 |
| 74 | Ga0070705_100004129 | 3300005440 | Bacteria | 7095 |
| 75 | Ga0070705_100061196 | 3300005440 | Bacteria | 2237 |
| 76 | Ga0070705_100871144 | 3300005440 | Bacteria | 722 |
| 77 | Ga0070700_100494078 | 3300005441 | Bacteria | 940 |
| 78 | Ga0070708_100011864 | 3300005445 | Bacteria | 7093 |
| 79 | Ga0070708_100066383 | 3300005445 | Bacteria | 3239 |
| 80 | Ga0070708_100133100 | 3300005445 | Bacteria | 2302 |
| 81 | Ga0070708_100300069 | 3300005445 | Unclassified | 1513 |
| 82 | Ga0070708_100491614 | 3300005445 | Bacteria | 1157 |
| 83 | Ga0070708_100965398 | 3300005445 | Unclassified | 799 |
| 84 | Ga0070708_101710966 | 3300005445 | Bacteria | 584 |
| 85 | Ga0070708_102034214 | 3300005445 | Unclassified | 532 |
| 86 | Ga0070663_100058646 | 3300005455 | Bacteria | 2765 |
| 87 | Ga0070663_100460392 | 3300005455 | Bacteria | 1050 |
| 88 | Ga0070678_100035823 | 3300005456 | Bacteria | 3469 |
| 89 | Ga0070678_100038155 | 3300005456 | Bacteria | 3380 |
| 90 | Ga0070678_100054297 | 3300005456 | Bacteria | 2918 |
| 91 | Ga0070678_100072832 | 3300005456 | Bacteria | 2577 |
| 92 | Ga0070678_100274664 | 3300005456 | Bacteria | 1423 |
| 93 | Ga0070681_10078561 | 3300005458 | Bacteria | 3257 |
| 94 | Ga0070681_10157540 | 3300005458 | Bacteria | 2195 |
| 95 | Ga0070681_10829295 | 3300005458 | Bacteria | 842 |
| 96 | Ga0068867_100207638 | 3300005459 | Bacteria | 1571 |
| 97 | Ga0068867_102261981 | 3300005459 | Unclassified | 516 |
| 98 | Ga0070685_10020253 | 3300005466 | Bacteria | 3600 |
| 99 | Ga0070706_100009596 | 3300005467 | Bacteria | 8999 |
| 100 | Ga0070706_100095870 | 3300005467 | Unclassified | 2754 |
| 101 | Ga0070706_100192123 | 3300005467 | Bacteria | 1907 |
| 102 | Ga0070707_100008884 | 3300005468 | Bacteria | 9320 |
| 103 | Ga0070707_100103964 | 3300005468 | Bacteria | 2753 |
| 104 | Ga0070698_100010100 | 3300005471 | Bacteria | 10083 |
| 105 | Ga0070698_100333092 | 3300005471 | Bacteria | 1449 |
| 106 | Ga0070698_100381147 | 3300005471 | Bacteria | 1343 |
| 107 | Ga0070698_101194977 | 3300005471 | Unclassified | 710 |
| 108 | Ga0070699_100111599 | 3300005518 | Bacteria | 2401 |
| 109 | Ga0070699_100155133 | 3300005518 | Bacteria | 2026 |
| 110 | Ga0070679_100805444 | 3300005530 | Bacteria | 883 |
| 111 | Ga0070684_101047288 | 3300005535 | Bacteria | 766 |
| 112 | Ga0070697_100221228 | 3300005536 | Bacteria | 1613 |
| 113 | Ga0070697_100314442 | 3300005536 | Bacteria | 1348 |
| 114 | Ga0070697_100528126 | 3300005536 | Bacteria | 1033 |
| 115 | Ga0070697_100623886 | 3300005536 | Unclassified | 948 |
| 116 | Ga0070697_101545418 | 3300005536 | Unclassified | 593 |
| 117 | Ga0070697_101989260 | 3300005536 | Bacteria | 520 |
| 118 | Ga0068853_100516278 | 3300005539 | Bacteria | 1129 |
| 119 | Ga0068853_100737205 | 3300005539 | Bacteria | 941 |
| 120 | Ga0070672_100009621 | 3300005543 | Bacteria | 6671 |
| 121 | Ga0070672_100346407 | 3300005543 | Bacteria | 1266 |
| 122 | Ga0070695_100037157 | 3300005545 | Bacteria | 3068 |
| 123 | Ga0070695_100957686 | 3300005545 | Bacteria | 694 |
| 124 | Ga0070696_100030703 | 3300005546 | Bacteria | 3681 |
| 125 | Ga0070696_100206138 | 3300005546 | Bacteria | 1470 |
| 126 | Ga0070696_100504795 | 3300005546 | Bacteria | 963 |
| 127 | Ga0070696_100711988 | 3300005546 | Bacteria | 819 |
| 128 | Ga0070696_101203560 | 3300005546 | Bacteria | 640 |
| 129 | Ga0070693_100295553 | 3300005547 | Unclassified | 1090 |
| 130 | Ga0070665_100236700 | 3300005548 | Unclassified | 1826 |
| 131 | Ga0070665_100543627 | 3300005548 | Bacteria | 1174 |
| 132 | Ga0070665_101813220 | 3300005548 | Unclassified | 617 |
| 133 | Ga0068855_100175383 | 3300005563 | Bacteria | 2426 |
| 134 | Ga0068855_100302894 | 3300005563 | Bacteria | 1770 |
| 135 | Ga0068854_100000001 | 3300005578 | Bacteria | 608908 |
| 136 | Ga0068854_100706440 | 3300005578 | Bacteria | 871 |
| 137 | Ga0068854_101570187 | 3300005578 | Bacteria | 599 |
| 138 | Ga0068856_100005936 | 3300005614 | Bacteria | 12021 |
| 139 | Ga0068856_100193535 | 3300005614 | Bacteria | 2047 |
| 140 | Ga0070702_100611646 | 3300005615 | Unclassified | 818 |
| 141 | Ga0068852_100504726 | 3300005616 | Bacteria | 1205 |
| 142 | Ga0068852_100588823 | 3300005616 | Bacteria | 1116 |
| 143 | Ga0068852_101444794 | 3300005616 | Bacteria | 710 |
| 144 | Ga0068866_10228375 | 3300005718 | Bacteria | 1127 |
| 145 | Ga0068861_102481785 | 3300005719 | Bacteria | 522 |
| 146 | Ga0068863_100001650 | 3300005841 | Bacteria | 22068 |
| 147 | Ga0068863_100692980 | 3300005841 | Bacteria | 1012 |
| 148 | Ga0068863_100869234 | 3300005841 | Bacteria | 901 |
| 149 | Ga0068858_101435399 | 3300005842 | Bacteria | 680 |
| 150 | Ga0081539_10155149 | 3300005985 | Bacteria | 1097 |
| 151 | Ga0070717_10015357 | 3300006028 | Bacteria | 5914 |
| 152 | Ga0070717_10121787 | 3300006028 | Bacteria | 2235 |
| 153 | Ga0070717_11799196 | 3300006028 | Bacteria | 554 |
| 154 | Ga0070715_10031606 | 3300006163 | Bacteria | 2150 |
| 155 | Ga0070716_100047306 | 3300006173 | Bacteria | 2426 |
| 156 | Ga0070716_100090831 | 3300006173 | Bacteria | 1848 |
| 157 | Ga0070716_100181288 | 3300006173 | Unclassified | 1383 |
| 158 | Ga0070712_100010137 | 3300006175 | Bacteria | 5940 |
| 159 | Ga0070712_100050131 | 3300006175 | Unclassified | 2902 |
| 160 | Ga0070712_100093583 | 3300006175 | Bacteria | 2206 |
| 161 | Ga0070712_100113267 | 3300006175 | Bacteria | 2028 |
| 162 | Ga0070712_101114429 | 3300006175 | Unclassified | 685 |
| 163 | Ga0075367_10589843 | 3300006178 | Bacteria | 706 |
| 164 | Ga0075366_10855952 | 3300006195 | Bacteria | 566 |
| 165 | Ga0097621_100306792 | 3300006237 | Bacteria | 1403 |
| 166 | Ga0097621_101835897 | 3300006237 | Bacteria | 578 |
| 167 | Ga0068871_100033180 | 3300006358 | Bacteria | 4085 |
| 168 | Ga0068871_100650977 | 3300006358 | Unclassified | 962 |
| 169 | Ga0068871_101460139 | 3300006358 | Bacteria | 646 |
| 170 | Ga0075428_100517064 | 3300006844 | Bacteria | 1277 |
| 171 | Ga0075431_100696407 | 3300006847 | Bacteria | 994 |
| 172 | Ga0075431_101019322 | 3300006847 | Bacteria | 794 |
| 173 | Ga0075433_10866858 | 3300006852 | Unclassified | 788 |
| 174 | Ga0075434_100147164 | 3300006871 | Bacteria | 2376 |
| 175 | Ga0075429_101422370 | 3300006880 | Bacteria | 604 |
| 176 | Ga0068865_102160632 | 3300006881 | Unclassified | 506 |
| 177 | Ga0075436_100021339 | 3300006914 | Bacteria | 4446 |
| 178 | Ga0075435_100376116 | 3300007076 | Bacteria | 1220 |
| 179 | Ga0075435_101239903 | 3300007076 | Bacteria | 653 |
| 180 | Ga0099794_10438609 | 3300007265 | Unclassified | 684 |
| 181 | Ga0105240_10013461 | 3300009093 | Bacteria | 11234 |
| 182 | Ga0105240_10345316 | 3300009093 | Bacteria | 1690 |
| 183 | Ga0105240_10361824 | 3300009093 | Unclassified | 1643 |
| 184 | Ga0105240_11131245 | 3300009093 | Bacteria | 832 |
| 185 | Ga0111539_10004383 | 3300009094 | Bacteria | 18467 |
| 186 | Ga0105245_10009908 | 3300009098 | Bacteria | 8299 |
| 187 | Ga0105245_10128762 | 3300009098 | Bacteria | 2372 |
| 188 | Ga0114129_10485488 | 3300009147 | Bacteria | 1616 |
| 189 | Ga0105243_11559169 | 3300009148 | Bacteria | 686 |
| 190 | Ga0105241_10734851 | 3300009174 | Bacteria | 904 |
| 191 | Ga0105248_10858980 | 3300009177 | Bacteria | 1024 |
| 192 | Ga0105248_11189404 | 3300009177 | Bacteria | 862 |
| 193 | Ga0105238_10388168 | 3300009551 | Unclassified | 1388 |
| 194 | Ga0105238_12576979 | 3300009551 | Bacteria | 545 |
| 195 | Ga0105249_12208552 | 3300009553 | Bacteria | 623 |
| 196 | Ga0105239_12402153 | 3300010375 | Bacteria | 614 |
| 197 | Ga0105246_10583254 | 3300011119 | Unclassified | 963 |
| 198 | Ga0105246_11701085 | 3300011119 | Unclassified | 599 |
| 199 | Ga0157339_1011526 | 3300012505 | Bacteria | 816 |
| 200 | Ga0157373_10702951 | 3300013100 | Bacteria | 741 |
| 201 | Ga0157373_10853575 | 3300013100 | Unclassified | 674 |
| 202 | Ga0157374_10003649 | 3300013296 | Bacteria | 12952 |
| 203 | Ga0157374_10008509 | 3300013296 | Bacteria | 8778 |
| 204 | Ga0157374_10038850 | 3300013296 | Bacteria | 4377 |
| 205 | Ga0157374_10054885 | 3300013296 | Bacteria | 3717 |
| 206 | Ga0157374_10372141 | 3300013296 | Unclassified | 1422 |
| 207 | Ga0157374_10413842 | 3300013296 | Bacteria | 1346 |
| 208 | Ga0157378_10037489 | 3300013297 | Bacteria | 4294 |
| 209 | Ga0157378_10106094 | 3300013297 | Bacteria | 2570 |
| 210 | Ga0157378_10199194 | 3300013297 | Unclassified | 1893 |
| 211 | Ga0157378_10219477 | 3300013297 | Bacteria | 1807 |
| 212 | Ga0157378_10303075 | 3300013297 | Unclassified | 1547 |
| 213 | Ga0157378_10534524 | 3300013297 | Bacteria | 1176 |
| 214 | Ga0157378_10760748 | 3300013297 | Bacteria | 992 |
| 215 | Ga0157378_11511488 | 3300013297 | Bacteria | 716 |
| 216 | Ga0157378_11744346 | 3300013297 | Bacteria | 670 |
| 217 | Ga0163162_10025857 | 3300013306 | Bacteria | 5802 |
| 218 | Ga0163162_10047376 | 3300013306 | Bacteria | 4308 |
| 219 | Ga0163162_10220004 | 3300013306 | Bacteria | 2029 |
| 220 | Ga0163162_10457768 | 3300013306 | Bacteria | 1407 |
| 221 | Ga0163162_11976223 | 3300013306 | Unclassified | 668 |
| 222 | Ga0157372_10285973 | 3300013307 | Bacteria | 1917 |
| 223 | Ga0157372_11808853 | 3300013307 | Unclassified | 702 |
| 224 | Ga0157375_10025531 | 3300013308 | Bacteria | 5492 |
| 225 | Ga0157375_10408046 | 3300013308 | Bacteria | 1525 |
| 226 | Ga0157375_10595176 | 3300013308 | Bacteria | 1265 |
| 227 | Ga0157375_13173947 | 3300013308 | Unclassified | 548 |
| 228 | Ga0157375_13750981 | 3300013308 | Bacteria | 505 |
| 229 | Ga0163163_10121974 | 3300014325 | Bacteria | 2641 |
| 230 | Ga0163163_11098612 | 3300014325 | Bacteria | 858 |
| 231 | Ga0157377_10711411 | 3300014745 | Bacteria | 730 |
| 232 | Ga0157377_11711172 | 3300014745 | Bacteria | 508 |
| 233 | Ga0157376_10021880 | 3300014969 | Bacteria | 4972 |
| 234 | Ga0157376_10566368 | 3300014969 | Bacteria | 1126 |
| 235 | Ga0157376_11254106 | 3300014969 | Unclassified | 770 |
| 236 | Ga0163161_10008101 | 3300017792 | Bacteria | 7267 |
| 237 | Ga0197907_10288390 | 3300020069 | Bacteria | 519 |
| 238 | Ga0197907_10850257 | 3300020069 | Bacteria | 1735 |
| 239 | Ga0206356_11686282 | 3300020070 | Bacteria | 9572 |
| 240 | Ga0206356_11841930 | 3300020070 | Bacteria | 2614 |
| 241 | Ga0206352_10241420 | 3300020078 | Bacteria | 772 |
| 242 | Ga0206354_10340800 | 3300020081 | Bacteria | 3101 |
| 243 | Ga0206353_11011302 | 3300020082 | Bacteria | 5437 |
| 244 | Ga0224712_10036212 | 3300022467 | Bacteria | 1827 |
| 245 | Ga0207697_10000854 | 3300025315 | Bacteria | 17240 |
| 246 | Ga0207692_10034745 | 3300025898 | Bacteria | 2443 |
| 247 | Ga0207692_10471613 | 3300025898 | Unclassified | 793 |
| 248 | Ga0207688_10055143 | 3300025901 | Bacteria | 2230 |
| 249 | Ga0207680_10015145 | 3300025903 | Bacteria | 4017 |
| 250 | Ga0207680_10040413 | 3300025903 | Bacteria | 2714 |
| 251 | Ga0207680_10277805 | 3300025903 | Bacteria | 1163 |
| 252 | Ga0207685_10630247 | 3300025905 | Bacteria | 578 |
| 253 | Ga0207699_10009049 | 3300025906 | Bacteria | 4942 |
| 254 | Ga0207699_10174652 | 3300025906 | Bacteria | 1440 |
| 255 | Ga0207699_11111605 | 3300025906 | Unclassified | 585 |
| 256 | Ga0207645_10009259 | 3300025907 | Bacteria | 6823 |
| 257 | Ga0207645_10397833 | 3300025907 | Bacteria | 926 |
| 258 | Ga0207645_10490314 | 3300025907 | Bacteria | 831 |
| 259 | Ga0207705_10003728 | 3300025909 | Bacteria | 11600 |
| 260 | Ga0207705_10583935 | 3300025909 | Bacteria | 869 |
| 261 | Ga0207684_10000236 | 3300025910 | Bacteria | 83977 |
| 262 | Ga0207684_10003260 | 3300025910 | Bacteria | 15924 |
| 263 | Ga0207684_10004441 | 3300025910 | Bacteria | 13222 |
| 264 | Ga0207684_10088592 | 3300025910 | Unclassified | 2637 |
| 265 | Ga0207684_10099417 | 3300025910 | Bacteria | 2485 |
| 266 | Ga0207684_10110691 | 3300025910 | Bacteria | 2351 |
| 267 | Ga0207684_10461391 | 3300025910 | Bacteria | 1090 |
| 268 | Ga0207684_10786058 | 3300025910 | Bacteria | 805 |
| 269 | Ga0207707_10001020 | 3300025912 | Bacteria | 26893 |
| 270 | Ga0207707_10064367 | 3300025912 | Bacteria | 3192 |
| 271 | Ga0207707_10200109 | 3300025912 | Bacteria | 1742 |
| 272 | Ga0207695_10410718 | 3300025913 | Unclassified | 1238 |
| 273 | Ga0207695_10720608 | 3300025913 | Bacteria | 878 |
| 274 | Ga0207695_10773759 | 3300025913 | Bacteria | 840 |
| 275 | Ga0207693_10005749 | 3300025915 | Bacteria | 10291 |
| 276 | Ga0207693_10012762 | 3300025915 | Bacteria | 6781 |
| 277 | Ga0207693_10019355 | 3300025915 | Bacteria | 5416 |
| 278 | Ga0207693_10030131 | 3300025915 | Bacteria | 4284 |
| 279 | Ga0207693_10118606 | 3300025915 | Bacteria | 2078 |
| 280 | Ga0207663_10016144 | 3300025916 | Bacteria | 4134 |
| 281 | Ga0207663_10024800 | 3300025916 | Bacteria | 3458 |
| 282 | Ga0207663_10092620 | 3300025916 | Bacteria | 2009 |
| 283 | Ga0207663_10239624 | 3300025916 | Bacteria | 1330 |
| 284 | Ga0207660_10003998 | 3300025917 | Bacteria | 9610 |
| 285 | Ga0207657_10207015 | 3300025919 | Bacteria | 1576 |
| 286 | Ga0207657_10809110 | 3300025919 | Bacteria | 724 |
| 287 | Ga0207649_10673743 | 3300025920 | Bacteria | 801 |
| 288 | Ga0207652_10004326 | 3300025921 | Bacteria | 11571 |
| 289 | Ga0207646_10120873 | 3300025922 | Bacteria | 2353 |
| 290 | Ga0207646_10182544 | 3300025922 | Bacteria | 1895 |
| 291 | Ga0207646_10732427 | 3300025922 | Bacteria | 883 |
| 292 | Ga0207681_10027734 | 3300025923 | Bacteria | 3664 |
| 293 | Ga0207681_10188203 | 3300025923 | Bacteria | 1577 |
| 294 | Ga0207694_10548544 | 3300025924 | Bacteria | 970 |
| 295 | Ga0207650_10003332 | 3300025925 | Bacteria | 11053 |
| 296 | Ga0207650_10146898 | 3300025925 | Bacteria | 1858 |
| 297 | Ga0207650_10564475 | 3300025925 | Bacteria | 955 |
| 298 | Ga0207650_10818206 | 3300025925 | Bacteria | 790 |
| 299 | Ga0207659_10022477 | 3300025926 | Bacteria | 4199 |
| 300 | Ga0207659_10562425 | 3300025926 | Unclassified | 970 |
| 301 | Ga0207659_10620267 | 3300025926 | Bacteria | 923 |
| 302 | Ga0207659_11316672 | 3300025926 | Unclassified | 620 |
| 303 | Ga0207687_10012150 | 3300025927 | Bacteria | 5632 |
| 304 | Ga0207687_10415139 | 3300025927 | Bacteria | 1110 |
| 305 | Ga0207700_10022927 | 3300025928 | Bacteria | 4292 |
| 306 | Ga0207700_10123482 | 3300025928 | Bacteria | 2103 |
| 307 | Ga0207700_10589759 | 3300025928 | Unclassified | 989 |
| 308 | Ga0207664_10080060 | 3300025929 | Bacteria | 2654 |
| 309 | Ga0207644_10049703 | 3300025931 | Bacteria | 3003 |
| 310 | Ga0207644_10055802 | 3300025931 | Bacteria | 2848 |
| 311 | Ga0207644_10603798 | 3300025931 | Unclassified | 911 |
| 312 | Ga0207644_10710843 | 3300025931 | Unclassified | 838 |
| 313 | Ga0207690_10176375 | 3300025932 | Bacteria | 1605 |
| 314 | Ga0207706_10116308 | 3300025933 | Bacteria | 2352 |
| 315 | Ga0207706_11532755 | 3300025933 | Unclassified | 542 |
| 316 | Ga0207670_10627840 | 3300025936 | Bacteria | 884 |
| 317 | Ga0207669_10404303 | 3300025937 | Bacteria | 1070 |
| 318 | Ga0207669_11384852 | 3300025937 | Bacteria | 599 |
| 319 | Ga0207704_11065146 | 3300025938 | Bacteria | 686 |
| 320 | Ga0207665_10064527 | 3300025939 | Bacteria | 2489 |
| 321 | Ga0207691_10007536 | 3300025940 | Bacteria | 10474 |
| 322 | Ga0207691_11735759 | 3300025940 | Bacteria | 504 |
| 323 | Ga0207711_10591775 | 3300025941 | Bacteria | 1035 |
| 324 | Ga0207711_11147710 | 3300025941 | Bacteria | 718 |
| 325 | Ga0207661_10456818 | 3300025944 | Bacteria | 1164 |
| 326 | Ga0207661_10572993 | 3300025944 | Bacteria | 1035 |
| 327 | Ga0207667_10240347 | 3300025949 | Bacteria | 1853 |
| 328 | Ga0207667_10247462 | 3300025949 | Bacteria | 1824 |
| 329 | Ga0207651_10104849 | 3300025960 | Bacteria | 2107 |
| 330 | Ga0207651_10506960 | 3300025960 | Unclassified | 1044 |
| 331 | Ga0207651_11426643 | 3300025960 | Unclassified | 623 |
| 332 | Ga0207668_10256977 | 3300025972 | Bacteria | 1422 |
| 333 | Ga0207668_10277815 | 3300025972 | Bacteria | 1372 |
| 334 | Ga0207640_10000003 | 3300025981 | Bacteria | 505282 |
| 335 | Ga0207640_10415509 | 3300025981 | Bacteria | 1099 |
| 336 | Ga0207658_10009327 | 3300025986 | Bacteria | 6655 |
| 337 | Ga0207658_10235579 | 3300025986 | Bacteria | 1548 |
| 338 | Ga0207658_10284461 | 3300025986 | Bacteria | 1419 |
| 339 | Ga0207658_10391341 | 3300025986 | Unclassified | 1220 |
| 340 | Ga0207658_10549787 | 3300025986 | Bacteria | 1033 |
| 341 | Ga0207677_10044878 | 3300026023 | Bacteria | 2948 |
| 342 | Ga0207677_11387381 | 3300026023 | Bacteria | 647 |
| 343 | Ga0207703_10037885 | 3300026035 | Bacteria | 3844 |
| 344 | Ga0207703_11578354 | 3300026035 | Bacteria | 631 |
| 345 | Ga0207639_10022648 | 3300026041 | Bacteria | 4527 |
| 346 | Ga0207678_10083083 | 3300026067 | Bacteria | 2740 |
| 347 | Ga0207678_10121977 | 3300026067 | Bacteria | 2224 |
| 348 | Ga0207702_10077387 | 3300026078 | Bacteria | 2877 |
| 349 | Ga0207641_10009942 | 3300026088 | Bacteria | 7829 |
| 350 | Ga0207641_10150179 | 3300026088 | Bacteria | 2110 |
| 351 | Ga0207641_10589848 | 3300026088 | Bacteria | 1087 |
| 352 | Ga0207641_12137596 | 3300026088 | Unclassified | 560 |
| 353 | Ga0207675_100216823 | 3300026118 | Bacteria | 1843 |
| 354 | Ga0207675_100492844 | 3300026118 | Bacteria | 1219 |
| 355 | Ga0207675_101904472 | 3300026118 | Bacteria | 613 |
| 356 | Ga0207675_102623842 | 3300026118 | Bacteria | 513 |
| 357 | Ga0207683_10012242 | 3300026121 | Bacteria | 7323 |
| 358 | Ga0207683_10108782 | 3300026121 | Bacteria | 2481 |
| 359 | Ga0207683_10325701 | 3300026121 | Bacteria | 1408 |
| 360 | Ga0207683_10463769 | 3300026121 | Bacteria | 1168 |
| 361 | Ga0207698_12572878 | 3300026142 | Bacteria | 519 |
| 362 | Ga0268266_10038515 | 3300028379 | Bacteria | 4069 |
| 363 | Ga0268266_10770610 | 3300028379 | Bacteria | 929 |
| 364 | Ga0268266_11894612 | 3300028379 | Unclassified | 570 |
| 365 | Ga0268265_11571858 | 3300028380 | Bacteria | 662 |
| 366 | Ga0268265_11725446 | 3300028380 | Bacteria | 632 |
| 367 | Ga0268265_12080723 | 3300028380 | Bacteria | 575 |
| 368 | Ga0268265_12620311 | 3300028380 | Unclassified | 510 |
| 369 | Ga0268264_10182601 | 3300028381 | Bacteria | 1906 |
| 370 | Ga0265330_10188941 | 3300031235 | Bacteria | 872 |
| 371 | Ga0265332_10006760 | 3300031238 | Bacteria | 5197 |
| 372 | Ga0265332_10331568 | 3300031238 | Bacteria | 628 |
| 373 | Ga0265329_10269673 | 3300031242 | Bacteria | 570 |
| 374 | Ga0265339_10001696 | 3300031249 | Bacteria | 16254 |
| 375 | Ga0265331_10059800 | 3300031250 | Bacteria | 1801 |
| 376 | Ga0265327_10006819 | 3300031251 | Bacteria | 9002 |
| 377 | Ga0307509_10008868 | 3300031507 | Bacteria | 12688 |
| 378 | Ga0265313_10430084 | 3300031595 | Bacteria | 515 |
| 379 | Ga0265314_10020409 | 3300031711 | Bacteria | 5113 |
| 380 | Ga0265342_10012485 | 3300031712 | Bacteria | 5752 |
| 381 | Ga0316576_10261265 | 3300031727 | Bacteria | 1299 |
| 382 | Ga0316578_10299713 | 3300031728 | Bacteria | 961 |
| 383 | Ga0307516_10470430 | 3300031730 | Bacteria | 912 |
| 384 | Ga0307405_10410701 | 3300031731 | Bacteria | 1062 |
| 385 | Ga0307405_11038490 | 3300031731 | Bacteria | 701 |
| 386 | Ga0307410_11084345 | 3300031852 | Bacteria | 694 |
| 387 | Ga0307407_10492982 | 3300031903 | Bacteria | 897 |
| 388 | Ga0307412_10237838 | 3300031911 | Bacteria | 1407 |
| 389 | Ga0307409_101161695 | 3300031995 | Bacteria | 794 |
| 390 | Ga0307416_100896928 | 3300032002 | Bacteria | 986 |
| 391 | Ga0307414_10230729 | 3300032004 | Bacteria | 1526 |
| 392 | Ga0307411_10115466 | 3300032005 | Bacteria | 1931 |
| 393 | Ga0307411_10368193 | 3300032005 | Bacteria | 1178 |
| 394 | Ga0373926_0055700 | 3300035083 | Bacteria | 1433 |
| 395 | Ga0373926_0180875 | 3300035083 | Unclassified | 808 |
| 396 | Ga0373944_0048002 | 3300035089 | Bacteria | 1339 |
| 397 | Ga0373944_0278878 | 3300035089 | Bacteria | 623 |
| 398 | Ga0373923_0485581 | 3300035111 | Unclassified | 601 |
| 399 | Ga0373936_0285219 | 3300035113 | Bacteria | 743 |
| 400 | Ga0373945_0013206 | 3300035116 | Bacteria | 2753 |
| 401 | Ga0373945_0071093 | 3300035116 | Bacteria | 1317 |
| 402 | Ga0373945_0302552 | 3300035116 | Bacteria | 685 |
| 403 | Ga0373960_0314457 | 3300035121 | Bacteria | 586 |
| 404 | Ga0373943_0027007 | 3300035170 | Bacteria | 2694 |
| 405 | Ga0373943_0306730 | 3300035170 | Unclassified | 902 |
| 406 | Ga0373943_0379536 | 3300035170 | Bacteria | 813 |
| 407 | Ga0373946_0066937 | 3300035171 | Bacteria | 1541 |
| 408 | Ga0373946_0109569 | 3300035171 | Bacteria | 1248 |
| 409 | Ga0373946_0562527 | 3300035171 | Unclassified | 589 |
| 410 | Ga0373946_0675508 | 3300035171 | Unclassified | 539 |
| 411 | Ga0373935_0017087 | 3300035692 | Bacteria | 4395 |
| 412 | Ga0373935_0047170 | 3300035692 | Bacteria | 2723 |
| 413 | Ga0373935_0060339 | 3300035692 | Bacteria | 2426 |
| 414 | Ga0373935_0138338 | 3300035692 | Bacteria | 1643 |
| 415 | Ga0373935_1198635 | 3300035692 | Unclassified | 566 |
| 416 | Ga0373927_0023279 | 3300035695 | Bacteria | 4057 |
| 417 | Ga0373947_0006717 | 3300035725 | Bacteria | 6674 |
| 418 | Ga0373947_0047497 | 3300035725 | Bacteria | 2572 |
| 419 | Ga0373947_0253550 | 3300035725 | Bacteria | 1164 |
| 420 | Ga0373947_0358549 | 3300035725 | Unclassified | 979 |
| 421 | Ga0373947_0729662 | 3300035725 | Unclassified | 676 |
| 422 | Ga0373937_0567388 | 3300036401 | Unclassified | 1078 |
| 423 | Ga0373937_0607591 | 3300036401 | Bacteria | 1038 |
| 424 | Ga0373937_0770387 | 3300036401 | Bacteria | 910 |
| 425 | Ga0316584_0027028 | 3300036712 | Bacteria | 4221 |
| 426 | Ga0373925_0002783 | 3300037068 | Bacteria | 13812 |
| 427 | Ga0373925_0079995 | 3300037068 | Bacteria | 2484 |
| 428 | Ga0373925_0423863 | 3300037068 | Bacteria | 1087 |
| 429 | Ga0395900_0004019 | 3300037418 | Bacteria | 15697 |
| 430 | Ga0395898_1406019 | 3300037466 | Unclassified | 625 |
| 431 | Ga0395905_1157971 | 3300037471 | Bacteria | 677 |
| 432 | Ga0395901_0651595 | 3300038443 | Bacteria | 1056 |
| 433 | Ga0436362_0501654 | 3300039453 | Unclassified | 759 |
| 434 | Ga0451789_0456917 | 3300041443 | Bacteria | 531 |
| 435 | Ga0451791_1817682 | 3300041451 | Bacteria | 973 |
| 436 | Ga0451843_0502551 | 3300041509 | Bacteria | 1017 |
| 437 | Ga0450923_119487 | 3300042125 | Bacteria | 621 |
| 438 | Ga0450907_012539 | 3300042146 | Bacteria | 1412 |
| 439 | Ga0439458_0201842 | 3300042157 | Bacteria | 544 |
| 440 | Ga0450908_000945 | 3300042184 | Bacteria | 5597 |
| 441 | Ga0439464_0081901 | 3300042439 | Bacteria | 965 |
| 442 | Ga0466966_0048017 | 3300044684 | Bacteria | 2720 |
| 443 | Ga0466966_0272853 | 3300044684 | Bacteria | 1018 |
| 444 | Ga0466961_0023664 | 3300044693 | Bacteria | 3952 |
| 445 | Ga0466961_0675380 | 3300044693 | Bacteria | 619 |
| 446 | Ga0466963_0064857 | 3300044694 | Bacteria | 2448 |
| 447 | Ga0466964_0898205 | 3300044706 | Unclassified | 507 |
| 448 | Ga0466957_0139280 | 3300044842 | Bacteria | 1562 |
| 449 | Ga0466959_0173447 | 3300045049 | Bacteria | 1511 |
| 450 | Ga0466959_0592667 | 3300045049 | Bacteria | 746 |
| 451 | Ga0466958_0022098 | 3300045836 | Bacteria | 3723 |
| 452 | Ga0495580_0538199 | 3300046472 | Bacteria | 777 |
| 453 | Ga0495639_0120376 | 3300046475 | Bacteria | 1252 |
| 454 | Ga0495584_0263680 | 3300046491 | Unclassified | 876 |
| 455 | Ga0495608_0195373 | 3300046511 | Bacteria | 1276 |
| 456 | Ga0495630_0040776 | 3300046517 | Bacteria | 3469 |
| 457 | Ga0495630_0389378 | 3300046517 | Bacteria | 1068 |
| 458 | Ga0495637_0117193 | 3300046520 | Bacteria | 1028 |
| 459 | Ga0495663_0334260 | 3300046525 | Unclassified | 550 |
| 460 | Ga0495666_0053589 | 3300046526 | Bacteria | 1935 |
| 461 | Ga0495642_0030910 | 3300046528 | Bacteria | 2145 |
| 462 | Ga0495665_0335630 | 3300046531 | Bacteria | 771 |
| 463 | Ga0495640_0792770 | 3300046533 | Unclassified | 565 |
| 464 | Ga0495598_0004342 | 3300046537 | Bacteria | 3063 |
| 465 | Ga0495667_0034908 | 3300046559 | Bacteria | 3363 |
| 466 | Ga0495668_0512914 | 3300046616 | Unclassified | 661 |
| 467 | Ga0495659_0032152 | 3300046664 | Bacteria | 1835 |
| 468 | Ga0495647_0152861 | 3300046681 | Bacteria | 990 |
| 469 | Ga0495669_0020388 | 3300046684 | Bacteria | 2868 |
| 470 | Ga0495613_0596179 | 3300046689 | Unclassified | 736 |
| 471 | Ga0495624_0217010 | 3300046690 | Bacteria | 1160 |
| 472 | Ga0495670_0603896 | 3300046691 | Unclassified | 598 |
| 473 | Ga0495581_0151576 | 3300047315 | Bacteria | 1354 |
| 474 | Ga0495681_0203819 | 3300047470 | Bacteria | 801 |
| 475 | Ga0495593_0605656 | 3300047673 | Bacteria | 550 |
| 476 | Ga0496101_0013434 | 3300048904 | Bacteria | 5486 |
| 477 | Ga0496101_1116857 | 3300048904 | Unclassified | 619 |
| 478 | Ga0496102_0767373 | 3300048905 | Unclassified | 887 |
| 479 | Ga0496102_1068300 | 3300048905 | Bacteria | 727 |
| 480 | Ga0496103_0023018 | 3300048906 | Bacteria | 3755 |
| 481 | Ga0496104_0047881 | 3300048907 | Bacteria | 4030 |
| 482 | Ga0496104_0511238 | 3300048907 | Bacteria | 1112 |
| 483 | Ga0496104_1550098 | 3300048907 | Unclassified | 565 |
| 484 | Ga0496105_0170611 | 3300048908 | Bacteria | 1783 |
| 485 | Ga0496105_0211488 | 3300048908 | Bacteria | 1581 |
| 486 | Ga0496105_0651287 | 3300048908 | Unclassified | 813 |
| 487 | Ga0496106_0002638 | 3300048909 | Bacteria | 13335 |
| 488 | Ga0496107_0048627 | 3300048910 | Bacteria | 3056 |
| 489 | Ga0496107_0593043 | 3300048910 | Bacteria | 819 |
| 490 | Ga0496108_0453670 | 3300048911 | Bacteria | 1120 |
| 491 | Ga0496108_1076739 | 3300048911 | Unclassified | 684 |
| 492 | Ga0496109_0007022 | 3300048912 | Bacteria | 9500 |
| 493 | Ga0496110_0789089 | 3300048913 | Bacteria | 854 |
| 494 | Ga0496111_0211411 | 3300048914 | Unclassified | 1441 |
| 495 | Ga0496112_0034922 | 3300048915 | Bacteria | 4893 |
| 496 | Ga0496112_0035434 | 3300048915 | Bacteria | 4862 |
| 497 | Ga0496112_0259561 | 3300048915 | Bacteria | 1687 |
| 498 | Ga0496112_0846542 | 3300048915 | Bacteria | 838 |
| 499 | Ga0496113_0195347 | 3300048916 | Bacteria | 1607 |
| 500 | Ga0496113_0486083 | 3300048916 | Unclassified | 992 |
| 501 | Ga0496113_1280319 | 3300048916 | Bacteria | 571 |
| 502 | Ga0496115_0018207 | 3300048918 | Bacteria | 5388 |
| 503 | Ga0496115_0085759 | 3300048918 | Bacteria | 2569 |
| 504 | Ga0501080_0168015 | 3300049742 | Bacteria | 2024 |
| 505 | nmdc:mga0k408_86168_c1 | 3300050493 | Bacteria | 1843 |
| 506 | nmdc:mga05p37_356344_c1 | 3300050507 | Bacteria | 1721 |
| 507 | nmdc:mga05p37_455653_c1 | 3300050507 | Bacteria | 1479 |
| 508 | nmdc:mga09592_1160413_c1 | 3300050508 | Bacteria | 640 |
| 509 | nmdc:mga0qj67_839081_c1 | 3300050509 | Bacteria | 726 |
| 510 | nmdc:mga06r32_472417_c1 | 3300050510 | Bacteria | 1232 |
| 511 | nmdc:mga06r32_664444_c1 | 3300050510 | Bacteria | 1009 |
| 512 | nmdc:mga08y16_3320_c1 | 3300050511 | Bacteria | 16654 |
| 513 | nmdc:mga0n895_360307_c1 | 3300050512 | Bacteria | 1472 |
| 514 | nmdc:mga0rr50_1839988_c1 | 3300050513 | Unclassified | 509 |
| 515 | nmdc:mga0rr50_204524_c1 | 3300050513 | Bacteria | 1624 |
| 516 | nmdc:mga0rr50_330307_c1 | 3300050513 | Bacteria | 1280 |
| 517 | nmdc:mga08x19_14882_c1 | 3300050514 | Bacteria | 4725 |
| 518 | nmdc:mga08x19_414956_c1 | 3300050514 | Unclassified | 945 |
| 519 | nmdc:mga08x19_54641_c1 | 3300050514 | Bacteria | 2572 |
| 520 | nmdc:mga0a205_400368_c1 | 3300050515 | Bacteria | 1236 |
| 521 | Ga0495655_0037124 | 3300053083 | Bacteria | 1222 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10855952 | Ga0075366_108559522 | 85 |
| 2 | iso_pu_bacteria | 2827628540 | 2827634422 | 90 |
| 3 | 3300041443 | Ga0451789_0456917 | Ga0451789_0456917_31_441 | 93 |
| 4 | 3300005563 | Ga0068855_100175383 | Ga0068855_1001753832 | 94 |
| 5 | 3300025949 | Ga0207667_10240347 | Ga0207667_102403472 | 94 |
| 6 | 3300041451 | Ga0451791_1817682 | Ga0451791_1817682_267_662 | 94 |
| 7 | iso_pu_bacteria | 2675903058 | 2676477662 | 94 |
| 8 | 3300031911 | Ga0307412_10237838 | Ga0307412_102378382 | 95 |
| 9 | 3300032005 | Ga0307411_10368193 | Ga0307411_103681931 | 95 |
| 10 | 3300050493 | nmdc:mga0k408_86168_c1 | nmdc:mga0k408_86168_c1_1480_1785 | 95 |
| 11 | 3300005614 | Ga0068856_100193535 | Ga0068856_1001935351 | 96 |
| 12 | 3300005616 | Ga0068852_100504726 | Ga0068852_1005047262 | 96 |
| 13 | 3300009098 | Ga0105245_10009908 | Ga0105245_100099086 | 96 |
| 14 | 3300009177 | Ga0105248_11189404 | Ga0105248_111894042 | 96 |
| 15 | 3300025927 | Ga0207687_10012150 | Ga0207687_100121503 | 96 |
| 16 | 3300025941 | Ga0207711_11147710 | Ga0207711_111477102 | 96 |
| 17 | 3300005327 | Ga0070658_10098792 | Ga0070658_100987922 | 97 |
| 18 | 3300005841 | Ga0068863_100001650 | Ga0068863_10000165016 | 97 |
| 19 | 3300009093 | Ga0105240_10345316 | Ga0105240_103453162 | 97 |
| 20 | 3300009551 | Ga0105238_12576979 | Ga0105238_125769792 | 97 |
| 21 | 3300025913 | Ga0207695_10720608 | Ga0207695_107206081 | 97 |
| 22 | 3300025924 | Ga0207694_10548544 | Ga0207694_105485442 | 97 |
| 23 | 3300026088 | Ga0207641_10009942 | Ga0207641_100099425 | 97 |
| 24 | 3300044694 | Ga0466963_0064857 | Ga0466963_0064857_368_667 | 97 |
| 25 | 3300044842 | Ga0466957_0139280 | Ga0466957_0139280_34_333 | 97 |
| 26 | 2162886007 | SwRhRL2b_contig_291498 | SwRhRL2b_0718.00007980 | 98 |
| 27 | 3300005272 | Ga0065703_1019513 | Ga0065703_10195132 | 98 |
| 28 | 3300005290 | Ga0065712_10098998 | Ga0065712_100989982 | 98 |
| 29 | 3300005293 | Ga0065715_10684539 | Ga0065715_106845391 | 98 |
| 30 | 3300005295 | Ga0065707_10012222 | Ga0065707_100122222 | 98 |
| 31 | 3300005295 | Ga0065707_10139243 | Ga0065707_101392432 | 98 |
| 32 | 3300005328 | Ga0070676_10031165 | Ga0070676_100311652 | 98 |
| 33 | 3300005328 | Ga0070676_10184903 | Ga0070676_101849032 | 98 |
| 34 | 3300005328 | Ga0070676_10551825 | Ga0070676_105518252 | 98 |
| 35 | 3300005328 | Ga0070676_10737358 | Ga0070676_107373582 | 98 |
| 36 | 3300005329 | Ga0070683_100602617 | Ga0070683_1006026172 | 98 |
| 37 | 3300005330 | Ga0070690_100125050 | Ga0070690_1001250502 | 98 |
| 38 | 3300005331 | Ga0070670_100001743 | Ga0070670_1000017435 | 98 |
| 39 | 3300005331 | Ga0070670_100199386 | Ga0070670_1001993863 | 98 |
| 40 | 3300005331 | Ga0070670_100342826 | Ga0070670_1003428262 | 98 |
| 41 | 3300005331 | Ga0070670_100791461 | Ga0070670_1007914612 | 98 |
| 42 | 3300005335 | Ga0070666_10017143 | Ga0070666_100171436 | 98 |
| 43 | 3300005335 | Ga0070666_10027760 | Ga0070666_100277601 | 98 |
| 44 | 3300005335 | Ga0070666_10061740 | Ga0070666_100617401 | 98 |
| 45 | 3300005337 | Ga0070682_101171375 | Ga0070682_1011713752 | 98 |
| 46 | 3300005338 | Ga0068868_100102598 | Ga0068868_1001025982 | 98 |
| 47 | 3300005338 | Ga0068868_100187050 | Ga0068868_1001870501 | 98 |
| 48 | 3300005338 | Ga0068868_100734882 | Ga0068868_1007348822 | 98 |
| 49 | 3300005338 | Ga0068868_101710032 | Ga0068868_1017100322 | 98 |
| 50 | 3300005338 | Ga0068868_101765770 | Ga0068868_1017657702 | 98 |
| 51 | 3300005339 | Ga0070660_101193151 | Ga0070660_1011931512 | 98 |
| 52 | 3300005340 | Ga0070689_100756485 | Ga0070689_1007564852 | 98 |
| 53 | 3300005343 | Ga0070687_100108935 | Ga0070687_1001089352 | 98 |
| 54 | 3300005344 | Ga0070661_100020606 | Ga0070661_1000206062 | 98 |
| 55 | 3300005345 | Ga0070692_10188767 | Ga0070692_101887672 | 98 |
| 56 | 3300005347 | Ga0070668_100024862 | Ga0070668_1000248624 | 98 |
| 57 | 3300005353 | Ga0070669_100021430 | Ga0070669_1000214301 | 98 |
| 58 | 3300005353 | Ga0070669_101358691 | Ga0070669_1013586911 | 98 |
| 59 | 3300005353 | Ga0070669_101749583 | Ga0070669_1017495831 | 98 |
| 60 | 3300005354 | Ga0070675_100039523 | Ga0070675_1000395235 | 98 |
| 61 | 3300005354 | Ga0070675_100076060 | Ga0070675_1000760603 | 98 |
| 62 | 3300005354 | Ga0070675_100088747 | Ga0070675_1000887474 | 98 |
| 63 | 3300005354 | Ga0070675_100539773 | Ga0070675_1005397732 | 98 |
| 64 | 3300005354 | Ga0070675_100894031 | Ga0070675_1008940312 | 98 |
| 65 | 3300005355 | Ga0070671_100012342 | Ga0070671_1000123424 | 98 |
| 66 | 3300005355 | Ga0070671_100500119 | Ga0070671_1005001192 | 98 |
| 67 | 3300005355 | Ga0070671_100697313 | Ga0070671_1006973132 | 98 |
| 68 | 3300005356 | Ga0070674_100004778 | Ga0070674_1000047788 | 98 |
| 69 | 3300005356 | Ga0070674_100283825 | Ga0070674_1002838252 | 98 |
| 70 | 3300005356 | Ga0070674_101021237 | Ga0070674_1010212372 | 98 |
| 71 | 3300005364 | Ga0070673_100059339 | Ga0070673_1000593392 | 98 |
| 72 | 3300005365 | Ga0070688_100004677 | Ga0070688_1000046772 | 98 |
| 73 | 3300005367 | Ga0070667_100070574 | Ga0070667_1000705744 | 98 |
| 74 | 3300005367 | Ga0070667_100282585 | Ga0070667_1002825852 | 98 |
| 75 | 3300005367 | Ga0070667_100365884 | Ga0070667_1003658842 | 98 |
| 76 | 3300005367 | Ga0070667_101152247 | Ga0070667_1011522471 | 98 |
| 77 | 3300005367 | Ga0070667_101628978 | Ga0070667_1016289782 | 98 |
| 78 | 3300005434 | Ga0070709_10004736 | Ga0070709_100047365 | 98 |
| 79 | 3300005434 | Ga0070709_10727672 | Ga0070709_107276722 | 98 |
| 80 | 3300005434 | Ga0070709_10830182 | Ga0070709_108301822 | 98 |
| 81 | 3300005434 | Ga0070709_11697228 | Ga0070709_116972281 | 98 |
| 82 | 3300005435 | Ga0070714_100098451 | Ga0070714_1000984512 | 98 |
| 83 | 3300005435 | Ga0070714_100173623 | Ga0070714_1001736232 | 98 |
| 84 | 3300005435 | Ga0070714_100659601 | Ga0070714_1006596012 | 98 |
| 85 | 3300005436 | Ga0070713_100125072 | Ga0070713_1001250722 | 98 |
| 86 | 3300005436 | Ga0070713_100204425 | Ga0070713_1002044252 | 98 |
| 87 | 3300005436 | Ga0070713_100383777 | Ga0070713_1003837772 | 98 |
| 88 | 3300005436 | Ga0070713_100438049 | Ga0070713_1004380493 | 98 |
| 89 | 3300005436 | Ga0070713_100856721 | Ga0070713_1008567212 | 98 |
| 90 | 3300005437 | Ga0070710_10079551 | Ga0070710_100795512 | 98 |
| 91 | 3300005437 | Ga0070710_10177518 | Ga0070710_101775182 | 98 |
| 92 | 3300005437 | Ga0070710_10213876 | Ga0070710_102138762 | 98 |
| 93 | 3300005437 | Ga0070710_10222095 | Ga0070710_102220951 | 98 |
| 94 | 3300005437 | Ga0070710_10379977 | Ga0070710_103799771 | 98 |
| 95 | 3300005439 | Ga0070711_100010802 | Ga0070711_1000108027 | 98 |
| 96 | 3300005439 | Ga0070711_100146807 | Ga0070711_1001468073 | 98 |
| 97 | 3300005439 | Ga0070711_100518628 | Ga0070711_1005186281 | 98 |
| 98 | 3300005440 | Ga0070705_100004129 | Ga0070705_1000041296 | 98 |
| 99 | 3300005440 | Ga0070705_100061196 | Ga0070705_1000611963 | 98 |
| 100 | 3300005440 | Ga0070705_100871144 | Ga0070705_1008711442 | 98 |
| 101 | 3300005441 | Ga0070700_100494078 | Ga0070700_1004940781 | 98 |
| 102 | 3300005445 | Ga0070708_100011864 | Ga0070708_1000118646 | 98 |
| 103 | 3300005445 | Ga0070708_100066383 | Ga0070708_1000663832 | 98 |
| 104 | 3300005445 | Ga0070708_100133100 | Ga0070708_1001331004 | 98 |
| 105 | 3300005445 | Ga0070708_100300069 | Ga0070708_1003000692 | 98 |
| 106 | 3300005445 | Ga0070708_100491614 | Ga0070708_1004916142 | 98 |
| 107 | 3300005445 | Ga0070708_100965398 | Ga0070708_1009653982 | 98 |
| 108 | 3300005445 | Ga0070708_101710966 | Ga0070708_1017109662 | 98 |
| 109 | 3300005445 | Ga0070708_102034214 | Ga0070708_1020342142 | 98 |
| 110 | 3300005455 | Ga0070663_100058646 | Ga0070663_1000586462 | 98 |
| 111 | 3300005455 | Ga0070663_100460392 | Ga0070663_1004603922 | 98 |
| 112 | 3300005456 | Ga0070678_100035823 | Ga0070678_1000358231 | 98 |
| 113 | 3300005456 | Ga0070678_100038155 | Ga0070678_1000381554 | 98 |
| 114 | 3300005456 | Ga0070678_100054297 | Ga0070678_1000542974 | 98 |
| 115 | 3300005456 | Ga0070678_100072832 | Ga0070678_1000728322 | 98 |
| 116 | 3300005456 | Ga0070678_100274664 | Ga0070678_1002746642 | 98 |
| 117 | 3300005458 | Ga0070681_10078561 | Ga0070681_100785612 | 98 |
| 118 | 3300005458 | Ga0070681_10157540 | Ga0070681_101575402 | 98 |
| 119 | 3300005458 | Ga0070681_10829295 | Ga0070681_108292951 | 98 |
| 120 | 3300005459 | Ga0068867_100207638 | Ga0068867_1002076382 | 98 |
| 121 | 3300005459 | Ga0068867_102261981 | Ga0068867_1022619811 | 98 |
| 122 | 3300005466 | Ga0070685_10020253 | Ga0070685_100202532 | 98 |
| 123 | 3300005467 | Ga0070706_100009596 | Ga0070706_1000095969 | 98 |
| 124 | 3300005467 | Ga0070706_100095870 | Ga0070706_1000958705 | 98 |
| 125 | 3300005467 | Ga0070706_100192123 | Ga0070706_1001921232 | 98 |
| 126 | 3300005468 | Ga0070707_100008884 | Ga0070707_1000088843 | 98 |
| 127 | 3300005468 | Ga0070707_100103964 | Ga0070707_1001039644 | 98 |
| 128 | 3300005471 | Ga0070698_100010100 | Ga0070698_10001010011 | 98 |
| 129 | 3300005471 | Ga0070698_100333092 | Ga0070698_1003330923 | 98 |
| 130 | 3300005471 | Ga0070698_100381147 | Ga0070698_1003811472 | 98 |
| 131 | 3300005471 | Ga0070698_101194977 | Ga0070698_1011949772 | 98 |
| 132 | 3300005518 | Ga0070699_100111599 | Ga0070699_1001115993 | 98 |
| 133 | 3300005518 | Ga0070699_100155133 | Ga0070699_1001551332 | 98 |
| 134 | 3300005530 | Ga0070679_100805444 | Ga0070679_1008054442 | 98 |
| 135 | 3300005535 | Ga0070684_101047288 | Ga0070684_1010472882 | 98 |
| 136 | 3300005536 | Ga0070697_100221228 | Ga0070697_1002212282 | 98 |
| 137 | 3300005536 | Ga0070697_100314442 | Ga0070697_1003144422 | 98 |
| 138 | 3300005536 | Ga0070697_100528126 | Ga0070697_1005281262 | 98 |
| 139 | 3300005536 | Ga0070697_100623886 | Ga0070697_1006238862 | 98 |
| 140 | 3300005536 | Ga0070697_101545418 | Ga0070697_1015454182 | 98 |
| 141 | 3300005536 | Ga0070697_101989260 | Ga0070697_1019892601 | 98 |
| 142 | 3300005539 | Ga0068853_100516278 | Ga0068853_1005162781 | 98 |
| 143 | 3300005539 | Ga0068853_100737205 | Ga0068853_1007372052 | 98 |
| 144 | 3300005543 | Ga0070672_100009621 | Ga0070672_1000096218 | 98 |
| 145 | 3300005543 | Ga0070672_100346407 | Ga0070672_1003464072 | 98 |
| 146 | 3300005545 | Ga0070695_100037157 | Ga0070695_1000371573 | 98 |
| 147 | 3300005545 | Ga0070695_100957686 | Ga0070695_1009576862 | 98 |
| 148 | 3300005546 | Ga0070696_100030703 | Ga0070696_1000307032 | 98 |
| 149 | 3300005546 | Ga0070696_100206138 | Ga0070696_1002061382 | 98 |
| 150 | 3300005546 | Ga0070696_100504795 | Ga0070696_1005047951 | 98 |
| 151 | 3300005546 | Ga0070696_100711988 | Ga0070696_1007119881 | 98 |
| 152 | 3300005546 | Ga0070696_101203560 | Ga0070696_1012035601 | 98 |
| 153 | 3300005547 | Ga0070693_100295553 | Ga0070693_1002955532 | 98 |
| 154 | 3300005548 | Ga0070665_100236700 | Ga0070665_1002367001 | 98 |
| 155 | 3300005548 | Ga0070665_100543627 | Ga0070665_1005436272 | 98 |
| 156 | 3300005548 | Ga0070665_101813220 | Ga0070665_1018132202 | 98 |
| 157 | 3300005563 | Ga0068855_100302894 | Ga0068855_1003028942 | 98 |
| 158 | 3300005578 | Ga0068854_100000001 | Ga0068854_100000001390 | 98 |
| 159 | 3300005578 | Ga0068854_100706440 | Ga0068854_1007064401 | 98 |
| 160 | 3300005578 | Ga0068854_101570187 | Ga0068854_1015701871 | 98 |
| 161 | 3300005614 | Ga0068856_100005936 | Ga0068856_1000059368 | 98 |
| 162 | 3300005615 | Ga0070702_100611646 | Ga0070702_1006116461 | 98 |
| 163 | 3300005616 | Ga0068852_100588823 | Ga0068852_1005888232 | 98 |
| 164 | 3300005616 | Ga0068852_101444794 | Ga0068852_1014447942 | 98 |
| 165 | 3300005718 | Ga0068866_10228375 | Ga0068866_102283752 | 98 |
| 166 | 3300005719 | Ga0068861_102481785 | Ga0068861_1024817852 | 98 |
| 167 | 3300005841 | Ga0068863_100692980 | Ga0068863_1006929802 | 98 |
| 168 | 3300005841 | Ga0068863_100869234 | Ga0068863_1008692342 | 98 |
| 169 | 3300005842 | Ga0068858_101435399 | Ga0068858_1014353992 | 98 |
| 170 | 3300005985 | Ga0081539_10155149 | Ga0081539_101551492 | 98 |
| 171 | 3300006028 | Ga0070717_10015357 | Ga0070717_100153573 | 98 |
| 172 | 3300006028 | Ga0070717_10121787 | Ga0070717_101217872 | 98 |
| 173 | 3300006028 | Ga0070717_11799196 | Ga0070717_117991962 | 98 |
| 174 | 3300006163 | Ga0070715_10031606 | Ga0070715_100316062 | 98 |
| 175 | 3300006173 | Ga0070716_100047306 | Ga0070716_1000473064 | 98 |
| 176 | 3300006173 | Ga0070716_100090831 | Ga0070716_1000908312 | 98 |
| 177 | 3300006173 | Ga0070716_100181288 | Ga0070716_1001812882 | 98 |
| 178 | 3300006175 | Ga0070712_100010137 | Ga0070712_1000101372 | 98 |
| 179 | 3300006175 | Ga0070712_100050131 | Ga0070712_1000501312 | 98 |
| 180 | 3300006175 | Ga0070712_100093583 | Ga0070712_1000935834 | 98 |
| 181 | 3300006175 | Ga0070712_100113267 | Ga0070712_1001132672 | 98 |
| 182 | 3300006175 | Ga0070712_101114429 | Ga0070712_1011144291 | 98 |
| 183 | 3300006178 | Ga0075367_10589843 | Ga0075367_105898432 | 98 |
| 184 | 3300006237 | Ga0097621_100306792 | Ga0097621_1003067923 | 98 |
| 185 | 3300006237 | Ga0097621_101835897 | Ga0097621_1018358972 | 98 |
| 186 | 3300006358 | Ga0068871_100033180 | Ga0068871_1000331802 | 98 |
| 187 | 3300006358 | Ga0068871_100650977 | Ga0068871_1006509772 | 98 |
| 188 | 3300006358 | Ga0068871_101460139 | Ga0068871_1014601392 | 98 |
| 189 | 3300006844 | Ga0075428_100517064 | Ga0075428_1005170643 | 98 |
| 190 | 3300006847 | Ga0075431_100696407 | Ga0075431_1006964072 | 98 |
| 191 | 3300006847 | Ga0075431_101019322 | Ga0075431_1010193222 | 98 |
| 192 | 3300006852 | Ga0075433_10866858 | Ga0075433_108668582 | 98 |
| 193 | 3300006871 | Ga0075434_100147164 | Ga0075434_1001471641 | 98 |
| 194 | 3300006880 | Ga0075429_101422370 | Ga0075429_1014223701 | 98 |
| 195 | 3300006881 | Ga0068865_102160632 | Ga0068865_1021606322 | 98 |
| 196 | 3300006914 | Ga0075436_100021339 | Ga0075436_1000213392 | 98 |
| 197 | 3300007076 | Ga0075435_100376116 | Ga0075435_1003761161 | 98 |
| 198 | 3300007076 | Ga0075435_101239903 | Ga0075435_1012399032 | 98 |
| 199 | 3300007265 | Ga0099794_10438609 | Ga0099794_104386092 | 98 |
| 200 | 3300009093 | Ga0105240_10013461 | Ga0105240_100134617 | 98 |
| 201 | 3300009093 | Ga0105240_10361824 | Ga0105240_103618242 | 98 |
| 202 | 3300009093 | Ga0105240_11131245 | Ga0105240_111312452 | 98 |
| 203 | 3300009094 | Ga0111539_10004383 | Ga0111539_1000438315 | 98 |
| 204 | 3300009098 | Ga0105245_10128762 | Ga0105245_101287623 | 98 |
| 205 | 3300009147 | Ga0114129_10485488 | Ga0114129_104854882 | 98 |
| 206 | 3300009148 | Ga0105243_11559169 | Ga0105243_115591692 | 98 |
| 207 | 3300009174 | Ga0105241_10734851 | Ga0105241_107348512 | 98 |
| 208 | 3300009177 | Ga0105248_10858980 | Ga0105248_108589802 | 98 |
| 209 | 3300009551 | Ga0105238_10388168 | Ga0105238_103881683 | 98 |
| 210 | 3300009553 | Ga0105249_12208552 | Ga0105249_122085521 | 98 |
| 211 | 3300010375 | Ga0105239_12402153 | Ga0105239_124021531 | 98 |
| 212 | 3300011119 | Ga0105246_10583254 | Ga0105246_105832542 | 98 |
| 213 | 3300011119 | Ga0105246_11701085 | Ga0105246_117010851 | 98 |
| 214 | 3300012505 | Ga0157339_1011526 | Ga0157339_10115262 | 98 |
| 215 | 3300013100 | Ga0157373_10702951 | Ga0157373_107029511 | 98 |
| 216 | 3300013100 | Ga0157373_10853575 | Ga0157373_108535752 | 98 |
| 217 | 3300013296 | Ga0157374_10003649 | Ga0157374_1000364911 | 98 |
| 218 | 3300013296 | Ga0157374_10008509 | Ga0157374_100085095 | 98 |
| 219 | 3300013296 | Ga0157374_10038850 | Ga0157374_100388504 | 98 |
| 220 | 3300013296 | Ga0157374_10054885 | Ga0157374_100548853 | 98 |
| 221 | 3300013296 | Ga0157374_10372141 | Ga0157374_103721412 | 98 |
| 222 | 3300013296 | Ga0157374_10413842 | Ga0157374_104138422 | 98 |
| 223 | 3300013297 | Ga0157378_10037489 | Ga0157378_100374893 | 98 |
| 224 | 3300013297 | Ga0157378_10106094 | Ga0157378_101060942 | 98 |
| 225 | 3300013297 | Ga0157378_10199194 | Ga0157378_101991942 | 98 |
| 226 | 3300013297 | Ga0157378_10219477 | Ga0157378_102194772 | 98 |
| 227 | 3300013297 | Ga0157378_10303075 | Ga0157378_103030751 | 98 |
| 228 | 3300013297 | Ga0157378_10534524 | Ga0157378_105345242 | 98 |
| 229 | 3300013297 | Ga0157378_10760748 | Ga0157378_107607481 | 98 |
| 230 | 3300013297 | Ga0157378_11511488 | Ga0157378_115114883 | 98 |
| 231 | 3300013297 | Ga0157378_11744346 | Ga0157378_117443462 | 98 |
| 232 | 3300013306 | Ga0163162_10025857 | Ga0163162_100258572 | 98 |
| 233 | 3300013306 | Ga0163162_10047376 | Ga0163162_100473767 | 98 |
| 234 | 3300013306 | Ga0163162_10220004 | Ga0163162_102200044 | 98 |
| 235 | 3300013306 | Ga0163162_10457768 | Ga0163162_104577682 | 98 |
| 236 | 3300013306 | Ga0163162_11976223 | Ga0163162_119762232 | 98 |
| 237 | 3300013307 | Ga0157372_10285973 | Ga0157372_102859732 | 98 |
| 238 | 3300013307 | Ga0157372_11808853 | Ga0157372_118088531 | 98 |
| 239 | 3300013308 | Ga0157375_10025531 | Ga0157375_100255312 | 98 |
| 240 | 3300013308 | Ga0157375_10408046 | Ga0157375_104080462 | 98 |
| 241 | 3300013308 | Ga0157375_10595176 | Ga0157375_105951761 | 98 |
| 242 | 3300013308 | Ga0157375_13173947 | Ga0157375_131739471 | 98 |
| 243 | 3300013308 | Ga0157375_13750981 | Ga0157375_137509811 | 98 |
| 244 | 3300014325 | Ga0163163_10121974 | Ga0163163_101219743 | 98 |
| 245 | 3300014325 | Ga0163163_11098612 | Ga0163163_110986122 | 98 |
| 246 | 3300014745 | Ga0157377_10711411 | Ga0157377_107114112 | 98 |
| 247 | 3300014745 | Ga0157377_11711172 | Ga0157377_117111721 | 98 |
| 248 | 3300014969 | Ga0157376_10021880 | Ga0157376_100218802 | 98 |
| 249 | 3300014969 | Ga0157376_10566368 | Ga0157376_105663682 | 98 |
| 250 | 3300014969 | Ga0157376_11254106 | Ga0157376_112541061 | 98 |
| 251 | 3300017792 | Ga0163161_10008101 | Ga0163161_100081014 | 98 |
| 252 | 3300020069 | Ga0197907_10288390 | Ga0197907_102883902 | 98 |
| 253 | 3300020069 | Ga0197907_10850257 | Ga0197907_108502571 | 98 |
| 254 | 3300020070 | Ga0206356_11686282 | Ga0206356_116862824 | 98 |
| 255 | 3300020070 | Ga0206356_11841930 | Ga0206356_118419302 | 98 |
| 256 | 3300020078 | Ga0206352_10241420 | Ga0206352_102414201 | 98 |
| 257 | 3300020081 | Ga0206354_10340800 | Ga0206354_103408003 | 98 |
| 258 | 3300020082 | Ga0206353_11011302 | Ga0206353_110113023 | 98 |
| 259 | 3300022467 | Ga0224712_10036212 | Ga0224712_100362123 | 98 |
| 260 | 3300025315 | Ga0207697_10000854 | Ga0207697_100008546 | 98 |
| 261 | 3300025898 | Ga0207692_10034745 | Ga0207692_100347451 | 98 |
| 262 | 3300025898 | Ga0207692_10471613 | Ga0207692_104716132 | 98 |
| 263 | 3300025901 | Ga0207688_10055143 | Ga0207688_100551432 | 98 |
| 264 | 3300025903 | Ga0207680_10015145 | Ga0207680_100151455 | 98 |
| 265 | 3300025903 | Ga0207680_10040413 | Ga0207680_100404133 | 98 |
| 266 | 3300025903 | Ga0207680_10277805 | Ga0207680_102778052 | 98 |
| 267 | 3300025905 | Ga0207685_10630247 | Ga0207685_106302471 | 98 |
| 268 | 3300025906 | Ga0207699_10009049 | Ga0207699_100090495 | 98 |
| 269 | 3300025906 | Ga0207699_10174652 | Ga0207699_101746522 | 98 |
| 270 | 3300025906 | Ga0207699_11111605 | Ga0207699_111116052 | 98 |
| 271 | 3300025907 | Ga0207645_10009259 | Ga0207645_100092594 | 98 |
| 272 | 3300025907 | Ga0207645_10397833 | Ga0207645_103978332 | 98 |
| 273 | 3300025907 | Ga0207645_10490314 | Ga0207645_104903142 | 98 |
| 274 | 3300025909 | Ga0207705_10003728 | Ga0207705_1000372811 | 98 |
| 275 | 3300025909 | Ga0207705_10583935 | Ga0207705_105839351 | 98 |
| 276 | 3300025910 | Ga0207684_10000236 | Ga0207684_1000023658 | 98 |
| 277 | 3300025910 | Ga0207684_10003260 | Ga0207684_100032607 | 98 |
| 278 | 3300025910 | Ga0207684_10004441 | Ga0207684_100044411 | 98 |
| 279 | 3300025910 | Ga0207684_10088592 | Ga0207684_100885922 | 98 |
| 280 | 3300025910 | Ga0207684_10099417 | Ga0207684_100994172 | 98 |
| 281 | 3300025910 | Ga0207684_10110691 | Ga0207684_101106912 | 98 |
| 282 | 3300025910 | Ga0207684_10461391 | Ga0207684_104613912 | 98 |
| 283 | 3300025910 | Ga0207684_10786058 | Ga0207684_107860582 | 98 |
| 284 | 3300025912 | Ga0207707_10001020 | Ga0207707_1000102026 | 98 |
| 285 | 3300025912 | Ga0207707_10064367 | Ga0207707_100643673 | 98 |
| 286 | 3300025912 | Ga0207707_10200109 | Ga0207707_102001092 | 98 |
| 287 | 3300025913 | Ga0207695_10410718 | Ga0207695_104107182 | 98 |
| 288 | 3300025913 | Ga0207695_10773759 | Ga0207695_107737592 | 98 |
| 289 | 3300025915 | Ga0207693_10005749 | Ga0207693_100057498 | 98 |
| 290 | 3300025915 | Ga0207693_10012762 | Ga0207693_100127621 | 98 |
| 291 | 3300025915 | Ga0207693_10019355 | Ga0207693_100193552 | 98 |
| 292 | 3300025915 | Ga0207693_10030131 | Ga0207693_100301312 | 98 |
| 293 | 3300025915 | Ga0207693_10118606 | Ga0207693_101186061 | 98 |
| 294 | 3300025916 | Ga0207663_10016144 | Ga0207663_100161443 | 98 |
| 295 | 3300025916 | Ga0207663_10024800 | Ga0207663_100248002 | 98 |
| 296 | 3300025916 | Ga0207663_10092620 | Ga0207663_100926203 | 98 |
| 297 | 3300025916 | Ga0207663_10239624 | Ga0207663_102396242 | 98 |
| 298 | 3300025917 | Ga0207660_10003998 | Ga0207660_100039989 | 98 |
| 299 | 3300025919 | Ga0207657_10207015 | Ga0207657_102070152 | 98 |
| 300 | 3300025919 | Ga0207657_10809110 | Ga0207657_108091102 | 98 |
| 301 | 3300025920 | Ga0207649_10673743 | Ga0207649_106737432 | 98 |
| 302 | 3300025921 | Ga0207652_10004326 | Ga0207652_1000432611 | 98 |
| 303 | 3300025922 | Ga0207646_10120873 | Ga0207646_101208734 | 98 |
| 304 | 3300025922 | Ga0207646_10182544 | Ga0207646_101825443 | 98 |
| 305 | 3300025922 | Ga0207646_10732427 | Ga0207646_107324271 | 98 |
| 306 | 3300025923 | Ga0207681_10027734 | Ga0207681_100277341 | 98 |
| 307 | 3300025923 | Ga0207681_10188203 | Ga0207681_101882032 | 98 |
| 308 | 3300025925 | Ga0207650_10003332 | Ga0207650_1000333210 | 98 |
| 309 | 3300025925 | Ga0207650_10146898 | Ga0207650_101468982 | 98 |
| 310 | 3300025925 | Ga0207650_10564475 | Ga0207650_105644752 | 98 |
| 311 | 3300025925 | Ga0207650_10818206 | Ga0207650_108182061 | 98 |
| 312 | 3300025926 | Ga0207659_10022477 | Ga0207659_100224775 | 98 |
| 313 | 3300025926 | Ga0207659_10562425 | Ga0207659_105624252 | 98 |
| 314 | 3300025926 | Ga0207659_10620267 | Ga0207659_106202672 | 98 |
| 315 | 3300025926 | Ga0207659_11316672 | Ga0207659_113166721 | 98 |
| 316 | 3300025927 | Ga0207687_10415139 | Ga0207687_104151392 | 98 |
| 317 | 3300025928 | Ga0207700_10022927 | Ga0207700_100229274 | 98 |
| 318 | 3300025928 | Ga0207700_10123482 | Ga0207700_101234822 | 98 |
| 319 | 3300025928 | Ga0207700_10589759 | Ga0207700_105897592 | 98 |
| 320 | 3300025929 | Ga0207664_10080060 | Ga0207664_100800605 | 98 |
| 321 | 3300025931 | Ga0207644_10049703 | Ga0207644_100497032 | 98 |
| 322 | 3300025931 | Ga0207644_10055802 | Ga0207644_100558022 | 98 |
| 323 | 3300025931 | Ga0207644_10603798 | Ga0207644_106037981 | 98 |
| 324 | 3300025931 | Ga0207644_10710843 | Ga0207644_107108432 | 98 |
| 325 | 3300025932 | Ga0207690_10176375 | Ga0207690_101763751 | 98 |
| 326 | 3300025933 | Ga0207706_10116308 | Ga0207706_101163083 | 98 |
| 327 | 3300025933 | Ga0207706_11532755 | Ga0207706_115327552 | 98 |
| 328 | 3300025936 | Ga0207670_10627840 | Ga0207670_106278402 | 98 |
| 329 | 3300025937 | Ga0207669_10404303 | Ga0207669_104043032 | 98 |
| 330 | 3300025937 | Ga0207669_11384852 | Ga0207669_113848522 | 98 |
| 331 | 3300025938 | Ga0207704_11065146 | Ga0207704_110651462 | 98 |
| 332 | 3300025939 | Ga0207665_10064527 | Ga0207665_100645272 | 98 |
| 333 | 3300025940 | Ga0207691_10007536 | Ga0207691_1000753611 | 98 |
| 334 | 3300025940 | Ga0207691_11735759 | Ga0207691_117357591 | 98 |
| 335 | 3300025941 | Ga0207711_10591775 | Ga0207711_105917752 | 98 |
| 336 | 3300025944 | Ga0207661_10456818 | Ga0207661_104568182 | 98 |
| 337 | 3300025944 | Ga0207661_10572993 | Ga0207661_105729932 | 98 |
| 338 | 3300025949 | Ga0207667_10247462 | Ga0207667_102474622 | 98 |
| 339 | 3300025960 | Ga0207651_10104849 | Ga0207651_101048493 | 98 |
| 340 | 3300025960 | Ga0207651_10506960 | Ga0207651_105069601 | 98 |
| 341 | 3300025960 | Ga0207651_11426643 | Ga0207651_114266431 | 98 |
| 342 | 3300025972 | Ga0207668_10256977 | Ga0207668_102569772 | 98 |
| 343 | 3300025972 | Ga0207668_10277815 | Ga0207668_102778152 | 98 |
| 344 | 3300025981 | Ga0207640_10000003 | Ga0207640_10000003162 | 98 |
| 345 | 3300025981 | Ga0207640_10415509 | Ga0207640_104155092 | 98 |
| 346 | 3300025986 | Ga0207658_10009327 | Ga0207658_100093277 | 98 |
| 347 | 3300025986 | Ga0207658_10235579 | Ga0207658_102355792 | 98 |
| 348 | 3300025986 | Ga0207658_10284461 | Ga0207658_102844611 | 98 |
| 349 | 3300025986 | Ga0207658_10391341 | Ga0207658_103913411 | 98 |
| 350 | 3300025986 | Ga0207658_10549787 | Ga0207658_105497871 | 98 |
| 351 | 3300026023 | Ga0207677_10044878 | Ga0207677_100448784 | 98 |
| 352 | 3300026023 | Ga0207677_11387381 | Ga0207677_113873811 | 98 |
| 353 | 3300026035 | Ga0207703_10037885 | Ga0207703_100378853 | 98 |
| 354 | 3300026035 | Ga0207703_11578354 | Ga0207703_115783542 | 98 |
| 355 | 3300026041 | Ga0207639_10022648 | Ga0207639_100226483 | 98 |
| 356 | 3300026067 | Ga0207678_10083083 | Ga0207678_100830833 | 98 |
| 357 | 3300026067 | Ga0207678_10121977 | Ga0207678_101219774 | 98 |
| 358 | 3300026078 | Ga0207702_10077387 | Ga0207702_100773874 | 98 |
| 359 | 3300026088 | Ga0207641_10150179 | Ga0207641_101501791 | 98 |
| 360 | 3300026088 | Ga0207641_10589848 | Ga0207641_105898482 | 98 |
| 361 | 3300026088 | Ga0207641_12137596 | Ga0207641_121375962 | 98 |
| 362 | 3300026118 | Ga0207675_100216823 | Ga0207675_1002168231 | 98 |
| 363 | 3300026118 | Ga0207675_100492844 | Ga0207675_1004928442 | 98 |
| 364 | 3300026118 | Ga0207675_101904472 | Ga0207675_1019044722 | 98 |
| 365 | 3300026118 | Ga0207675_102623842 | Ga0207675_1026238421 | 98 |
| 366 | 3300026121 | Ga0207683_10012242 | Ga0207683_100122422 | 98 |
| 367 | 3300026121 | Ga0207683_10108782 | Ga0207683_101087823 | 98 |
| 368 | 3300026121 | Ga0207683_10325701 | Ga0207683_103257012 | 98 |
| 369 | 3300026121 | Ga0207683_10463769 | Ga0207683_104637692 | 98 |
| 370 | 3300026142 | Ga0207698_12572878 | Ga0207698_125728782 | 98 |
| 371 | 3300028379 | Ga0268266_10038515 | Ga0268266_100385153 | 98 |
| 372 | 3300028379 | Ga0268266_10770610 | Ga0268266_107706102 | 98 |
| 373 | 3300028379 | Ga0268266_11894612 | Ga0268266_118946122 | 98 |
| 374 | 3300028380 | Ga0268265_11571858 | Ga0268265_115718582 | 98 |
| 375 | 3300028380 | Ga0268265_11725446 | Ga0268265_117254462 | 98 |
| 376 | 3300028380 | Ga0268265_12080723 | Ga0268265_120807231 | 98 |
| 377 | 3300028380 | Ga0268265_12620311 | Ga0268265_126203112 | 98 |
| 378 | 3300028381 | Ga0268264_10182601 | Ga0268264_101826013 | 98 |
| 379 | 3300031235 | Ga0265330_10188941 | Ga0265330_101889412 | 98 |
| 380 | 3300031238 | Ga0265332_10006760 | Ga0265332_100067601 | 98 |
| 381 | 3300031238 | Ga0265332_10331568 | Ga0265332_103315682 | 98 |
| 382 | 3300031242 | Ga0265329_10269673 | Ga0265329_102696732 | 98 |
| 383 | 3300031249 | Ga0265339_10001696 | Ga0265339_1000169610 | 98 |
| 384 | 3300031250 | Ga0265331_10059800 | Ga0265331_100598002 | 98 |
| 385 | 3300031251 | Ga0265327_10006819 | Ga0265327_100068193 | 98 |
| 386 | 3300031507 | Ga0307509_10008868 | Ga0307509_100088687 | 98 |
| 387 | 3300031595 | Ga0265313_10430084 | Ga0265313_104300842 | 98 |
| 388 | 3300031711 | Ga0265314_10020409 | Ga0265314_100204092 | 98 |
| 389 | 3300031712 | Ga0265342_10012485 | Ga0265342_100124854 | 98 |
| 390 | 3300031727 | Ga0316576_10261265 | Ga0316576_102612651 | 98 |
| 391 | 3300031728 | Ga0316578_10299713 | Ga0316578_102997132 | 98 |
| 392 | 3300031730 | Ga0307516_10470430 | Ga0307516_104704302 | 98 |
| 393 | 3300031731 | Ga0307405_10410701 | Ga0307405_104107011 | 98 |
| 394 | 3300031731 | Ga0307405_11038490 | Ga0307405_110384902 | 98 |
| 395 | 3300031852 | Ga0307410_11084345 | Ga0307410_110843452 | 98 |
| 396 | 3300031903 | Ga0307407_10492982 | Ga0307407_104929821 | 98 |
| 397 | 3300031995 | Ga0307409_101161695 | Ga0307409_1011616952 | 98 |
| 398 | 3300032002 | Ga0307416_100896928 | Ga0307416_1008969282 | 98 |
| 399 | 3300032004 | Ga0307414_10230729 | Ga0307414_102307292 | 98 |
| 400 | 3300032005 | Ga0307411_10115466 | Ga0307411_101154663 | 98 |
| 401 | 3300035083 | Ga0373926_0055700 | Ga0373926_0055700_377_673 | 98 |
| 402 | 3300035083 | Ga0373926_0180875 | Ga0373926_0180875_327_623 | 98 |
| 403 | 3300035089 | Ga0373944_0048002 | Ga0373944_0048002_38_334 | 98 |
| 404 | 3300035089 | Ga0373944_0278878 | Ga0373944_0278878_120_416 | 98 |
| 405 | 3300035111 | Ga0373923_0485581 | Ga0373923_0485581_107_403 | 98 |
| 406 | 3300035113 | Ga0373936_0285219 | Ga0373936_0285219_418_714 | 98 |
| 407 | 3300035116 | Ga0373945_0013206 | Ga0373945_0013206_1591_1887 | 98 |
| 408 | 3300035116 | Ga0373945_0071093 | Ga0373945_0071093_338_634 | 98 |
| 409 | 3300035116 | Ga0373945_0302552 | Ga0373945_0302552_85_381 | 98 |
| 410 | 3300035121 | Ga0373960_0314457 | Ga0373960_0314457_187_531 | 98 |
| 411 | 3300035170 | Ga0373943_0027007 | Ga0373943_0027007_1572_1868 | 98 |
| 412 | 3300035170 | Ga0373943_0306730 | Ga0373943_0306730_281_577 | 98 |
| 413 | 3300035170 | Ga0373943_0379536 | Ga0373943_0379536_24_320 | 98 |
| 414 | 3300035171 | Ga0373946_0066937 | Ga0373946_0066937_818_1114 | 98 |
| 415 | 3300035171 | Ga0373946_0109569 | Ga0373946_0109569_181_477 | 98 |
| 416 | 3300035171 | Ga0373946_0562527 | Ga0373946_0562527_40_336 | 98 |
| 417 | 3300035171 | Ga0373946_0675508 | Ga0373946_0675508_179_475 | 98 |
| 418 | 3300035692 | Ga0373935_0017087 | Ga0373935_0017087_667_963 | 98 |
| 419 | 3300035692 | Ga0373935_0047170 | Ga0373935_0047170_1948_2244 | 98 |
| 420 | 3300035692 | Ga0373935_0060339 | Ga0373935_0060339_13_309 | 98 |
| 421 | 3300035692 | Ga0373935_0138338 | Ga0373935_0138338_849_1145 | 98 |
| 422 | 3300035692 | Ga0373935_1198635 | Ga0373935_1198635_166_462 | 98 |
| 423 | 3300035695 | Ga0373927_0023279 | Ga0373927_0023279_1008_1304 | 98 |
| 424 | 3300035725 | Ga0373947_0006717 | Ga0373947_0006717_3926_4222 | 98 |
| 425 | 3300035725 | Ga0373947_0047497 | Ga0373947_0047497_251_547 | 98 |
| 426 | 3300035725 | Ga0373947_0253550 | Ga0373947_0253550_494_790 | 98 |
| 427 | 3300035725 | Ga0373947_0358549 | Ga0373947_0358549_244_540 | 98 |
| 428 | 3300035725 | Ga0373947_0729662 | Ga0373947_0729662_294_590 | 98 |
| 429 | 3300036401 | Ga0373937_0567388 | Ga0373937_0567388_103_399 | 98 |
| 430 | 3300036401 | Ga0373937_0607591 | Ga0373937_0607591_278_574 | 98 |
| 431 | 3300036401 | Ga0373937_0770387 | Ga0373937_0770387_299_604 | 98 |
| 432 | 3300036712 | Ga0316584_0027028 | Ga0316584_0027028_91_387 | 98 |
| 433 | 3300037068 | Ga0373925_0002783 | Ga0373925_0002783_4904_5200 | 98 |
| 434 | 3300037068 | Ga0373925_0079995 | Ga0373925_0079995_1232_1528 | 98 |
| 435 | 3300037068 | Ga0373925_0423863 | Ga0373925_0423863_725_1021 | 98 |
| 436 | 3300037418 | Ga0395900_0004019 | Ga0395900_0004019_4331_4627 | 98 |
| 437 | 3300037466 | Ga0395898_1406019 | Ga0395898_1406019_152_448 | 98 |
| 438 | 3300037471 | Ga0395905_1157971 | Ga0395905_1157971_11_307 | 98 |
| 439 | 3300038443 | Ga0395901_0651595 | Ga0395901_0651595_746_1042 | 98 |
| 440 | 3300039453 | Ga0436362_0501654 | Ga0436362_0501654_243_539 | 98 |
| 441 | 3300041509 | Ga0451843_0502551 | Ga0451843_0502551_389_685 | 98 |
| 442 | 3300042125 | Ga0450923_119487 | Ga0450923_119487_315_611 | 98 |
| 443 | 3300042146 | Ga0450907_012539 | Ga0450907_012539_575_895 | 98 |
| 444 | 3300042157 | Ga0439458_0201842 | Ga0439458_0201842_85_387 | 98 |
| 445 | 3300042184 | Ga0450908_000945 | Ga0450908_000945_1579_1899 | 98 |
| 446 | 3300042439 | Ga0439464_0081901 | Ga0439464_0081901_519_818 | 98 |
| 447 | 3300044684 | Ga0466966_0048017 | Ga0466966_0048017_173_478 | 98 |
| 448 | 3300044684 | Ga0466966_0272853 | Ga0466966_0272853_593_910 | 98 |
| 449 | 3300044693 | Ga0466961_0023664 | Ga0466961_0023664_3078_3383 | 98 |
| 450 | 3300044693 | Ga0466961_0675380 | Ga0466961_0675380_95_391 | 98 |
| 451 | 3300044706 | Ga0466964_0898205 | Ga0466964_0898205_198_494 | 98 |
| 452 | 3300045049 | Ga0466959_0173447 | Ga0466959_0173447_780_1085 | 98 |
| 453 | 3300045049 | Ga0466959_0592667 | Ga0466959_0592667_428_724 | 98 |
| 454 | 3300045836 | Ga0466958_0022098 | Ga0466958_0022098_366_671 | 98 |
| 455 | 3300046472 | Ga0495580_0538199 | Ga0495580_0538199_401_697 | 98 |
| 456 | 3300046475 | Ga0495639_0120376 | Ga0495639_0120376_741_1037 | 98 |
| 457 | 3300046491 | Ga0495584_0263680 | Ga0495584_0263680_79_375 | 98 |
| 458 | 3300046511 | Ga0495608_0195373 | Ga0495608_0195373_301_597 | 98 |
| 459 | 3300046517 | Ga0495630_0040776 | Ga0495630_0040776_2281_2577 | 98 |
| 460 | 3300046517 | Ga0495630_0389378 | Ga0495630_0389378_49_345 | 98 |
| 461 | 3300046520 | Ga0495637_0117193 | Ga0495637_0117193_48_344 | 98 |
| 462 | 3300046525 | Ga0495663_0334260 | Ga0495663_0334260_110_406 | 98 |
| 463 | 3300046526 | Ga0495666_0053589 | Ga0495666_0053589_255_551 | 98 |
| 464 | 3300046528 | Ga0495642_0030910 | Ga0495642_0030910_1660_1956 | 98 |
| 465 | 3300046531 | Ga0495665_0335630 | Ga0495665_0335630_419_715 | 98 |
| 466 | 3300046533 | Ga0495640_0792770 | Ga0495640_0792770_219_524 | 98 |
| 467 | 3300046537 | Ga0495598_0004342 | Ga0495598_0004342_2689_2985 | 98 |
| 468 | 3300046559 | Ga0495667_0034908 | Ga0495667_0034908_2360_2656 | 98 |
| 469 | 3300046616 | Ga0495668_0512914 | Ga0495668_0512914_142_438 | 98 |
| 470 | 3300046664 | Ga0495659_0032152 | Ga0495659_0032152_30_326 | 98 |
| 471 | 3300046681 | Ga0495647_0152861 | Ga0495647_0152861_363_659 | 98 |
| 472 | 3300046684 | Ga0495669_0020388 | Ga0495669_0020388_2059_2355 | 98 |
| 473 | 3300046689 | Ga0495613_0596179 | Ga0495613_0596179_130_426 | 98 |
| 474 | 3300046690 | Ga0495624_0217010 | Ga0495624_0217010_342_638 | 98 |
| 475 | 3300046691 | Ga0495670_0603896 | Ga0495670_0603896_83_379 | 98 |
| 476 | 3300047315 | Ga0495581_0151576 | Ga0495581_0151576_827_1123 | 98 |
| 477 | 3300047470 | Ga0495681_0203819 | Ga0495681_0203819_133_429 | 98 |
| 478 | 3300047673 | Ga0495593_0605656 | Ga0495593_0605656_18_314 | 98 |
| 479 | 3300048904 | Ga0496101_0013434 | Ga0496101_0013434_1258_1602 | 98 |
| 480 | 3300048904 | Ga0496101_1116857 | Ga0496101_1116857_142_438 | 98 |
| 481 | 3300048905 | Ga0496102_0767373 | Ga0496102_0767373_295_621 | 98 |
| 482 | 3300048905 | Ga0496102_1068300 | Ga0496102_1068300_55_351 | 98 |
| 483 | 3300048906 | Ga0496103_0023018 | Ga0496103_0023018_2700_3044 | 98 |
| 484 | 3300048907 | Ga0496104_0047881 | Ga0496104_0047881_1568_1912 | 98 |
| 485 | 3300048907 | Ga0496104_0511238 | Ga0496104_0511238_58_354 | 98 |
| 486 | 3300048907 | Ga0496104_1550098 | Ga0496104_1550098_57_401 | 98 |
| 487 | 3300048908 | Ga0496105_0170611 | Ga0496105_0170611_976_1320 | 98 |
| 488 | 3300048908 | Ga0496105_0211488 | Ga0496105_0211488_248_544 | 98 |
| 489 | 3300048908 | Ga0496105_0651287 | Ga0496105_0651287_380_676 | 98 |
| 490 | 3300048909 | Ga0496106_0002638 | Ga0496106_0002638_6028_6372 | 98 |
| 491 | 3300048910 | Ga0496107_0048627 | Ga0496107_0048627_547_843 | 98 |
| 492 | 3300048910 | Ga0496107_0593043 | Ga0496107_0593043_468_764 | 98 |
| 493 | 3300048911 | Ga0496108_0453670 | Ga0496108_0453670_248_544 | 98 |
| 494 | 3300048911 | Ga0496108_1076739 | Ga0496108_1076739_309_605 | 98 |
| 495 | 3300048912 | Ga0496109_0007022 | Ga0496109_0007022_5966_6262 | 98 |
| 496 | 3300048913 | Ga0496110_0789089 | Ga0496110_0789089_409_705 | 98 |
| 497 | 3300048914 | Ga0496111_0211411 | Ga0496111_0211411_1045_1341 | 98 |
| 498 | 3300048915 | Ga0496112_0034922 | Ga0496112_0034922_892_1188 | 98 |
| 499 | 3300048915 | Ga0496112_0035434 | Ga0496112_0035434_139_483 | 98 |
| 500 | 3300048915 | Ga0496112_0259561 | Ga0496112_0259561_287_583 | 98 |
| 501 | 3300048915 | Ga0496112_0846542 | Ga0496112_0846542_192_488 | 98 |
| 502 | 3300048916 | Ga0496113_0195347 | Ga0496113_0195347_698_1042 | 98 |
| 503 | 3300048916 | Ga0496113_0486083 | Ga0496113_0486083_266_562 | 98 |
| 504 | 3300048916 | Ga0496113_1280319 | Ga0496113_1280319_221_547 | 98 |
| 505 | 3300048918 | Ga0496115_0018207 | Ga0496115_0018207_3140_3484 | 98 |
| 506 | 3300048918 | Ga0496115_0085759 | Ga0496115_0085759_687_983 | 98 |
| 507 | 3300049742 | Ga0501080_0168015 | Ga0501080_0168015_170_466 | 98 |
| 508 | 3300050507 | nmdc:mga05p37_356344_c1 | nmdc:mga05p37_356344_c1_354_650 | 98 |
| 509 | 3300050507 | nmdc:mga05p37_455653_c1 | nmdc:mga05p37_455653_c1_799_1095 | 98 |
| 510 | 3300050508 | nmdc:mga09592_1160413_c1 | nmdc:mga09592_1160413_c1_243_539 | 98 |
| 511 | 3300050509 | nmdc:mga0qj67_839081_c1 | nmdc:mga0qj67_839081_c1_418_714 | 98 |
| 512 | 3300050510 | nmdc:mga06r32_472417_c1 | nmdc:mga06r32_472417_c1_575_874 | 98 |
| 513 | 3300050510 | nmdc:mga06r32_664444_c1 | nmdc:mga06r32_664444_c1_635_931 | 98 |
| 514 | 3300050511 | nmdc:mga08y16_3320_c1 | nmdc:mga08y16_3320_c1_12290_12589 | 98 |
| 515 | 3300050512 | nmdc:mga0n895_360307_c1 | nmdc:mga0n895_360307_c1_955_1251 | 98 |
| 516 | 3300050513 | nmdc:mga0rr50_1839988_c1 | nmdc:mga0rr50_1839988_c1_77_373 | 98 |
| 517 | 3300050513 | nmdc:mga0rr50_204524_c1 | nmdc:mga0rr50_204524_c1_454_750 | 98 |
| 518 | 3300050513 | nmdc:mga0rr50_330307_c1 | nmdc:mga0rr50_330307_c1_107_403 | 98 |
| 519 | 3300050514 | nmdc:mga08x19_14882_c1 | nmdc:mga08x19_14882_c1_3880_4176 | 98 |
| 520 | 3300050514 | nmdc:mga08x19_414956_c1 | nmdc:mga08x19_414956_c1_28_324 | 98 |
| 521 | 3300050514 | nmdc:mga08x19_54641_c1 | nmdc:mga08x19_54641_c1_34_330 | 98 |
| 522 | 3300050515 | nmdc:mga0a205_400368_c1 | nmdc:mga0a205_400368_c1_66_362 | 98 |
| 523 | 3300053083 | Ga0495655_0037124 | Ga0495655_0037124_138_434 | 98 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8687 | 3 | 95 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8418 | 3 | 98 |
| 1v8c-assembly1.cif.gz_A | crystal structure of moad related protein from thermus thermophilus hb8 | 0.8368 | 3 | 95 |
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8246 | 3 | 95 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8078 | 3 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8687 | 3 | 95 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8246 | 3 | 95 | 3.10.20.30 |
| af_Q54NM8_4_86_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8073 | 1 | 98 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8007 | 3 | 93 | 3.10.20.30 |
| af_Q54NM8_4_86_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.7988 | 1 | 98 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5W3B6-F1-model_v4 | MoaD/ThiS family protein | 0.9893 | 1 | 67 |
|
| AF-A0A535NE45-F1-model_v4 | MoaD/ThiS family protein | 0.9885 | 1 | 47 |
|
| AF-A0A534ZY62-F1-model_v4 | MoaD/ThiS family protein | 0.9853 | 1 | 84 |
|
| AF-A0A1F8SIJ2-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9826 | 1 | 94 |
|
| AF-A0A1G0SXB6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9788 | 1 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar