F458874

General Info

Members Datasets Scaffolds Average Seq Length
522 274 1044 114

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1482068|Ga0436364_1482068_468_818
Length 109
Sequence MGNPNIEADPEWKKGSAELLVLSLLEAQPRHGYDISKLIEARSGGALTFHVTSLYPLLHRLEQQGWIEGKWVEKAEQLTAAGRRVLRSKQQSWKDFVAAIGRVTGAENA

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
226 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
227 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
228 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
229 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
235 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
236 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
237 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
238 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
239 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
240 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
243 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
244 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
247 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
248 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
249 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
250 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
251 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
256 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
257 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
258 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
259 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
260 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 1.34
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 42.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1482068 3300037853 Bacteria 1127
2 MBSR1b_contig_3288526 2162886012 Unclassified 1849
3 Ga0065707_10032395 3300005295 Unclassified 1347
4 Ga0070658_10458625 3300005327 Unclassified 1099
5 Ga0070676_10783558 3300005328 Bacteria 702
6 Ga0070683_100840892 3300005329 Bacteria 880
7 Ga0070690_100008733 3300005330 Bacteria 5847
8 Ga0070690_100165569 3300005330 Bacteria 1518
9 Ga0068869_100330436 3300005334 Bacteria 1238
10 Ga0070666_10625592 3300005335 Unclassified 786
11 Ga0070666_10752241 3300005335 Unclassified 716
12 Ga0070680_100005491 3300005336 Bacteria 9594
13 Ga0070682_100211955 3300005337 Unclassified 1373
14 Ga0068868_100010616 3300005338 Bacteria 6674
15 Ga0070660_100306377 3300005339 Bacteria 1303
16 Ga0070689_101191525 3300005340 Bacteria 683
17 Ga0070689_101966679 3300005340 Unclassified 534
18 Ga0070687_100003714 3300005343 Bacteria 5979
19 Ga0070661_101130032 3300005344 Unclassified 653
20 Ga0070668_100897576 3300005347 Bacteria 792
21 Ga0070675_100394854 3300005354 Bacteria 1233
22 Ga0070675_100885783 3300005354 Unclassified 818
23 Ga0070671_100019242 3300005355 Bacteria 5555
24 Ga0070659_100124093 3300005366 Bacteria 2094
25 Ga0070659_100420853 3300005366 Unclassified 1130
26 Ga0070659_100491398 3300005366 Unclassified 1045
27 Ga0070709_10385621 3300005434 Bacteria 1043
28 Ga0070709_10400659 3300005434 Unclassified 1024
29 Ga0070709_11023456 3300005434 Unclassified 658
30 Ga0070714_100328025 3300005435 Unclassified 1433
31 Ga0070713_100678103 3300005436 Unclassified 983
32 Ga0070713_100779615 3300005436 Bacteria 916
33 Ga0070701_10337397 3300005438 Unclassified 937
34 Ga0070711_101204656 3300005439 Unclassified 655
35 Ga0070705_100738269 3300005440 Bacteria 777
36 Ga0070700_100192746 3300005441 Unclassified 1426
37 Ga0070694_100357298 3300005444 Unclassified 1133
38 Ga0070694_100466967 3300005444 Bacteria 999
39 Ga0070694_100581782 3300005444 Bacteria 900
40 Ga0070694_100945145 3300005444 Bacteria 713
41 Ga0070708_100196172 3300005445 Unclassified 1889
42 Ga0070678_101156944 3300005456 Unclassified 716
43 Ga0070662_100101365 3300005457 Bacteria 2179
44 Ga0070662_100433714 3300005457 Bacteria 1089
45 Ga0070681_11957196 3300005458 Unclassified 514
46 Ga0068867_100163413 3300005459 Bacteria 1757
47 Ga0068867_101536187 3300005459 Unclassified 621
48 Ga0068867_101824679 3300005459 Bacteria 572
49 Ga0070685_10371164 3300005466 Bacteria 983
50 Ga0070698_100001288 3300005471 Bacteria 27970
51 Ga0070698_100085961 3300005471 Bacteria 3131
52 Ga0070698_100333580 3300005471 Bacteria 1448
53 Ga0070698_100815970 3300005471 Unclassified 877
54 Ga0070698_101365515 3300005471 Unclassified 659
55 Ga0070699_100001501 3300005518 Bacteria 21362
56 Ga0070699_101316335 3300005518 Unclassified 663
57 Ga0070679_100136260 3300005530 Bacteria 2436
58 Ga0070679_100493422 3300005530 Unclassified 1169
59 Ga0070697_101608914 3300005536 Unclassified 581
60 Ga0068853_100373778 3300005539 Bacteria 1330
61 Ga0068853_101011308 3300005539 Bacteria 800
62 Ga0070672_100172890 3300005543 Unclassified 1797
63 Ga0070686_100004522 3300005544 Bacteria 7669
64 Ga0070695_100028194 3300005545 Bacteria 3484
65 Ga0070696_101106831 3300005546 Unclassified 666
66 Ga0070665_100138835 3300005548 Bacteria 2434
67 Ga0070704_100009430 3300005549 Bacteria 5895
68 Ga0070704_100009849 3300005549 Bacteria 5797
69 Ga0070704_100399502 3300005549 Bacteria 1172
70 Ga0068855_100068056 3300005563 Bacteria 4147
71 Ga0068855_100142230 3300005563 Bacteria 2733
72 Ga0068855_100244453 3300005563 Bacteria 2004
73 Ga0068855_100405838 3300005563 Unclassified 1493
74 Ga0070664_100228239 3300005564 Bacteria 1668
75 Ga0070664_102030524 3300005564 Bacteria 546
76 Ga0068857_100956500 3300005577 Bacteria 823
77 Ga0068857_101021869 3300005577 Unclassified 796
78 Ga0068854_100183013 3300005578 Unclassified 1638
79 Ga0068856_100140142 3300005614 Unclassified 2425
80 Ga0068856_100857233 3300005614 Bacteria 928
81 Ga0070702_100364488 3300005615 Unclassified 1022
82 Ga0068852_100033032 3300005616 Bacteria 4291
83 Ga0068852_100317966 3300005616 Unclassified 1511
84 Ga0068852_100852451 3300005616 Bacteria 927
85 Ga0068859_100385215 3300005617 Bacteria 1498
86 Ga0068859_100927224 3300005617 Unclassified 955
87 Ga0068859_101537136 3300005617 Unclassified 735
88 Ga0068859_102662136 3300005617 Bacteria 550
89 Ga0068859_102675994 3300005617 Bacteria 548
90 Ga0068864_100569393 3300005618 Bacteria 1097
91 Ga0068864_100812623 3300005618 Bacteria 919
92 Ga0068864_102211955 3300005618 Bacteria 556
93 Ga0068866_10086268 3300005718 Bacteria 1698
94 Ga0068866_10408430 3300005718 Unclassified 878
95 Ga0068866_10514555 3300005718 Bacteria 794
96 Ga0068861_100024328 3300005719 Unclassified 4379
97 Ga0068861_100177189 3300005719 Bacteria 1771
98 Ga0068861_101331852 3300005719 Unclassified 699
99 Ga0068870_10195792 3300005840 Bacteria 1222
100 Ga0068870_10288210 3300005840 Bacteria 1032
101 Ga0068858_102361854 3300005842 Unclassified 525
102 Ga0068860_100891642 3300005843 Unclassified 905
103 Ga0068860_100910523 3300005843 Bacteria 896
104 Ga0068862_100087195 3300005844 Bacteria 2715
105 Ga0068862_100424106 3300005844 Bacteria 1249
106 Ga0068862_100467684 3300005844 Bacteria 1191
107 Ga0068862_101483701 3300005844 Unclassified 683
108 Ga0068862_101642298 3300005844 Bacteria 650
109 Ga0081455_10019244 3300005937 Bacteria 6467
110 Ga0081455_10053047 3300005937 Bacteria 3466
111 Ga0070717_10103436 3300006028 Bacteria 2421
112 Ga0075368_10011755 3300006042 Bacteria 3191
113 Ga0075364_10002697 3300006051 Bacteria 9973
114 Ga0070716_100780653 3300006173 Unclassified 738
115 Ga0075362_10000091 3300006177 Bacteria 25095
116 Ga0075367_10009630 3300006178 Bacteria 5058
117 Ga0075366_10246266 3300006195 Bacteria 1090
118 Ga0097621_100220914 3300006237 Bacteria 1651
119 Ga0097621_100811356 3300006237 Bacteria 867
120 Ga0097621_101405039 3300006237 Unclassified 661
121 Ga0068871_100190756 3300006358 Unclassified 1765
122 Ga0068871_100265655 3300006358 Unclassified 1498
123 Ga0068871_102128031 3300006358 Unclassified 534
124 Ga0075428_100001084 3300006844 Bacteria 28963
125 Ga0075428_100009017 3300006844 Bacteria 11067
126 Ga0075428_100078809 3300006844 Bacteria 3596
127 Ga0075428_100564810 3300006844 Unclassified 1216
128 Ga0075430_100005595 3300006846 Bacteria 10617
129 Ga0075430_100008268 3300006846 Bacteria 8787
130 Ga0075430_100373047 3300006846 Bacteria 1178
131 Ga0075430_100454032 3300006846 Unclassified 1058
132 Ga0075430_101437924 3300006846 Bacteria 567
133 Ga0075431_100006320 3300006847 Bacteria 11766
134 Ga0075431_100015249 3300006847 Bacteria 7789
135 Ga0075431_100032294 3300006847 Bacteria 5395
136 Ga0075431_100039153 3300006847 Bacteria 4883
137 Ga0075431_100055753 3300006847 Unclassified 4077
138 Ga0075431_100071471 3300006847 Bacteria 3580
139 Ga0075431_100440655 3300006847 Bacteria 1300
140 Ga0075431_100718256 3300006847 Bacteria 976
141 Ga0075433_10209362 3300006852 Bacteria 1733
142 Ga0075434_100150053 3300006871 Unclassified 2351
143 Ga0075429_100024467 3300006880 Bacteria 5239
144 Ga0075429_100704181 3300006880 Bacteria 885
145 Ga0075429_101252613 3300006880 Unclassified 647
146 Ga0068865_101571308 3300006881 Unclassified 591
147 Ga0068865_101927082 3300006881 Unclassified 535
148 Ga0075436_100000203 3300006914 Bacteria 36662
149 Ga0075436_100068062 3300006914 Unclassified 2460
150 Ga0075436_100671446 3300006914 Unclassified 766
151 Ga0075436_100700456 3300006914 Unclassified 750
152 Ga0075436_101238375 3300006914 Bacteria 564
153 Ga0097620_100385187 3300006931 Bacteria 1498
154 Ga0097620_100927057 3300006931 Unclassified 955
155 Ga0097620_101536745 3300006931 Unclassified 735
156 Ga0097620_102662341 3300006931 Bacteria 550
157 Ga0097620_102676023 3300006931 Bacteria 548
158 Ga0075435_100000012 3300007076 Bacteria 108852
159 Ga0075435_100231995 3300007076 Unclassified 1568
160 Ga0075435_100324963 3300007076 Bacteria 1317
161 Ga0075435_101042108 3300007076 Bacteria 715
162 Ga0105240_10001084 3300009093 Bacteria 48040
163 Ga0105240_10151337 3300009093 Bacteria 2763
164 Ga0105240_11815535 3300009093 Unclassified 635
165 Ga0105240_12249515 3300009093 Unclassified 565
166 Ga0111539_10000391 3300009094 Bacteria 54306
167 Ga0111539_10005012 3300009094 Bacteria 17220
168 Ga0111539_10005807 3300009094 Bacteria 15953
169 Ga0111539_10038824 3300009094 Bacteria 5743
170 Ga0111539_10199743 3300009094 Bacteria 2332
171 Ga0105245_10811327 3300009098 Unclassified 974
172 Ga0105247_11851449 3300009101 Unclassified 503
173 Ga0114129_10000006 3300009147 Bacteria 157531
174 Ga0114129_10000145 3300009147 Bacteria 74706
175 Ga0114129_10001461 3300009147 Bacteria 31932
176 Ga0114129_10004854 3300009147 Bacteria 18979
177 Ga0114129_10025963 3300009147 Bacteria 8296
178 Ga0114129_10101298 3300009147 Bacteria 3985
179 Ga0114129_10627905 3300009147 Unclassified 1389
180 Ga0114129_10630583 3300009147 Bacteria 1385
181 Ga0114129_11088867 3300009147 Bacteria 1001
182 Ga0114129_11183181 3300009147 Bacteria 953
183 Ga0114129_11391670 3300009147 Bacteria 866
184 Ga0114129_13461294 3300009147 Bacteria 506
185 Ga0105243_11135192 3300009148 Bacteria 791
186 Ga0105241_10099756 3300009174 Unclassified 2307
187 Ga0105241_12242349 3300009174 Bacteria 542
188 Ga0105242_10086846 3300009176 Bacteria 2626
189 Ga0105242_10182221 3300009176 Bacteria 1854
190 Ga0105242_10741988 3300009176 Bacteria 965
191 Ga0105248_10010901 3300009177 Bacteria 10029
192 Ga0105248_10044073 3300009177 Bacteria 5003
193 Ga0105248_10114822 3300009177 Unclassified 3037
194 Ga0105248_10662213 3300009177 Bacteria 1178
195 Ga0105248_11046550 3300009177 Unclassified 922
196 Ga0105248_13423487 3300009177 Unclassified 504
197 Ga0105237_11319096 3300009545 Unclassified 728
198 Ga0105237_12198761 3300009545 Unclassified 561
199 Ga0105238_10961074 3300009551 Unclassified 874
200 Ga0105238_12965821 3300009551 Unclassified 510
201 Ga0105249_10270645 3300009553 Bacteria 1692
202 Ga0105249_11671515 3300009553 Bacteria 709
203 Ga0105249_11689090 3300009553 Unclassified 706
204 Ga0105239_10769599 3300010375 Unclassified 1102
205 Ga0105239_10828421 3300010375 Unclassified 1061
206 Ga0105239_12957415 3300010375 Bacteria 554
207 Ga0157373_10084531 3300013100 Bacteria 2237
208 Ga0157373_10897428 3300013100 Unclassified 657
209 Ga0157371_10074435 3300013102 Unclassified 2405
210 Ga0157371_10386150 3300013102 Unclassified 1023
211 Ga0157370_10017793 3300013104 Bacteria 7163
212 Ga0157369_10009609 3300013105 Bacteria 11060
213 Ga0157369_10015118 3300013105 Bacteria 8712
214 Ga0157369_10171400 3300013105 Bacteria 2287
215 Ga0157369_10271560 3300013105 Bacteria 1767
216 Ga0157369_10337774 3300013105 Unclassified 1565
217 Ga0157369_10908303 3300013105 Unclassified 903
218 Ga0157374_10012598 3300013296 Bacteria 7363
219 Ga0157374_10071288 3300013296 Bacteria 3276
220 Ga0157374_10366613 3300013296 Bacteria 1433
221 Ga0157374_10467366 3300013296 Unclassified 1264
222 Ga0157378_10077924 3300013297 Unclassified 2988
223 Ga0157378_10099856 3300013297 Unclassified 2648
224 Ga0157378_10313929 3300013297 Bacteria 1521
225 Ga0157378_11086388 3300013297 Bacteria 837
226 Ga0157378_11101266 3300013297 Bacteria 831
227 Ga0157378_12013076 3300013297 Unclassified 628
228 Ga0163162_10116456 3300013306 Unclassified 2773
229 Ga0163162_10421439 3300013306 Unclassified 1467
230 Ga0163162_12550228 3300013306 Unclassified 588
231 Ga0157372_10021029 3300013307 Bacteria 7045
232 Ga0157372_10066899 3300013307 Bacteria 4037
233 Ga0157372_10902297 3300013307 Unclassified 1025
234 Ga0157375_10447175 3300013308 Bacteria 1458
235 Ga0157375_11069467 3300013308 Unclassified 944
236 Ga0163163_10323924 3300014325 Bacteria 1595
237 Ga0163163_10718343 3300014325 Bacteria 1063
238 Ga0157380_10030071 3300014326 Bacteria 4157
239 Ga0157379_10008589 3300014968 Bacteria 8888
240 Ga0157379_10891876 3300014968 Unclassified 843
241 Ga0157376_10045782 3300014969 Unclassified 3605
242 Ga0157376_10066069 3300014969 Bacteria 3056
243 Ga0157376_10514061 3300014969 Bacteria 1179
244 Ga0157376_10652888 3300014969 Unclassified 1053
245 Ga0163161_10110330 3300017792 Unclassified 2056
246 Ga0213874_10398736 3300021377 Unclassified 535
247 Ga0213875_10013294 3300021388 Bacteria 4046
248 Ga0213875_10337500 3300021388 Bacteria 715
249 Ga0207699_10423926 3300025906 Bacteria 951
250 Ga0207645_10066087 3300025907 Bacteria 2312
251 Ga0207643_11138894 3300025908 Bacteria 503
252 Ga0207684_10691239 3300025910 Unclassified 867
253 Ga0207684_10824115 3300025910 Bacteria 783
254 Ga0207707_10866467 3300025912 Unclassified 749
255 Ga0207695_10338309 3300025913 Bacteria 1393
256 Ga0207671_11320108 3300025914 Unclassified 561
257 Ga0207660_10025360 3300025917 Bacteria 4023
258 Ga0207657_10046663 3300025919 Bacteria 3794
259 Ga0207652_10088595 3300025921 Unclassified 2716
260 Ga0207646_11520024 3300025922 Unclassified 579
261 Ga0207681_10563160 3300025923 Bacteria 939
262 Ga0207650_10046399 3300025925 Bacteria 3199
263 Ga0207650_10621567 3300025925 Unclassified 909
264 Ga0207659_10363866 3300025926 Unclassified 1203
265 Ga0207700_10511997 3300025928 Unclassified 1063
266 Ga0207664_10250812 3300025929 Unclassified 1545
267 Ga0207644_10003041 3300025931 Bacteria 10784
268 Ga0207690_10191553 3300025932 Bacteria 1547
269 Ga0207690_10558980 3300025932 Unclassified 931
270 Ga0207706_10089514 3300025933 Bacteria 2706
271 Ga0207706_10204054 3300025933 Unclassified 1733
272 Ga0207706_10610854 3300025933 Unclassified 936
273 Ga0207686_11281021 3300025934 Unclassified 601
274 Ga0207670_10871730 3300025936 Bacteria 753
275 Ga0207670_11400451 3300025936 Bacteria 594
276 Ga0207669_11059996 3300025937 Bacteria 683
277 Ga0207704_10031166 3300025938 Bacteria 3000
278 Ga0207665_10700289 3300025939 Unclassified 796
279 Ga0207691_10967769 3300025940 Unclassified 711
280 Ga0207711_10014754 3300025941 Bacteria 6494
281 Ga0207711_10078248 3300025941 Unclassified 2884
282 Ga0207711_10485267 3300025941 Bacteria 1151
283 Ga0207711_10901835 3300025941 Bacteria 822
284 Ga0207661_10753001 3300025944 Unclassified 897
285 Ga0207679_10078084 3300025945 Bacteria 2521
286 Ga0207679_10111648 3300025945 Bacteria 2159
287 Ga0207679_11866561 3300025945 Bacteria 548
288 Ga0207667_10025407 3300025949 Bacteria 6483
289 Ga0207667_10230184 3300025949 Unclassified 1898
290 Ga0207667_10288300 3300025949 Bacteria 1677
291 Ga0207712_10372115 3300025961 Bacteria 1193
292 Ga0207640_10797117 3300025981 Unclassified 818
293 Ga0207703_10234085 3300026035 Bacteria 1648
294 Ga0207703_11662385 3300026035 Unclassified 614
295 Ga0207703_12143759 3300026035 Bacteria 535
296 Ga0207639_11958766 3300026041 Unclassified 547
297 Ga0207639_12017076 3300026041 Bacteria 538
298 Ga0207708_10261628 3300026075 Bacteria 1397
299 Ga0207641_10170179 3300026088 Bacteria 1988
300 Ga0207641_11807286 3300026088 Bacteria 613
301 Ga0207641_12288745 3300026088 Unclassified 540
302 Ga0207648_10150033 3300026089 Bacteria 2057
303 Ga0207648_10278988 3300026089 Unclassified 1494
304 Ga0207648_11891870 3300026089 Bacteria 558
305 Ga0207676_11509595 3300026095 Bacteria 669
306 Ga0207674_10043326 3300026116 Bacteria 4641
307 Ga0207674_11361776 3300026116 Unclassified 679
308 Ga0207675_100016297 3300026118 Bacteria 6938
309 Ga0207683_11081402 3300026121 Unclassified 744
310 Ga0207683_11285784 3300026121 Unclassified 677
311 Ga0207698_10163236 3300026142 Bacteria 1951
312 Ga0207698_10417414 3300026142 Unclassified 1287
313 Ga0207698_10892313 3300026142 Bacteria 896
314 Ga0209971_1036641 3300027682 Bacteria 1181
315 Ga0207428_10018757 3300027907 Bacteria 5903
316 Ga0207428_10019325 3300027907 Bacteria 5809
317 Ga0207428_10022255 3300027907 Bacteria 5352
318 Ga0207428_10077060 3300027907 Bacteria 2610
319 Ga0207428_10261439 3300027907 Bacteria 1289
320 Ga0268266_10031293 3300028379 Bacteria 4518
321 Ga0268266_11623949 3300028379 Bacteria 622
322 Ga0268265_10139431 3300028380 Bacteria 2028
323 Ga0268265_10528840 3300028380 Bacteria 1116
324 Ga0268265_10844422 3300028380 Unclassified 896
325 Ga0268265_10978251 3300028380 Bacteria 835
326 Ga0268265_11087932 3300028380 Bacteria 793
327 Ga0268265_11432682 3300028380 Bacteria 693
328 Ga0268264_11488560 3300028381 Unclassified 688
329 Ga0268264_12535674 3300028381 Bacteria 518
330 Ga0265332_10031472 3300031238 Bacteria 2314
331 Ga0265328_10045294 3300031239 Bacteria 1617
332 Ga0265329_10000529 3300031242 Bacteria 19689
333 Ga0265316_10150120 3300031344 Bacteria 1746
334 Ga0307408_100008601 3300031548 Bacteria 6740
335 Ga0307408_100024212 3300031548 Bacteria 4143
336 Ga0265314_10000046 3300031711 Bacteria 199789
337 Ga0307405_10050378 3300031731 Unclassified 2578
338 Ga0307405_10133618 3300031731 Unclassified 1719
339 Ga0307405_12106107 3300031731 Bacteria 506
340 Ga0307413_12198158 3300031824 Unclassified 500
341 Ga0307410_10985424 3300031852 Unclassified 726
342 Ga0307406_10114309 3300031901 Bacteria 1864
343 Ga0307406_10790083 3300031901 Unclassified 800
344 Ga0307412_10029541 3300031911 Bacteria 3441
345 Ga0307412_11053736 3300031911 Unclassified 721
346 Ga0307412_11513056 3300031911 Unclassified 610
347 Ga0307409_100137516 3300031995 Bacteria 2099
348 Ga0307409_101278527 3300031995 Bacteria 758
349 Ga0307409_101704103 3300031995 Unclassified 659
350 Ga0307416_100142979 3300032002 Bacteria 2178
351 Ga0307416_101329559 3300032002 Unclassified 824
352 Ga0307414_11367263 3300032004 Unclassified 658
353 Ga0307411_10136300 3300032005 Unclassified 1803
354 Ga0307411_10142640 3300032005 Unclassified 1768
355 Ga0307411_10311038 3300032005 Bacteria 1268
356 Ga0307415_100160377 3300032126 Bacteria 1742
357 Ga0307415_100272961 3300032126 Unclassified 1386
358 Ga0373926_0001850 3300035083 Bacteria 6587
359 Ga0373944_0139153 3300035089 Unclassified 849
360 Ga0373945_0269437 3300035116 Unclassified 723
361 Ga0373954_0102020 3300035118 Unclassified 1385
362 Ga0373943_0092078 3300035170 Bacteria 1572
363 Ga0373943_0653528 3300035170 Unclassified 621
364 Ga0373946_0027084 3300035171 Unclassified 2265
365 Ga0373946_0176371 3300035171 Unclassified 1012
366 Ga0373935_0428598 3300035692 Bacteria 953
367 Ga0373927_0000385 3300035695 Bacteria 34273
368 Ga0373927_0106388 3300035695 Bacteria 1827
369 Ga0373927_0423987 3300035695 Unclassified 878
370 Ga0373933_0185670 3300035724 Bacteria 1327
371 Ga0373947_0034906 3300035725 Unclassified 2976
372 Ga0373947_0089422 3300035725 Bacteria 1918
373 Ga0373947_0821480 3300035725 Unclassified 635
374 Ga0373925_0003144 3300037068 Bacteria 12952
375 Ga0373925_0171958 3300037068 Bacteria 1711
376 Ga0373925_0177522 3300037068 Bacteria 1684
377 Ga0395899_0746101 3300037312 Unclassified 610
378 Ga0395905_1315930 3300037471 Unclassified 626
379 Ga0436364_0512271 3300037853 Bacteria 3958
380 Ga0436364_0944006 3300037853 Unclassified 705
381 Ga0436364_1235243 3300037853 Bacteria 1706
382 Ga0436365_0285818 3300039437 Bacteria 3149
383 Ga0436365_0397466 3300039437 Bacteria 16718
384 Ga0436363_1159143 3300039450 Unclassified 595
385 Ga0436362_1105643 3300039453 Bacteria 661
386 Ga0436362_1137242 3300039453 Bacteria 810
387 Ga0451807_0983759 3300041486 Bacteria 612
388 Ga0439434_0138638 3300042435 Unclassified 801
389 Ga0439435_0218066 3300042436 Unclassified 634
390 Ga0439435_0249454 3300042436 Bacteria 597
391 Ga0439464_0003033 3300042439 Bacteria 4201
392 Ga0453683_0257204 3300044673 Bacteria 1113
393 Ga0453683_1202055 3300044673 Unclassified 507
394 Ga0466963_0178766 3300044694 Unclassified 1481
395 Ga0466963_1101242 3300044694 Unclassified 559
396 Ga0466959_0362553 3300045049 Unclassified 987
397 Ga0451576_1563089 3300045051 Bacteria 685
398 Ga0466958_0062414 3300045836 Unclassified 2272
399 Ga0466967_1362071 3300045976 Bacteria 707
400 Ga0466967_1847476 3300045976 Bacteria 601
401 Ga0495592_0232734 3300046454 Unclassified 1226
402 Ga0495629_0755009 3300046459 Unclassified 644
403 Ga0495651_0213191 3300046462 Unclassified 1342
404 Ga0495580_0032098 3300046472 Bacteria 3791
405 Ga0495580_0050503 3300046472 Unclassified 2941
406 Ga0495664_0143815 3300046477 Unclassified 1446
407 Ga0495630_0156601 3300046517 Unclassified 1734
408 Ga0495666_0492835 3300046526 Unclassified 548
409 Ga0495665_0414317 3300046531 Unclassified 683
410 Ga0495587_0008078 3300046536 Bacteria 6786
411 Ga0495598_0033852 3300046537 Unclassified 1453
412 Ga0495621_0008484 3300046539 Bacteria 3085
413 Ga0495645_0041500 3300046543 Bacteria 3355
414 Ga0495667_0486022 3300046559 Unclassified 774
415 Ga0495635_0659082 3300046663 Unclassified 681
416 Ga0495657_0587262 3300046675 Unclassified 645
417 Ga0495599_0310261 3300046678 Unclassified 951
418 Ga0495599_0627558 3300046678 Unclassified 624
419 Ga0495604_0249332 3300047317 Unclassified 1211
420 Ga0495604_0808850 3300047317 Unclassified 590
421 Ga0495674_0066052 3300047319 Bacteria 3140
422 Ga0495674_0282597 3300047319 Bacteria 1359
423 Ga0495674_1263821 3300047319 Unclassified 555
424 Ga0495676_0607820 3300047321 Unclassified 712
425 Ga0495680_0624358 3300047322 Unclassified 719
426 Ga0495684_0016437 3300047471 Bacteria 5698
427 Ga0496104_0728665 3300048907 Unclassified 899
428 Ga0496106_0314602 3300048909 Bacteria 1256
429 Ga0496107_0509590 3300048910 Unclassified 892
430 Ga0496108_0848999 3300048911 Unclassified 786
431 Ga0496112_1037731 3300048915 Unclassified 739
432 Ga0496115_0392727 3300048918 Unclassified 1126
433 Ga0501291_012922 3300049514 Unclassified 1228
434 Ga0501292_003093 3300049515 Unclassified 2198
435 Ga0501292_059596 3300049515 Unclassified 690
436 Ga0501296_022908 3300049519 Bacteria 807
437 Ga0501299_003362 3300049522 Bacteria 2312
438 Ga0501299_020035 3300049522 Unclassified 1216
439 Ga0501299_059087 3300049522 Unclassified 808
440 Ga0501300_041694 3300049523 Unclassified 693
441 Ga0501041_0407999 3300049577 Bacteria 861
442 Ga0501048_0936383 3300049582 Bacteria 623
443 Ga0501067_0201950 3300049583 Unclassified 1107
444 Ga0501077_0310295 3300049593 Bacteria 1005
445 Ga0501198_010002 3300049649 Bacteria 1397
446 Ga0501199_064917 3300049650 Unclassified 515
447 Ga0501201_011674 3300049651 Unclassified 870
448 Ga0501202_024641 3300049652 Unclassified 1221
449 Ga0501206_027229 3300049653 Bacteria 837
450 Ga0501207_147569 3300049654 Bacteria 505
451 Ga0501209_135293 3300049656 Unclassified 737
452 Ga0501217_010818 3300049661 Unclassified 2008
453 Ga0501217_031619 3300049661 Unclassified 1305
454 Ga0501223_006704 3300049663 Unclassified 2375
455 Ga0501223_040548 3300049663 Unclassified 904
456 Ga0501228_005633 3300049666 Unclassified 1116
457 Ga0501233_124762 3300049668 Unclassified 699
458 Ga0501235_021778 3300049669 Bacteria 1425
459 Ga0501235_059412 3300049669 Unclassified 894
460 Ga0501243_024669 3300049675 Unclassified 1005
461 Ga0501249_003290 3300049679 Bacteria 3250
462 Ga0501253_095414 3300049683 Unclassified 690
463 Ga0501259_138582 3300049688 Unclassified 593
464 Ga0501221_036444 3300049704 Bacteria 1054
465 Ga0501221_119433 3300049704 Bacteria 672
466 Ga0501245_023003 3300049708 Unclassified 987
467 Ga0501079_0142838 3300049741 Bacteria 1865
468 Ga0501080_1133984 3300049742 Bacteria 674
469 Ga0501081_0114992 3300049743 Bacteria 1912
470 Ga0501266_020998 3300049763 Unclassified 891
471 Ga0501273_044749 3300049770 Unclassified 663
472 Ga0501275_027556 3300049772 Unclassified 735
473 Ga0501278_011220 3300049774 Unclassified 725
474 Ga0501204_041501 3300049850 Unclassified 676
475 Ga0501212_120012 3300049851 Bacteria 509
476 nmdc:mga03683_1647_c1 3300050489 Bacteria 6710
477 nmdc:mga0k408_10029_c1 3300050493 Bacteria 5116
478 nmdc:mga0k408_24591_c1 3300050493 Bacteria 3406
479 nmdc:mga05p37_1038300_c1 3300050507 Bacteria 866
480 nmdc:mga05p37_1456550_c1 3300050507 Bacteria 685
481 nmdc:mga05p37_166578_c1 3300050507 Bacteria 2689
482 nmdc:mga05p37_172370_c1 3300050507 Bacteria 2638
483 nmdc:mga05p37_194972_c1 3300050507 Bacteria 2456
484 nmdc:mga05p37_1987_c1 3300050507 Bacteria 23855
485 nmdc:mga05p37_25_c1 3300050507 Bacteria 116982
486 nmdc:mga05p37_418261_c1 3300050507 Unclassified 1560
487 nmdc:mga05p37_68_c1 3300050507 Bacteria 91472
488 nmdc:mga09592_1140250_c1 3300050508 Unclassified 647
489 nmdc:mga09592_198579_c1 3300050508 Unclassified 1737
490 nmdc:mga0qj67_260129_c1 3300050509 Unclassified 1408
491 nmdc:mga0qj67_75015_c1 3300050509 Unclassified 2703
492 nmdc:mga06r32_31521_c1 3300050510 Bacteria 4980
493 nmdc:mga06r32_39330_c1 3300050510 Bacteria 4487
494 nmdc:mga06r32_458604_c1 3300050510 Bacteria 1254
495 nmdc:mga06r32_48091_c1 3300050510 Bacteria 4077
496 nmdc:mga06r32_75959_c1 3300050510 Bacteria 3262
497 nmdc:mga06r32_872417_c1 3300050510 Bacteria 857
498 nmdc:mga08y16_179476_c1 3300050511 Bacteria 2199
499 nmdc:mga08y16_193217_c1 3300050511 Bacteria 2110
500 nmdc:mga08y16_19798_c1 3300050511 Bacteria 7096
501 nmdc:mga08y16_5937_c1 3300050511 Bacteria 12800
502 nmdc:mga08y16_623030_c1 3300050511 Bacteria 1086
503 nmdc:mga08y16_71481_c1 3300050511 Bacteria 3616
504 nmdc:mga0n895_112436_c1 3300050512 Unclassified 2740
505 nmdc:mga0n895_1211675_c1 3300050512 Unclassified 728
506 nmdc:mga0n895_531_c1 3300050512 Bacteria 25976
507 nmdc:mga0rr50_194416_c1 3300050513 Bacteria 1664
508 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
509 nmdc:mga0rr50_299342_c1 3300050513 Unclassified 1345
510 nmdc:mga0rr50_894989_c1 3300050513 Bacteria 757
511 nmdc:mga08x19_311_c1 3300050514 Bacteria 35355
512 nmdc:mga08x19_350860_c1 3300050514 Bacteria 1030
513 nmdc:mga08x19_598898_c1 3300050514 Unclassified 781
514 nmdc:mga08x19_675768_c1 3300050514 Unclassified 733
515 nmdc:mga08x19_68761_c1 3300050514 Unclassified 2305
516 nmdc:mga0a205_21468_c1 3300050515 Bacteria 4727
517 nmdc:mga0a205_215282_c1 3300050515 Bacteria 1808
518 nmdc:mga0a205_22864_c1 3300050515 Bacteria 5927
519 nmdc:mga0a205_275756_c1 3300050515 Unclassified 1558
520 Ga0501084_0019512 3300054114 Bacteria 5648
521 Ga0590071_140548 3300059421 Bacteria 623
522 Ga0501082_0000348 3300060353 Bacteria 40832
523 Ga0436364_1482068
524 MBSR1b_contig_3288526
525 Ga0065707_10032395
526 Ga0070658_10458625
527 Ga0070676_10783558
528 Ga0070683_100840892
529 Ga0070690_100008733
530 Ga0070690_100165569
531 Ga0068869_100330436
532 Ga0070666_10625592
533 Ga0070666_10752241
534 Ga0070680_100005491
535 Ga0070682_100211955
536 Ga0068868_100010616
537 Ga0070660_100306377
538 Ga0070689_101191525
539 Ga0070689_101966679
540 Ga0070687_100003714
541 Ga0070661_101130032
542 Ga0070668_100897576
543 Ga0070675_100394854
544 Ga0070675_100885783
545 Ga0070671_100019242
546 Ga0070659_100124093
547 Ga0070659_100420853
548 Ga0070659_100491398
549 Ga0070709_10385621
550 Ga0070709_10400659
551 Ga0070709_11023456
552 Ga0070714_100328025
553 Ga0070713_100678103
554 Ga0070713_100779615
555 Ga0070701_10337397
556 Ga0070711_101204656
557 Ga0070705_100738269
558 Ga0070700_100192746
559 Ga0070694_100357298
560 Ga0070694_100466967
561 Ga0070694_100581782
562 Ga0070694_100945145
563 Ga0070708_100196172
564 Ga0070678_101156944
565 Ga0070662_100101365
566 Ga0070662_100433714
567 Ga0070681_11957196
568 Ga0068867_100163413
569 Ga0068867_101536187
570 Ga0068867_101824679
571 Ga0070685_10371164
572 Ga0070698_100001288
573 Ga0070698_100085961
574 Ga0070698_100333580
575 Ga0070698_100815970
576 Ga0070698_101365515
577 Ga0070699_100001501
578 Ga0070699_101316335
579 Ga0070679_100136260
580 Ga0070679_100493422
581 Ga0070697_101608914
582 Ga0068853_100373778
583 Ga0068853_101011308
584 Ga0070672_100172890
585 Ga0070686_100004522
586 Ga0070695_100028194
587 Ga0070696_101106831
588 Ga0070665_100138835
589 Ga0070704_100009430
590 Ga0070704_100009849
591 Ga0070704_100399502
592 Ga0068855_100068056
593 Ga0068855_100142230
594 Ga0068855_100244453
595 Ga0068855_100405838
596 Ga0070664_100228239
597 Ga0070664_102030524
598 Ga0068857_100956500
599 Ga0068857_101021869
600 Ga0068854_100183013
601 Ga0068856_100140142
602 Ga0068856_100857233
603 Ga0070702_100364488
604 Ga0068852_100033032
605 Ga0068852_100317966
606 Ga0068852_100852451
607 Ga0068859_100385215
608 Ga0068859_100927224
609 Ga0068859_101537136
610 Ga0068859_102662136
611 Ga0068859_102675994
612 Ga0068864_100569393
613 Ga0068864_100812623
614 Ga0068864_102211955
615 Ga0068866_10086268
616 Ga0068866_10408430
617 Ga0068866_10514555
618 Ga0068861_100024328
619 Ga0068861_100177189
620 Ga0068861_101331852
621 Ga0068870_10195792
622 Ga0068870_10288210
623 Ga0068858_102361854
624 Ga0068860_100891642
625 Ga0068860_100910523
626 Ga0068862_100087195
627 Ga0068862_100424106
628 Ga0068862_100467684
629 Ga0068862_101483701
630 Ga0068862_101642298
631 Ga0081455_10019244
632 Ga0081455_10053047
633 Ga0070717_10103436
634 Ga0075368_10011755
635 Ga0075364_10002697
636 Ga0070716_100780653
637 Ga0075362_10000091
638 Ga0075367_10009630
639 Ga0075366_10246266
640 Ga0097621_100220914
641 Ga0097621_100811356
642 Ga0097621_101405039
643 Ga0068871_100190756
644 Ga0068871_100265655
645 Ga0068871_102128031
646 Ga0075428_100001084
647 Ga0075428_100009017
648 Ga0075428_100078809
649 Ga0075428_100564810
650 Ga0075430_100005595
651 Ga0075430_100008268
652 Ga0075430_100373047
653 Ga0075430_100454032
654 Ga0075430_101437924
655 Ga0075431_100006320
656 Ga0075431_100015249
657 Ga0075431_100032294
658 Ga0075431_100039153
659 Ga0075431_100055753
660 Ga0075431_100071471
661 Ga0075431_100440655
662 Ga0075431_100718256
663 Ga0075433_10209362
664 Ga0075434_100150053
665 Ga0075429_100024467
666 Ga0075429_100704181
667 Ga0075429_101252613
668 Ga0068865_101571308
669 Ga0068865_101927082
670 Ga0075436_100000203
671 Ga0075436_100068062
672 Ga0075436_100671446
673 Ga0075436_100700456
674 Ga0075436_101238375
675 Ga0097620_100385187
676 Ga0097620_100927057
677 Ga0097620_101536745
678 Ga0097620_102662341
679 Ga0097620_102676023
680 Ga0075435_100000012
681 Ga0075435_100231995
682 Ga0075435_100324963
683 Ga0075435_101042108
684 Ga0105240_10001084
685 Ga0105240_10151337
686 Ga0105240_11815535
687 Ga0105240_12249515
688 Ga0111539_10000391
689 Ga0111539_10005012
690 Ga0111539_10005807
691 Ga0111539_10038824
692 Ga0111539_10199743
693 Ga0105245_10811327
694 Ga0105247_11851449
695 Ga0114129_10000006
696 Ga0114129_10000145
697 Ga0114129_10001461
698 Ga0114129_10004854
699 Ga0114129_10025963
700 Ga0114129_10101298
701 Ga0114129_10627905
702 Ga0114129_10630583
703 Ga0114129_11088867
704 Ga0114129_11183181
705 Ga0114129_11391670
706 Ga0114129_13461294
707 Ga0105243_11135192
708 Ga0105241_10099756
709 Ga0105241_12242349
710 Ga0105242_10086846
711 Ga0105242_10182221
712 Ga0105242_10741988
713 Ga0105248_10010901
714 Ga0105248_10044073
715 Ga0105248_10114822
716 Ga0105248_10662213
717 Ga0105248_11046550
718 Ga0105248_13423487
719 Ga0105237_11319096
720 Ga0105237_12198761
721 Ga0105238_10961074
722 Ga0105238_12965821
723 Ga0105249_10270645
724 Ga0105249_11671515
725 Ga0105249_11689090
726 Ga0105239_10769599
727 Ga0105239_10828421
728 Ga0105239_12957415
729 Ga0157373_10084531
730 Ga0157373_10897428
731 Ga0157371_10074435
732 Ga0157371_10386150
733 Ga0157370_10017793
734 Ga0157369_10009609
735 Ga0157369_10015118
736 Ga0157369_10171400
737 Ga0157369_10271560
738 Ga0157369_10337774
739 Ga0157369_10908303
740 Ga0157374_10012598
741 Ga0157374_10071288
742 Ga0157374_10366613
743 Ga0157374_10467366
744 Ga0157378_10077924
745 Ga0157378_10099856
746 Ga0157378_10313929
747 Ga0157378_11086388
748 Ga0157378_11101266
749 Ga0157378_12013076
750 Ga0163162_10116456
751 Ga0163162_10421439
752 Ga0163162_12550228
753 Ga0157372_10021029
754 Ga0157372_10066899
755 Ga0157372_10902297
756 Ga0157375_10447175
757 Ga0157375_11069467
758 Ga0163163_10323924
759 Ga0163163_10718343
760 Ga0157380_10030071
761 Ga0157379_10008589
762 Ga0157379_10891876
763 Ga0157376_10045782
764 Ga0157376_10066069
765 Ga0157376_10514061
766 Ga0157376_10652888
767 Ga0163161_10110330
768 Ga0213874_10398736
769 Ga0213875_10013294
770 Ga0213875_10337500
771 Ga0207699_10423926
772 Ga0207645_10066087
773 Ga0207643_11138894
774 Ga0207684_10691239
775 Ga0207684_10824115
776 Ga0207707_10866467
777 Ga0207695_10338309
778 Ga0207671_11320108
779 Ga0207660_10025360
780 Ga0207657_10046663
781 Ga0207652_10088595
782 Ga0207646_11520024
783 Ga0207681_10563160
784 Ga0207650_10046399
785 Ga0207650_10621567
786 Ga0207659_10363866
787 Ga0207700_10511997
788 Ga0207664_10250812
789 Ga0207644_10003041
790 Ga0207690_10191553
791 Ga0207690_10558980
792 Ga0207706_10089514
793 Ga0207706_10204054
794 Ga0207706_10610854
795 Ga0207686_11281021
796 Ga0207670_10871730
797 Ga0207670_11400451
798 Ga0207669_11059996
799 Ga0207704_10031166
800 Ga0207665_10700289
801 Ga0207691_10967769
802 Ga0207711_10014754
803 Ga0207711_10078248
804 Ga0207711_10485267
805 Ga0207711_10901835
806 Ga0207661_10753001
807 Ga0207679_10078084
808 Ga0207679_10111648
809 Ga0207679_11866561
810 Ga0207667_10025407
811 Ga0207667_10230184
812 Ga0207667_10288300
813 Ga0207712_10372115
814 Ga0207640_10797117
815 Ga0207703_10234085
816 Ga0207703_11662385
817 Ga0207703_12143759
818 Ga0207639_11958766
819 Ga0207639_12017076
820 Ga0207708_10261628
821 Ga0207641_10170179
822 Ga0207641_11807286
823 Ga0207641_12288745
824 Ga0207648_10150033
825 Ga0207648_10278988
826 Ga0207648_11891870
827 Ga0207676_11509595
828 Ga0207674_10043326
829 Ga0207674_11361776
830 Ga0207675_100016297
831 Ga0207683_11081402
832 Ga0207683_11285784
833 Ga0207698_10163236
834 Ga0207698_10417414
835 Ga0207698_10892313
836 Ga0209971_1036641
837 Ga0207428_10018757
838 Ga0207428_10019325
839 Ga0207428_10022255
840 Ga0207428_10077060
841 Ga0207428_10261439
842 Ga0268266_10031293
843 Ga0268266_11623949
844 Ga0268265_10139431
845 Ga0268265_10528840
846 Ga0268265_10844422
847 Ga0268265_10978251
848 Ga0268265_11087932
849 Ga0268265_11432682
850 Ga0268264_11488560
851 Ga0268264_12535674
852 Ga0265332_10031472
853 Ga0265328_10045294
854 Ga0265329_10000529
855 Ga0265316_10150120
856 Ga0307408_100008601
857 Ga0307408_100024212
858 Ga0265314_10000046
859 Ga0307405_10050378
860 Ga0307405_10133618
861 Ga0307405_12106107
862 Ga0307413_12198158
863 Ga0307410_10985424
864 Ga0307406_10114309
865 Ga0307406_10790083
866 Ga0307412_10029541
867 Ga0307412_11053736
868 Ga0307412_11513056
869 Ga0307409_100137516
870 Ga0307409_101278527
871 Ga0307409_101704103
872 Ga0307416_100142979
873 Ga0307416_101329559
874 Ga0307414_11367263
875 Ga0307411_10136300
876 Ga0307411_10142640
877 Ga0307411_10311038
878 Ga0307415_100160377
879 Ga0307415_100272961
880 Ga0373926_0001850
881 Ga0373944_0139153
882 Ga0373945_0269437
883 Ga0373954_0102020
884 Ga0373943_0092078
885 Ga0373943_0653528
886 Ga0373946_0027084
887 Ga0373946_0176371
888 Ga0373935_0428598
889 Ga0373927_0000385
890 Ga0373927_0106388
891 Ga0373927_0423987
892 Ga0373933_0185670
893 Ga0373947_0034906
894 Ga0373947_0089422
895 Ga0373947_0821480
896 Ga0373925_0003144
897 Ga0373925_0171958
898 Ga0373925_0177522
899 Ga0395899_0746101
900 Ga0395905_1315930
901 Ga0436364_0512271
902 Ga0436364_0944006
903 Ga0436364_1235243
904 Ga0436365_0285818
905 Ga0436365_0397466
906 Ga0436363_1159143
907 Ga0436362_1105643
908 Ga0436362_1137242
909 Ga0451807_0983759
910 Ga0439434_0138638
911 Ga0439435_0218066
912 Ga0439435_0249454
913 Ga0439464_0003033
914 Ga0453683_0257204
915 Ga0453683_1202055
916 Ga0466963_0178766
917 Ga0466963_1101242
918 Ga0466959_0362553
919 Ga0451576_1563089
920 Ga0466958_0062414
921 Ga0466967_1362071
922 Ga0466967_1847476
923 Ga0495592_0232734
924 Ga0495629_0755009
925 Ga0495651_0213191
926 Ga0495580_0032098
927 Ga0495580_0050503
928 Ga0495664_0143815
929 Ga0495630_0156601
930 Ga0495666_0492835
931 Ga0495665_0414317
932 Ga0495587_0008078
933 Ga0495598_0033852
934 Ga0495621_0008484
935 Ga0495645_0041500
936 Ga0495667_0486022
937 Ga0495635_0659082
938 Ga0495657_0587262
939 Ga0495599_0310261
940 Ga0495599_0627558
941 Ga0495604_0249332
942 Ga0495604_0808850
943 Ga0495674_0066052
944 Ga0495674_0282597
945 Ga0495674_1263821
946 Ga0495676_0607820
947 Ga0495680_0624358
948 Ga0495684_0016437
949 Ga0496104_0728665
950 Ga0496106_0314602
951 Ga0496107_0509590
952 Ga0496108_0848999
953 Ga0496112_1037731
954 Ga0496115_0392727
955 Ga0501291_012922
956 Ga0501292_003093
957 Ga0501292_059596
958 Ga0501296_022908
959 Ga0501299_003362
960 Ga0501299_020035
961 Ga0501299_059087
962 Ga0501300_041694
963 Ga0501041_0407999
964 Ga0501048_0936383
965 Ga0501067_0201950
966 Ga0501077_0310295
967 Ga0501198_010002
968 Ga0501199_064917
969 Ga0501201_011674
970 Ga0501202_024641
971 Ga0501206_027229
972 Ga0501207_147569
973 Ga0501209_135293
974 Ga0501217_010818
975 Ga0501217_031619
976 Ga0501223_006704
977 Ga0501223_040548
978 Ga0501228_005633
979 Ga0501233_124762
980 Ga0501235_021778
981 Ga0501235_059412
982 Ga0501243_024669
983 Ga0501249_003290
984 Ga0501253_095414
985 Ga0501259_138582
986 Ga0501221_036444
987 Ga0501221_119433
988 Ga0501245_023003
989 Ga0501079_0142838
990 Ga0501080_1133984
991 Ga0501081_0114992
992 Ga0501266_020998
993 Ga0501273_044749
994 Ga0501275_027556
995 Ga0501278_011220
996 Ga0501204_041501
997 Ga0501212_120012
998 nmdc:mga03683_1647_c1
999 nmdc:mga0k408_10029_c1
1000 nmdc:mga0k408_24591_c1
1001 nmdc:mga05p37_1038300_c1
1002 nmdc:mga05p37_1456550_c1
1003 nmdc:mga05p37_166578_c1
1004 nmdc:mga05p37_172370_c1
1005 nmdc:mga05p37_194972_c1
1006 nmdc:mga05p37_1987_c1
1007 nmdc:mga05p37_25_c1
1008 nmdc:mga05p37_418261_c1
1009 nmdc:mga05p37_68_c1
1010 nmdc:mga09592_1140250_c1
1011 nmdc:mga09592_198579_c1
1012 nmdc:mga0qj67_260129_c1
1013 nmdc:mga0qj67_75015_c1
1014 nmdc:mga06r32_31521_c1
1015 nmdc:mga06r32_39330_c1
1016 nmdc:mga06r32_458604_c1
1017 nmdc:mga06r32_48091_c1
1018 nmdc:mga06r32_75959_c1
1019 nmdc:mga06r32_872417_c1
1020 nmdc:mga08y16_179476_c1
1021 nmdc:mga08y16_193217_c1
1022 nmdc:mga08y16_19798_c1
1023 nmdc:mga08y16_5937_c1
1024 nmdc:mga08y16_623030_c1
1025 nmdc:mga08y16_71481_c1
1026 nmdc:mga0n895_112436_c1
1027 nmdc:mga0n895_1211675_c1
1028 nmdc:mga0n895_531_c1
1029 nmdc:mga0rr50_194416_c1
1030 nmdc:mga0rr50_1_c1
1031 nmdc:mga0rr50_299342_c1
1032 nmdc:mga0rr50_894989_c1
1033 nmdc:mga08x19_311_c1
1034 nmdc:mga08x19_350860_c1
1035 nmdc:mga08x19_598898_c1
1036 nmdc:mga08x19_675768_c1
1037 nmdc:mga08x19_68761_c1
1038 nmdc:mga0a205_21468_c1
1039 nmdc:mga0a205_215282_c1
1040 nmdc:mga0a205_22864_c1
1041 nmdc:mga0a205_275756_c1
1042 Ga0501084_0019512
1043 Ga0590071_140548
1044 Ga0501082_0000348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

21

88

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9382 12 112
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9366 10 111
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9349 13 111
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9258 12 112
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.923 10 113
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9258 12 112 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9214 10 117 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9158 17 96 1.10.10.10
3hhhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9134 10 110 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9001 22 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A831PUK6-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9758 12 112
AF-A0A3A0CJ40-F1-model_v4 PadR family transcriptional regulator 0.9753 11 112
AF-A0A7X4EK53-F1-model_v4 PadR family transcriptional regulator 0.9739 12 111
AF-A0A351R0I5-F1-model_v4 PadR family transcriptional regulator 0.9738 13 111
AF-A0A1Q9K340-F1-model_v4 PadR family transcriptional regulator 0.9735 19 111

Map