F458812

General Info

Members Datasets Scaffolds Average Seq Length
522 236 1044 462

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10016627|Ga0070681_100166275
Length 509
Sequence MARLVAAQRFHSLIGAAAALASSRRAQECLLMTGDAPCWLNEFNDFSMTTALASELSDYLATHDRRIHDELFAFLRIPSVSARTEHRGDMTRAAEWLATSMRTAGLKAEILPTGGHPAVLGEWRGAPAGAKTVLIYGHYDVQPVEPLDLWTTPPFEPAVRDGRIYARGSVDDKGQLFLHVKALEAHLATRGSLPVNVIVLAEGEEEVGSGNLAPFIERHRDRLRCDYCVISDSSMFAPGLPSILSSLRGLAYFEIEVQGPASDLHSGIYGGAVVNPATALARIIATFHDEHWRVAIPGFYDDVRDWEPRVLKEMRALPFEDERFRKEVGAPALDGEAGRTTLERIWTRPTCEVNGLLSGYTGEGAKTVLPGKAMAKVSCRLVPDQTPDAIKRVLTAHVQRVAPRGVTVTVNALHGGLPWRAEMSGPLVDAARRALAGAFGREPVITGEGGSIPVVGDFERILGAPVLLIGFGLPGENAHAPNEWMSDENFVKGTRAIAMLWDELAKPAA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
220 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
221 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
226 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
227 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.53
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10016627 3300005458 Bacteria 7345
2 Ga0058863_11584584 3300004799 Bacteria 2195
3 Ga0065707_10095578 3300005295 Bacteria 3362
4 Ga0070658_10002403 3300005327 Bacteria 15680
5 Ga0070658_10008160 3300005327 Bacteria 8419
6 Ga0070658_10161401 3300005327 Bacteria 1880
7 Ga0070676_10001662 3300005328 Bacteria 11308
8 Ga0070676_10005255 3300005328 Bacteria 6885
9 Ga0070683_100001613 3300005329 Bacteria 17456
10 Ga0070683_100002037 3300005329 Bacteria 15914
11 Ga0070683_100007371 3300005329 Bacteria 9295
12 Ga0070683_100029092 3300005329 Bacteria 4999
13 Ga0070683_100034706 3300005329 Bacteria 4610
14 Ga0070683_100042083 3300005329 Bacteria 4206
15 Ga0070683_100042311 3300005329 Bacteria 4195
16 Ga0070683_100043331 3300005329 Bacteria 4147
17 Ga0070683_100047013 3300005329 Bacteria 3987
18 Ga0070683_100050211 3300005329 Bacteria 3860
19 Ga0070683_100071033 3300005329 Bacteria 3248
20 Ga0070683_100193074 3300005329 Bacteria 1934
21 Ga0070683_100245685 3300005329 Bacteria 1702
22 Ga0070690_100043074 3300005330 Bacteria 2861
23 Ga0070670_100001462 3300005331 Bacteria 19015
24 Ga0068869_100045567 3300005334 Bacteria 3158
25 Ga0070680_100000032 3300005336 Bacteria 72004
26 Ga0070680_100004132 3300005336 Bacteria 10877
27 Ga0070680_100049557 3300005336 Bacteria 3424
28 Ga0070680_100075485 3300005336 Bacteria 2775
29 Ga0070660_100020559 3300005339 Bacteria 4853
30 Ga0070660_100060949 3300005339 Bacteria 2929
31 Ga0070687_100024714 3300005343 Bacteria 2874
32 Ga0070661_100002247 3300005344 Bacteria 13248
33 Ga0070661_100012309 3300005344 Bacteria 5983
34 Ga0070661_100018173 3300005344 Bacteria 4996
35 Ga0070661_100038473 3300005344 Bacteria 3482
36 Ga0070661_100084147 3300005344 Bacteria 2350
37 Ga0070668_100000787 3300005347 Bacteria 21854
38 Ga0070668_100004688 3300005347 Bacteria 10134
39 Ga0070668_100033279 3300005347 Bacteria 3924
40 Ga0070669_100002444 3300005353 Bacteria 13459
41 Ga0070669_100020098 3300005353 Bacteria 4768
42 Ga0070669_100084982 3300005353 Bacteria 2362
43 Ga0070675_100020842 3300005354 Bacteria 5232
44 Ga0070675_100029943 3300005354 Bacteria 4392
45 Ga0070675_100031152 3300005354 Bacteria 4310
46 Ga0070671_100029664 3300005355 Unclassified 4511
47 Ga0070671_100082901 3300005355 Bacteria 2682
48 Ga0070673_100054149 3300005364 Bacteria 3155
49 Ga0070688_100045988 3300005365 Bacteria 2701
50 Ga0070688_100070486 3300005365 Unclassified 2235
51 Ga0070659_100029355 3300005366 Bacteria 4250
52 Ga0070659_100223833 3300005366 Bacteria 1554
53 Ga0070667_100012957 3300005367 Bacteria 6894
54 Ga0070667_100013393 3300005367 Bacteria 6779
55 Ga0070667_100030053 3300005367 Bacteria 4531
56 Ga0070709_10054043 3300005434 Bacteria 2530
57 Ga0070714_100001686 3300005435 Bacteria 16048
58 Ga0070714_100016004 3300005435 Bacteria 6047
59 Ga0070714_100016220 3300005435 Bacteria 6008
60 Ga0070714_100113813 3300005435 Bacteria 2399
61 Ga0070713_100003194 3300005436 Bacteria 10786
62 Ga0070700_100054038 3300005441 Bacteria 2508
63 Ga0070694_100014822 3300005444 Bacteria 4883
64 Ga0070694_100024950 3300005444 Bacteria 3863
65 Ga0070694_100042490 3300005444 Bacteria 3036
66 Ga0070708_100001746 3300005445 Bacteria 16686
67 Ga0070663_100011715 3300005455 Bacteria 5517
68 Ga0070663_100011838 3300005455 Bacteria 5496
69 Ga0070662_100023950 3300005457 Bacteria 4200
70 Ga0070662_100155098 3300005457 Bacteria 1787
71 Ga0070681_10002927 3300005458 Bacteria 15821
72 Ga0070681_10004944 3300005458 Bacteria 12817
73 Ga0070681_10008476 3300005458 Bacteria 10064
74 Ga0070681_10011090 3300005458 Bacteria 8917
75 Ga0070681_10017337 3300005458 Bacteria 7196
76 Ga0068867_100108350 3300005459 Bacteria 2131
77 Ga0070685_10029149 3300005466 Bacteria 3063
78 Ga0070706_100071733 3300005467 Bacteria 3204
79 Ga0070706_100256651 3300005467 Bacteria 1632
80 Ga0070707_100130040 3300005468 Bacteria 2448
81 Ga0070698_100001779 3300005471 Bacteria 23995
82 Ga0070698_100073028 3300005471 Bacteria 3438
83 Ga0070699_100120449 3300005518 Bacteria 2307
84 Ga0070679_100000420 3300005530 Bacteria 36037
85 Ga0070679_100002414 3300005530 Bacteria 16929
86 Ga0070679_100003040 3300005530 Bacteria 15326
87 Ga0070679_100005364 3300005530 Bacteria 11866
88 Ga0070679_100020914 3300005530 Bacteria 6383
89 Ga0070679_100032801 3300005530 Bacteria 5140
90 Ga0070679_100041803 3300005530 Bacteria 4563
91 Ga0070679_100091743 3300005530 Bacteria 3025
92 Ga0070679_100150961 3300005530 Bacteria 2300
93 Ga0070684_100002344 3300005535 Bacteria 13959
94 Ga0070684_100007441 3300005535 Bacteria 8514
95 Ga0070684_100017228 3300005535 Bacteria 5924
96 Ga0070684_100025320 3300005535 Bacteria 4986
97 Ga0070684_100050584 3300005535 Unclassified 3610
98 Ga0070684_100060926 3300005535 Bacteria 3302
99 Ga0070684_100077274 3300005535 Bacteria 2940
100 Ga0068853_100002180 3300005539 Bacteria 14591
101 Ga0068853_100114411 3300005539 Bacteria 2400
102 Ga0070672_100008057 3300005543 Bacteria 7198
103 Ga0070672_100015900 3300005543 Bacteria 5373
104 Ga0070672_100093554 3300005543 Bacteria 2428
105 Ga0070672_100094962 3300005543 Bacteria 2411
106 Ga0070672_100099918 3300005543 Unclassified 2352
107 Ga0070672_100132635 3300005543 Unclassified 2049
108 Ga0070696_100085250 3300005546 Bacteria 2242
109 Ga0070696_100120205 3300005546 Unclassified 1901
110 Ga0068855_100023666 3300005563 Bacteria 7355
111 Ga0068855_100042600 3300005563 Bacteria 5378
112 Ga0070664_100002537 3300005564 Bacteria 14728
113 Ga0070664_100003554 3300005564 Bacteria 12595
114 Ga0070664_100004984 3300005564 Bacteria 10642
115 Ga0070664_100055492 3300005564 Bacteria 3363
116 Ga0068857_100002675 3300005577 Bacteria 14628
117 Ga0068857_100002944 3300005577 Bacteria 14029
118 Ga0068857_100052712 3300005577 Bacteria 3608
119 Ga0068854_100019620 3300005578 Bacteria 4558
120 Ga0068854_100028354 3300005578 Bacteria 3868
121 Ga0068854_100128835 3300005578 Bacteria 1930
122 Ga0068856_100009523 3300005614 Bacteria 9438
123 Ga0068856_100052401 3300005614 Bacteria 4023
124 Ga0068856_100228100 3300005614 Bacteria 1878
125 Ga0068852_100001963 3300005616 Bacteria 14009
126 Ga0068852_100007355 3300005616 Bacteria 8035
127 Ga0068852_100032920 3300005616 Bacteria 4298
128 Ga0068859_100007139 3300005617 Bacteria 11340
129 Ga0068859_100031326 3300005617 Bacteria 5340
130 Ga0068859_100195064 3300005617 Bacteria 2109
131 Ga0068864_100103576 3300005618 Bacteria 2527
132 Ga0068861_100000535 3300005719 Bacteria 22271
133 Ga0068861_100001808 3300005719 Bacteria 13774
134 Ga0068851_10023454 3300005834 Bacteria 3017
135 Ga0068870_10001490 3300005840 Bacteria 9481
136 Ga0068870_10014916 3300005840 Bacteria 3678
137 Ga0068863_100058121 3300005841 Bacteria 3661
138 Ga0068863_100251577 3300005841 Bacteria 1707
139 Ga0068858_100127227 3300005842 Bacteria 2387
140 Ga0068858_100143756 3300005842 Unclassified 2240
141 Ga0068860_100002295 3300005843 Bacteria 20100
142 Ga0068862_100000532 3300005844 Bacteria 39799
143 Ga0068862_100053048 3300005844 Unclassified 3470
144 Ga0070716_100004299 3300006173 Bacteria 6786
145 Ga0097621_100132514 3300006237 Bacteria 2122
146 Ga0075430_100004127 3300006846 Bacteria 12254
147 Ga0075430_100031549 3300006846 Bacteria 4498
148 Ga0075430_100088947 3300006846 Bacteria 2584
149 Ga0075430_100101885 3300006846 Bacteria 2397
150 Ga0075431_100014088 3300006847 Bacteria 8083
151 Ga0075431_100019434 3300006847 Bacteria 6927
152 Ga0075431_100050851 3300006847 Bacteria 4273
153 Ga0075431_100253401 3300006847 Bacteria 1788
154 Ga0075433_10024595 3300006852 Bacteria 5086
155 Ga0075433_10126385 3300006852 Bacteria 2271
156 Ga0075434_100027070 3300006871 Bacteria 5627
157 Ga0075434_100194827 3300006871 Bacteria 2046
158 Ga0075429_100054986 3300006880 Bacteria 3463
159 Ga0075429_100175226 3300006880 Bacteria 1879
160 Ga0075436_100003583 3300006914 Bacteria 10636
161 Ga0075436_100014035 3300006914 Bacteria 5482
162 Ga0075436_100019708 3300006914 Bacteria 4624
163 Ga0097620_100007139 3300006931 Bacteria 11340
164 Ga0097620_100031326 3300006931 Bacteria 5340
165 Ga0097620_100195043 3300006931 Bacteria 2109
166 Ga0105240_10011967 3300009093 Bacteria 12026
167 Ga0105240_10080676 3300009093 Bacteria 4000
168 Ga0105240_10108426 3300009093 Bacteria 3364
169 Ga0105240_10141662 3300009093 Bacteria 2874
170 Ga0111539_10013257 3300009094 Bacteria 10305
171 Ga0111539_10020801 3300009094 Bacteria 8078
172 Ga0111539_10036871 3300009094 Bacteria 5908
173 Ga0105245_10318016 3300009098 Bacteria 1532
174 Ga0114129_10115096 3300009147 Bacteria 3707
175 Ga0114129_10576279 3300009147 Bacteria 1461
176 Ga0105241_10000115 3300009174 Bacteria 57755
177 Ga0105241_10119042 3300009174 Bacteria 2124
178 Ga0105241_10145746 3300009174 Bacteria 1932
179 Ga0105242_10002654 3300009176 Bacteria 14019
180 Ga0105242_10090986 3300009176 Unclassified 2568
181 Ga0105248_10010988 3300009177 Bacteria 9990
182 Ga0105248_10068390 3300009177 Bacteria 3988
183 Ga0105248_10128693 3300009177 Bacteria 2857
184 Ga0105248_10164755 3300009177 Bacteria 2499
185 Ga0105248_10253736 3300009177 Bacteria 1980
186 Ga0105237_10080013 3300009545 Bacteria 3258
187 Ga0105237_10122349 3300009545 Bacteria 2596
188 Ga0105238_10011818 3300009551 Bacteria 8796
189 Ga0105238_10015545 3300009551 Bacteria 7706
190 Ga0105249_10000075 3300009553 Bacteria 145150
191 Ga0105249_10000101 3300009553 Bacteria 119072
192 Ga0105249_10003487 3300009553 Bacteria 13628
193 Ga0105249_10118062 3300009553 Unclassified 2517
194 Ga0105239_10009090 3300010375 Bacteria 11242
195 Ga0157373_10002813 3300013100 Bacteria 13159
196 Ga0157373_10019845 3300013100 Bacteria 4890
197 Ga0157371_10005758 3300013102 Bacteria 10383
198 Ga0157370_10019271 3300013104 Bacteria 6849
199 Ga0157370_10023711 3300013104 Bacteria 6090
200 Ga0157370_10026083 3300013104 Bacteria 5774
201 Ga0157370_10026300 3300013104 Bacteria 5747
202 Ga0157370_10030055 3300013104 Bacteria 5325
203 Ga0157370_10034985 3300013104 Bacteria 4887
204 Ga0157369_10002043 3300013105 Bacteria 24342
205 Ga0157369_10027614 3300013105 Bacteria 6288
206 Ga0157369_10053064 3300013105 Bacteria 4382
207 Ga0157369_10054826 3300013105 Bacteria 4304
208 Ga0157369_10058483 3300013105 Bacteria 4158
209 Ga0157369_10076593 3300013105 Bacteria 3585
210 Ga0157369_10106363 3300013105 Bacteria 2986
211 Ga0157369_10242600 3300013105 Bacteria 1882
212 Ga0157374_10013301 3300013296 Bacteria 7180
213 Ga0163162_10005049 3300013306 Bacteria 12716
214 Ga0163162_10020911 3300013306 Bacteria 6436
215 Ga0163162_10061226 3300013306 Bacteria 3801
216 Ga0163162_10424803 3300013306 Bacteria 1461
217 Ga0157372_10003023 3300013307 Bacteria 18132
218 Ga0157372_10003946 3300013307 Bacteria 15931
219 Ga0157372_10031157 3300013307 Bacteria 5838
220 Ga0157372_10069479 3300013307 Bacteria 3961
221 Ga0157372_10069516 3300013307 Bacteria 3960
222 Ga0157372_10078514 3300013307 Bacteria 3730
223 Ga0157372_10081218 3300013307 Bacteria 3669
224 Ga0157372_10187844 3300013307 Bacteria 2393
225 Ga0157372_10240858 3300013307 Bacteria 2099
226 Ga0157375_10044097 3300013308 Bacteria 4329
227 Ga0157375_10137741 3300013308 Bacteria 2566
228 Ga0163163_10074601 3300014325 Bacteria 3384
229 Ga0157380_10031126 3300014326 Bacteria 4094
230 Ga0157380_10074512 3300014326 Bacteria 2756
231 Ga0182008_10002321 3300014497 Bacteria 11987
232 Ga0157379_10004256 3300014968 Bacteria 12220
233 Ga0157376_10049272 3300014969 Bacteria 3488
234 Ga0213876_10015034 3300021384 Bacteria 4102
235 Ga0228598_1013745 3300024227 Unclassified 1602
236 Ga0207656_10021592 3300025321 Unclassified 2574
237 Ga0207656_10049251 3300025321 Bacteria 1816
238 Ga0207680_10049704 3300025903 Bacteria 2497
239 Ga0207645_10000294 3300025907 Bacteria 41976
240 Ga0207645_10024029 3300025907 Bacteria 3955
241 Ga0207643_10001203 3300025908 Bacteria 15301
242 Ga0207643_10001307 3300025908 Bacteria 14505
243 Ga0207705_10008095 3300025909 Bacteria 7701
244 Ga0207705_10021789 3300025909 Bacteria 4572
245 Ga0207705_10028625 3300025909 Bacteria 3971
246 Ga0207684_10111287 3300025910 Bacteria 2344
247 Ga0207654_10000390 3300025911 Bacteria 25502
248 Ga0207654_10115150 3300025911 Unclassified 1679
249 Ga0207707_10002005 3300025912 Bacteria 18476
250 Ga0207707_10003108 3300025912 Bacteria 14737
251 Ga0207707_10003388 3300025912 Bacteria 14152
252 Ga0207707_10015445 3300025912 Bacteria 6652
253 Ga0207707_10019380 3300025912 Bacteria 5938
254 Ga0207707_10035534 3300025912 Bacteria 4357
255 Ga0207707_10039520 3300025912 Bacteria 4123
256 Ga0207707_10055009 3300025912 Bacteria 3463
257 Ga0207707_10106096 3300025912 Unclassified 2456
258 Ga0207695_10005010 3300025913 Bacteria 17783
259 Ga0207695_10010327 3300025913 Bacteria 11432
260 Ga0207695_10014107 3300025913 Bacteria 9487
261 Ga0207695_10020165 3300025913 Bacteria 7644
262 Ga0207695_10053009 3300025913 Bacteria 4245
263 Ga0207695_10078722 3300025913 Bacteria 3344
264 Ga0207695_10160324 3300025913 Bacteria 2181
265 Ga0207663_10088512 3300025916 Bacteria 2048
266 Ga0207660_10002760 3300025917 Bacteria 11509
267 Ga0207660_10003903 3300025917 Bacteria 9718
268 Ga0207660_10010817 3300025917 Bacteria 5930
269 Ga0207660_10040000 3300025917 Bacteria 3280
270 Ga0207660_10068162 3300025917 Bacteria 2580
271 Ga0207660_10075330 3300025917 Bacteria 2465
272 Ga0207660_10086324 3300025917 Bacteria 2317
273 Ga0207662_10001571 3300025918 Bacteria 11178
274 Ga0207662_10050515 3300025918 Bacteria 2471
275 Ga0207657_10001581 3300025919 Bacteria 24468
276 Ga0207657_10023916 3300025919 Bacteria 5674
277 Ga0207657_10033338 3300025919 Bacteria 4643
278 Ga0207657_10051939 3300025919 Bacteria 3561
279 Ga0207657_10069463 3300025919 Bacteria 2989
280 Ga0207649_10006940 3300025920 Bacteria 6156
281 Ga0207649_10016840 3300025920 Bacteria 4134
282 Ga0207652_10004402 3300025921 Bacteria 11475
283 Ga0207652_10022273 3300025921 Bacteria 5240
284 Ga0207652_10025118 3300025921 Bacteria 4950
285 Ga0207652_10025756 3300025921 Bacteria 4894
286 Ga0207652_10040012 3300025921 Bacteria 3981
287 Ga0207652_10058013 3300025921 Bacteria 3335
288 Ga0207652_10129665 3300025921 Bacteria 2248
289 Ga0207652_10164175 3300025921 Bacteria 1991
290 Ga0207652_10257179 3300025921 Bacteria 1575
291 Ga0207652_10290726 3300025921 Unclassified 1474
292 Ga0207681_10002121 3300025923 Bacteria 12694
293 Ga0207681_10003187 3300025923 Bacteria 10297
294 Ga0207681_10009430 3300025923 Bacteria 5965
295 Ga0207681_10022812 3300025923 Bacteria 3996
296 Ga0207681_10139285 3300025923 Unclassified 1805
297 Ga0207694_10004995 3300025924 Bacteria 10262
298 Ga0207650_10005585 3300025925 Bacteria 8589
299 Ga0207659_10022344 3300025926 Bacteria 4212
300 Ga0207664_10010599 3300025929 Bacteria 6513
301 Ga0207664_10026650 3300025929 Bacteria 4371
302 Ga0207644_10062298 3300025931 Bacteria 2705
303 Ga0207644_10062684 3300025931 Bacteria 2698
304 Ga0207690_10107765 3300025932 Bacteria 2001
305 Ga0207690_10120705 3300025932 Unclassified 1903
306 Ga0207706_10000472 3300025933 Bacteria 43032
307 Ga0207706_10077595 3300025933 Bacteria 2921
308 Ga0207670_10036387 3300025936 Bacteria 3201
309 Ga0207704_10025563 3300025938 Bacteria 3223
310 Ga0207665_10000881 3300025939 Bacteria 20264
311 Ga0207665_10040264 3300025939 Bacteria 3117
312 Ga0207691_10000248 3300025940 Bacteria 53460
313 Ga0207691_10006091 3300025940 Bacteria 11657
314 Ga0207691_10009348 3300025940 Bacteria 9409
315 Ga0207691_10010004 3300025940 Bacteria 9106
316 Ga0207691_10017023 3300025940 Bacteria 6898
317 Ga0207691_10059546 3300025940 Bacteria 3472
318 Ga0207711_10021638 3300025941 Bacteria 5372
319 Ga0207711_10068237 3300025941 Bacteria 3079
320 Ga0207711_10099697 3300025941 Bacteria 2568
321 Ga0207689_10000810 3300025942 Bacteria 30206
322 Ga0207689_10085991 3300025942 Bacteria 2585
323 Ga0207689_10131715 3300025942 Bacteria 2058
324 Ga0207661_10006854 3300025944 Bacteria 8076
325 Ga0207661_10008147 3300025944 Bacteria 7478
326 Ga0207661_10010991 3300025944 Bacteria 6539
327 Ga0207661_10063328 3300025944 Bacteria 2995
328 Ga0207661_10130356 3300025944 Bacteria 2153
329 Ga0207661_10141977 3300025944 Bacteria 2067
330 Ga0207679_10002710 3300025945 Bacteria 10955
331 Ga0207679_10015334 3300025945 Bacteria 5061
332 Ga0207679_10164864 3300025945 Bacteria 1818
333 Ga0207667_10018113 3300025949 Bacteria 7906
334 Ga0207712_10000063 3300025961 Bacteria 133704
335 Ga0207712_10001640 3300025961 Bacteria 15074
336 Ga0207712_10001936 3300025961 Bacteria 13605
337 Ga0207668_10014134 3300025972 Bacteria 4937
338 Ga0207668_10033862 3300025972 Bacteria 3387
339 Ga0207640_10015126 3300025981 Bacteria 4459
340 Ga0207640_10089162 3300025981 Bacteria 2131
341 Ga0207640_10164618 3300025981 Bacteria 1645
342 Ga0207658_10029971 3300025986 Bacteria 3849
343 Ga0207658_10046283 3300025986 Bacteria 3176
344 Ga0207658_10147318 3300025986 Bacteria 1914
345 Ga0207658_10201451 3300025986 Unclassified 1662
346 Ga0207639_10033427 3300026041 Bacteria 3794
347 Ga0207639_10161039 3300026041 Bacteria 1891
348 Ga0207639_10254424 3300026041 Unclassified 1533
349 Ga0207678_10000331 3300026067 Bacteria 42428
350 Ga0207702_10018206 3300026078 Bacteria 5810
351 Ga0207702_10133016 3300026078 Bacteria 2240
352 Ga0207641_10064172 3300026088 Bacteria 3138
353 Ga0207641_10152207 3300026088 Bacteria 2096
354 Ga0207648_10016684 3300026089 Bacteria 6701
355 Ga0207648_10043005 3300026089 Bacteria 3967
356 Ga0207648_10064017 3300026089 Bacteria 3205
357 Ga0207676_10049043 3300026095 Bacteria 3282
358 Ga0207676_10268697 3300026095 Bacteria 1543
359 Ga0207674_10001081 3300026116 Bacteria 35413
360 Ga0207674_10002222 3300026116 Bacteria 24579
361 Ga0207674_10002802 3300026116 Bacteria 21703
362 Ga0207674_10010697 3300026116 Bacteria 10364
363 Ga0207674_10065696 3300026116 Bacteria 3656
364 Ga0207675_100000373 3300026118 Bacteria 43010
365 Ga0207675_100007831 3300026118 Bacteria 10081
366 Ga0207675_100083679 3300026118 Bacteria 2993
367 Ga0207698_10000550 3300026142 Bacteria 21788
368 Ga0207698_10002774 3300026142 Bacteria 10447
369 Ga0207698_10019143 3300026142 Bacteria 4680
370 Ga0207698_10021581 3300026142 Bacteria 4458
371 Ga0209995_1000320 3300027471 Bacteria 7528
372 Ga0209966_1005430 3300027695 Bacteria 2187
373 Ga0209998_10000343 3300027717 Bacteria 13759
374 Ga0209974_10005387 3300027876 Bacteria 4503
375 Ga0207428_10048070 3300027907 Bacteria 3424
376 Ga0207428_10209212 3300027907 Bacteria 1466
377 Ga0268266_10106130 3300028379 Bacteria 2483
378 Ga0268265_10002731 3300028380 Bacteria 13047
379 Ga0268265_10007702 3300028380 Bacteria 7266
380 Ga0268264_10043664 3300028381 Bacteria 3716
381 Ga0307408_100002025 3300031548 Bacteria 14622
382 Ga0307408_100011025 3300031548 Bacteria 5964
383 Ga0307408_100144753 3300031548 Bacteria 1869
384 Ga0307408_100176804 3300031548 Bacteria 1708
385 Ga0316579_10004684 3300031691 Bacteria 5452
386 Ga0265314_10012641 3300031711 Bacteria 6871
387 Ga0316576_10071051 3300031727 Bacteria 2567
388 Ga0316578_10002880 3300031728 Bacteria 7699
389 Ga0307405_10061158 3300031731 Bacteria 2379
390 Ga0316577_10001368 3300031733 Bacteria 11479
391 Ga0316577_10003147 3300031733 Bacteria 8293
392 Ga0307413_10092402 3300031824 Bacteria 1975
393 Ga0307410_10014301 3300031852 Bacteria 4666
394 Ga0307410_10059829 3300031852 Bacteria 2601
395 Ga0307406_10008031 3300031901 Bacteria 5875
396 Ga0307406_10025378 3300031901 Bacteria 3548
397 Ga0307407_10003734 3300031903 Bacteria 6321
398 Ga0307407_10030214 3300031903 Bacteria 2921
399 Ga0307412_10012260 3300031911 Bacteria 4991
400 Ga0307409_100001251 3300031995 Bacteria 12253
401 Ga0307409_100011769 3300031995 Bacteria 5537
402 Ga0307409_100053360 3300031995 Bacteria 3106
403 Ga0307409_100089094 3300031995 Bacteria 2521
404 Ga0307416_100004336 3300032002 Bacteria 8532
405 Ga0307416_100010766 3300032002 Bacteria 6060
406 Ga0307416_100082771 3300032002 Bacteria 2720
407 Ga0307416_100233800 3300032002 Bacteria 1774
408 Ga0307411_10001448 3300032005 Bacteria 9704
409 Ga0307411_10183376 3300032005 Bacteria 1591
410 Ga0307415_100003082 3300032126 Bacteria 8416
411 Ga0307415_100003236 3300032126 Bacteria 8263
412 Ga0307415_100070231 3300032126 Bacteria 2459
413 Ga0307415_100212010 3300032126 Bacteria 1546
414 Ga0373960_0019476 3300035121 Bacteria 1783
415 Ga0373955_0000467 3300035172 Bacteria 17081
416 Ga0373955_0005052 3300035172 Bacteria 5901
417 Ga0373942_0006638 3300035207 Bacteria 2673
418 Ga0316574_0130687 3300035398 Bacteria 1616
419 Ga0373933_0011610 3300035724 Bacteria 4860
420 Ga0373947_0062506 3300035725 Bacteria 2266
421 Ga0373937_0002823 3300036401 Bacteria 14518
422 Ga0373937_0123323 3300036401 Bacteria 2416
423 Ga0316584_0012282 3300036712 Bacteria 6038
424 Ga0316584_0171118 3300036712 Unclassified 1611
425 Ga0373925_0071488 3300037068 Bacteria 2624
426 Ga0395899_0018705 3300037312 Bacteria 5265
427 Ga0395900_0091487 3300037418 Bacteria 3126
428 Ga0395898_0099941 3300037466 Bacteria 2786
429 Ga0316581_0016719 3300037588 Bacteria 2109
430 Ga0395901_0006561 3300038443 Bacteria 11765
431 Ga0436365_0566690 3300039437 Bacteria 27032
432 Ga0439439_0021743 3300041406 Bacteria 1599
433 Ga0439434_0010450 3300042435 Bacteria 2735
434 Ga0439434_0010957 3300042435 Bacteria 2679
435 Ga0453683_0013357 3300044673 Bacteria 5366
436 Ga0466963_0137720 3300044694 Unclassified 1690
437 Ga0466959_0075443 3300045049 Bacteria 2436
438 Ga0466959_0130221 3300045049 Bacteria 1783
439 Ga0466967_0017890 3300045976 Bacteria 5647
440 Ga0495592_0055967 3300046454 Bacteria 2916
441 Ga0495629_0077382 3300046459 Bacteria 2322
442 Ga0495629_0105338 3300046459 Bacteria 1967
443 Ga0495651_0021243 3300046462 Bacteria 5045
444 Ga0495653_0022819 3300046463 Bacteria 5062
445 Ga0495653_0110832 3300046463 Bacteria 1972
446 Ga0495580_0008944 3300046472 Bacteria 7918
447 Ga0495662_0033653 3300046476 Bacteria 2476
448 Ga0495608_0004117 3300046511 Bacteria 10423
449 Ga0495628_0017468 3300046516 Bacteria 5973
450 Ga0495630_0012502 3300046517 Bacteria 6165
451 Ga0495630_0020768 3300046517 Bacteria 4845
452 Ga0495652_0043977 3300046529 Bacteria 3847
453 Ga0495652_0052866 3300046529 Bacteria 3463
454 Ga0495665_0051443 3300046531 Bacteria 2182
455 Ga0495586_0002862 3300046535 Bacteria 9324
456 Ga0495586_0020143 3300046535 Bacteria 3553
457 Ga0495586_0062889 3300046535 Bacteria 2021
458 Ga0495587_0004678 3300046536 Bacteria 8989
459 Ga0495587_0028061 3300046536 Bacteria 3427
460 Ga0495621_0002663 3300046539 Bacteria 4831
461 Ga0495645_0004165 3300046543 Bacteria 9883
462 Ga0495645_0033114 3300046543 Bacteria 3770
463 Ga0495645_0071933 3300046543 Bacteria 2493
464 Ga0495645_0189715 3300046543 Bacteria 1402
465 Ga0495667_0060063 3300046559 Bacteria 2494
466 Ga0495657_0010758 3300046675 Bacteria 6873
467 Ga0495657_0159501 3300046675 Bacteria 1396
468 Ga0495599_0068228 3300046678 Bacteria 2220
469 Ga0495599_0116870 3300046678 Bacteria 1659
470 Ga0495623_0013945 3300046679 Bacteria 5210
471 Ga0495623_0087356 3300046679 Bacteria 1921
472 Ga0495613_0025753 3300046689 Bacteria 4383
473 Ga0495600_0010933 3300046809 Bacteria 5645
474 Ga0495581_0023828 3300047315 Bacteria 3547
475 Ga0495674_0040725 3300047319 Bacteria 4153
476 Ga0495672_0005103 3300047320 Bacteria 10482
477 Ga0495675_0003445 3300047444 Bacteria 9530
478 Ga0495684_0016783 3300047471 Bacteria 5642
479 Ga0495593_0099070 3300047673 Bacteria 1496
480 Ga0496100_0043601 3300048903 Bacteria 2870
481 Ga0496109_0011666 3300048912 Bacteria 7557
482 Ga0496109_0023629 3300048912 Bacteria 5457
483 Ga0496112_0002617 3300048915 Bacteria 14532
484 Ga0496112_0086398 3300048915 Bacteria 3103
485 Ga0496112_0110874 3300048915 Bacteria 2714
486 Ga0496112_0167508 3300048915 Bacteria 2163
487 Ga0496115_0000615 3300048918 Bacteria 27047
488 Ga0501031_0200118 3300049568 Bacteria 1303
489 Ga0501033_0024735 3300049570 Bacteria 4528
490 Ga0501033_0127137 3300049570 Bacteria 1848
491 Ga0501034_0006077 3300049571 Bacteria 13034
492 Ga0501034_0052943 3300049571 Bacteria 4089
493 Ga0501036_0157040 3300049572 Bacteria 1918
494 Ga0501046_0184752 3300049580 Bacteria 1557
495 Ga0501075_0202277 3300049591 Bacteria 1515
496 Ga0501076_0162768 3300049592 Bacteria 1818
497 Ga0501076_0180488 3300049592 Bacteria 1721
498 Ga0501198_003037 3300049649 Bacteria 2284
499 Ga0501202_001560 3300049652 Bacteria 3695
500 Ga0501224_001138 3300049664 Bacteria 3470
501 Ga0501235_000757 3300049669 Bacteria 6581
502 Ga0501242_002647 3300049674 Bacteria 1896
503 Ga0501225_0007566 3300049705 Bacteria 3147
504 Ga0501262_001058 3300049759 Bacteria 3119
505 Ga0501266_003973 3300049763 Bacteria 1829
506 Ga0501268_000173 3300049765 Bacteria 5988
507 Ga0501045_0027354 3300049824 Bacteria 4109
508 nmdc:mga09592_25324_c1 3300050508 Bacteria 4910
509 nmdc:mga0qj67_13821_c1 3300050509 Bacteria 6094
510 nmdc:mga0qj67_26934_c1 3300050509 Bacteria 4452
511 nmdc:mga0qj67_96888_c1 3300050509 Bacteria 2375
512 nmdc:mga06r32_173404_c1 3300050510 Bacteria 2141
513 nmdc:mga06r32_175363_c1 3300050510 Bacteria 2128
514 nmdc:mga06r32_98147_c1 3300050510 Bacteria 2871
515 nmdc:mga08y16_29810_c1 3300050511 Bacteria 5745
516 nmdc:mga08y16_38442_c1 3300050511 Bacteria 5025
517 nmdc:mga08y16_48370_c1 3300050511 Bacteria 4451
518 nmdc:mga0n895_11757_c1 3300050512 Bacteria 7824
519 nmdc:mga0rr50_210520_c1 3300050513 Bacteria 1601
520 nmdc:mga0a205_16311_c1 3300050515 Bacteria 6956
521 nmdc:mga0a205_19503_c1 3300050515 Bacteria 6394
522 Ga0495619_0081807 3300053085 Bacteria 2175
523 Ga0070681_10016627
524 Ga0058863_11584584
525 Ga0065707_10095578
526 Ga0070658_10002403
527 Ga0070658_10008160
528 Ga0070658_10161401
529 Ga0070676_10001662
530 Ga0070676_10005255
531 Ga0070683_100001613
532 Ga0070683_100002037
533 Ga0070683_100007371
534 Ga0070683_100029092
535 Ga0070683_100034706
536 Ga0070683_100042083
537 Ga0070683_100042311
538 Ga0070683_100043331
539 Ga0070683_100047013
540 Ga0070683_100050211
541 Ga0070683_100071033
542 Ga0070683_100193074
543 Ga0070683_100245685
544 Ga0070690_100043074
545 Ga0070670_100001462
546 Ga0068869_100045567
547 Ga0070680_100000032
548 Ga0070680_100004132
549 Ga0070680_100049557
550 Ga0070680_100075485
551 Ga0070660_100020559
552 Ga0070660_100060949
553 Ga0070687_100024714
554 Ga0070661_100002247
555 Ga0070661_100012309
556 Ga0070661_100018173
557 Ga0070661_100038473
558 Ga0070661_100084147
559 Ga0070668_100000787
560 Ga0070668_100004688
561 Ga0070668_100033279
562 Ga0070669_100002444
563 Ga0070669_100020098
564 Ga0070669_100084982
565 Ga0070675_100020842
566 Ga0070675_100029943
567 Ga0070675_100031152
568 Ga0070671_100029664
569 Ga0070671_100082901
570 Ga0070673_100054149
571 Ga0070688_100045988
572 Ga0070688_100070486
573 Ga0070659_100029355
574 Ga0070659_100223833
575 Ga0070667_100012957
576 Ga0070667_100013393
577 Ga0070667_100030053
578 Ga0070709_10054043
579 Ga0070714_100001686
580 Ga0070714_100016004
581 Ga0070714_100016220
582 Ga0070714_100113813
583 Ga0070713_100003194
584 Ga0070700_100054038
585 Ga0070694_100014822
586 Ga0070694_100024950
587 Ga0070694_100042490
588 Ga0070708_100001746
589 Ga0070663_100011715
590 Ga0070663_100011838
591 Ga0070662_100023950
592 Ga0070662_100155098
593 Ga0070681_10002927
594 Ga0070681_10004944
595 Ga0070681_10008476
596 Ga0070681_10011090
597 Ga0070681_10017337
598 Ga0068867_100108350
599 Ga0070685_10029149
600 Ga0070706_100071733
601 Ga0070706_100256651
602 Ga0070707_100130040
603 Ga0070698_100001779
604 Ga0070698_100073028
605 Ga0070699_100120449
606 Ga0070679_100000420
607 Ga0070679_100002414
608 Ga0070679_100003040
609 Ga0070679_100005364
610 Ga0070679_100020914
611 Ga0070679_100032801
612 Ga0070679_100041803
613 Ga0070679_100091743
614 Ga0070679_100150961
615 Ga0070684_100002344
616 Ga0070684_100007441
617 Ga0070684_100017228
618 Ga0070684_100025320
619 Ga0070684_100050584
620 Ga0070684_100060926
621 Ga0070684_100077274
622 Ga0068853_100002180
623 Ga0068853_100114411
624 Ga0070672_100008057
625 Ga0070672_100015900
626 Ga0070672_100093554
627 Ga0070672_100094962
628 Ga0070672_100099918
629 Ga0070672_100132635
630 Ga0070696_100085250
631 Ga0070696_100120205
632 Ga0068855_100023666
633 Ga0068855_100042600
634 Ga0070664_100002537
635 Ga0070664_100003554
636 Ga0070664_100004984
637 Ga0070664_100055492
638 Ga0068857_100002675
639 Ga0068857_100002944
640 Ga0068857_100052712
641 Ga0068854_100019620
642 Ga0068854_100028354
643 Ga0068854_100128835
644 Ga0068856_100009523
645 Ga0068856_100052401
646 Ga0068856_100228100
647 Ga0068852_100001963
648 Ga0068852_100007355
649 Ga0068852_100032920
650 Ga0068859_100007139
651 Ga0068859_100031326
652 Ga0068859_100195064
653 Ga0068864_100103576
654 Ga0068861_100000535
655 Ga0068861_100001808
656 Ga0068851_10023454
657 Ga0068870_10001490
658 Ga0068870_10014916
659 Ga0068863_100058121
660 Ga0068863_100251577
661 Ga0068858_100127227
662 Ga0068858_100143756
663 Ga0068860_100002295
664 Ga0068862_100000532
665 Ga0068862_100053048
666 Ga0070716_100004299
667 Ga0097621_100132514
668 Ga0075430_100004127
669 Ga0075430_100031549
670 Ga0075430_100088947
671 Ga0075430_100101885
672 Ga0075431_100014088
673 Ga0075431_100019434
674 Ga0075431_100050851
675 Ga0075431_100253401
676 Ga0075433_10024595
677 Ga0075433_10126385
678 Ga0075434_100027070
679 Ga0075434_100194827
680 Ga0075429_100054986
681 Ga0075429_100175226
682 Ga0075436_100003583
683 Ga0075436_100014035
684 Ga0075436_100019708
685 Ga0097620_100007139
686 Ga0097620_100031326
687 Ga0097620_100195043
688 Ga0105240_10011967
689 Ga0105240_10080676
690 Ga0105240_10108426
691 Ga0105240_10141662
692 Ga0111539_10013257
693 Ga0111539_10020801
694 Ga0111539_10036871
695 Ga0105245_10318016
696 Ga0114129_10115096
697 Ga0114129_10576279
698 Ga0105241_10000115
699 Ga0105241_10119042
700 Ga0105241_10145746
701 Ga0105242_10002654
702 Ga0105242_10090986
703 Ga0105248_10010988
704 Ga0105248_10068390
705 Ga0105248_10128693
706 Ga0105248_10164755
707 Ga0105248_10253736
708 Ga0105237_10080013
709 Ga0105237_10122349
710 Ga0105238_10011818
711 Ga0105238_10015545
712 Ga0105249_10000075
713 Ga0105249_10000101
714 Ga0105249_10003487
715 Ga0105249_10118062
716 Ga0105239_10009090
717 Ga0157373_10002813
718 Ga0157373_10019845
719 Ga0157371_10005758
720 Ga0157370_10019271
721 Ga0157370_10023711
722 Ga0157370_10026083
723 Ga0157370_10026300
724 Ga0157370_10030055
725 Ga0157370_10034985
726 Ga0157369_10002043
727 Ga0157369_10027614
728 Ga0157369_10053064
729 Ga0157369_10054826
730 Ga0157369_10058483
731 Ga0157369_10076593
732 Ga0157369_10106363
733 Ga0157369_10242600
734 Ga0157374_10013301
735 Ga0163162_10005049
736 Ga0163162_10020911
737 Ga0163162_10061226
738 Ga0163162_10424803
739 Ga0157372_10003023
740 Ga0157372_10003946
741 Ga0157372_10031157
742 Ga0157372_10069479
743 Ga0157372_10069516
744 Ga0157372_10078514
745 Ga0157372_10081218
746 Ga0157372_10187844
747 Ga0157372_10240858
748 Ga0157375_10044097
749 Ga0157375_10137741
750 Ga0163163_10074601
751 Ga0157380_10031126
752 Ga0157380_10074512
753 Ga0182008_10002321
754 Ga0157379_10004256
755 Ga0157376_10049272
756 Ga0213876_10015034
757 Ga0228598_1013745
758 Ga0207656_10021592
759 Ga0207656_10049251
760 Ga0207680_10049704
761 Ga0207645_10000294
762 Ga0207645_10024029
763 Ga0207643_10001203
764 Ga0207643_10001307
765 Ga0207705_10008095
766 Ga0207705_10021789
767 Ga0207705_10028625
768 Ga0207684_10111287
769 Ga0207654_10000390
770 Ga0207654_10115150
771 Ga0207707_10002005
772 Ga0207707_10003108
773 Ga0207707_10003388
774 Ga0207707_10015445
775 Ga0207707_10019380
776 Ga0207707_10035534
777 Ga0207707_10039520
778 Ga0207707_10055009
779 Ga0207707_10106096
780 Ga0207695_10005010
781 Ga0207695_10010327
782 Ga0207695_10014107
783 Ga0207695_10020165
784 Ga0207695_10053009
785 Ga0207695_10078722
786 Ga0207695_10160324
787 Ga0207663_10088512
788 Ga0207660_10002760
789 Ga0207660_10003903
790 Ga0207660_10010817
791 Ga0207660_10040000
792 Ga0207660_10068162
793 Ga0207660_10075330
794 Ga0207660_10086324
795 Ga0207662_10001571
796 Ga0207662_10050515
797 Ga0207657_10001581
798 Ga0207657_10023916
799 Ga0207657_10033338
800 Ga0207657_10051939
801 Ga0207657_10069463
802 Ga0207649_10006940
803 Ga0207649_10016840
804 Ga0207652_10004402
805 Ga0207652_10022273
806 Ga0207652_10025118
807 Ga0207652_10025756
808 Ga0207652_10040012
809 Ga0207652_10058013
810 Ga0207652_10129665
811 Ga0207652_10164175
812 Ga0207652_10257179
813 Ga0207652_10290726
814 Ga0207681_10002121
815 Ga0207681_10003187
816 Ga0207681_10009430
817 Ga0207681_10022812
818 Ga0207681_10139285
819 Ga0207694_10004995
820 Ga0207650_10005585
821 Ga0207659_10022344
822 Ga0207664_10010599
823 Ga0207664_10026650
824 Ga0207644_10062298
825 Ga0207644_10062684
826 Ga0207690_10107765
827 Ga0207690_10120705
828 Ga0207706_10000472
829 Ga0207706_10077595
830 Ga0207670_10036387
831 Ga0207704_10025563
832 Ga0207665_10000881
833 Ga0207665_10040264
834 Ga0207691_10000248
835 Ga0207691_10006091
836 Ga0207691_10009348
837 Ga0207691_10010004
838 Ga0207691_10017023
839 Ga0207691_10059546
840 Ga0207711_10021638
841 Ga0207711_10068237
842 Ga0207711_10099697
843 Ga0207689_10000810
844 Ga0207689_10085991
845 Ga0207689_10131715
846 Ga0207661_10006854
847 Ga0207661_10008147
848 Ga0207661_10010991
849 Ga0207661_10063328
850 Ga0207661_10130356
851 Ga0207661_10141977
852 Ga0207679_10002710
853 Ga0207679_10015334
854 Ga0207679_10164864
855 Ga0207667_10018113
856 Ga0207712_10000063
857 Ga0207712_10001640
858 Ga0207712_10001936
859 Ga0207668_10014134
860 Ga0207668_10033862
861 Ga0207640_10015126
862 Ga0207640_10089162
863 Ga0207640_10164618
864 Ga0207658_10029971
865 Ga0207658_10046283
866 Ga0207658_10147318
867 Ga0207658_10201451
868 Ga0207639_10033427
869 Ga0207639_10161039
870 Ga0207639_10254424
871 Ga0207678_10000331
872 Ga0207702_10018206
873 Ga0207702_10133016
874 Ga0207641_10064172
875 Ga0207641_10152207
876 Ga0207648_10016684
877 Ga0207648_10043005
878 Ga0207648_10064017
879 Ga0207676_10049043
880 Ga0207676_10268697
881 Ga0207674_10001081
882 Ga0207674_10002222
883 Ga0207674_10002802
884 Ga0207674_10010697
885 Ga0207674_10065696
886 Ga0207675_100000373
887 Ga0207675_100007831
888 Ga0207675_100083679
889 Ga0207698_10000550
890 Ga0207698_10002774
891 Ga0207698_10019143
892 Ga0207698_10021581
893 Ga0209995_1000320
894 Ga0209966_1005430
895 Ga0209998_10000343
896 Ga0209974_10005387
897 Ga0207428_10048070
898 Ga0207428_10209212
899 Ga0268266_10106130
900 Ga0268265_10002731
901 Ga0268265_10007702
902 Ga0268264_10043664
903 Ga0307408_100002025
904 Ga0307408_100011025
905 Ga0307408_100144753
906 Ga0307408_100176804
907 Ga0316579_10004684
908 Ga0265314_10012641
909 Ga0316576_10071051
910 Ga0316578_10002880
911 Ga0307405_10061158
912 Ga0316577_10001368
913 Ga0316577_10003147
914 Ga0307413_10092402
915 Ga0307410_10014301
916 Ga0307410_10059829
917 Ga0307406_10008031
918 Ga0307406_10025378
919 Ga0307407_10003734
920 Ga0307407_10030214
921 Ga0307412_10012260
922 Ga0307409_100001251
923 Ga0307409_100011769
924 Ga0307409_100053360
925 Ga0307409_100089094
926 Ga0307416_100004336
927 Ga0307416_100010766
928 Ga0307416_100082771
929 Ga0307416_100233800
930 Ga0307411_10001448
931 Ga0307411_10183376
932 Ga0307415_100003082
933 Ga0307415_100003236
934 Ga0307415_100070231
935 Ga0307415_100212010
936 Ga0373960_0019476
937 Ga0373955_0000467
938 Ga0373955_0005052
939 Ga0373942_0006638
940 Ga0316574_0130687
941 Ga0373933_0011610
942 Ga0373947_0062506
943 Ga0373937_0002823
944 Ga0373937_0123323
945 Ga0316584_0012282
946 Ga0316584_0171118
947 Ga0373925_0071488
948 Ga0395899_0018705
949 Ga0395900_0091487
950 Ga0395898_0099941
951 Ga0316581_0016719
952 Ga0395901_0006561
953 Ga0436365_0566690
954 Ga0439439_0021743
955 Ga0439434_0010450
956 Ga0439434_0010957
957 Ga0453683_0013357
958 Ga0466963_0137720
959 Ga0466959_0075443
960 Ga0466959_0130221
961 Ga0466967_0017890
962 Ga0495592_0055967
963 Ga0495629_0077382
964 Ga0495629_0105338
965 Ga0495651_0021243
966 Ga0495653_0022819
967 Ga0495653_0110832
968 Ga0495580_0008944
969 Ga0495662_0033653
970 Ga0495608_0004117
971 Ga0495628_0017468
972 Ga0495630_0012502
973 Ga0495630_0020768
974 Ga0495652_0043977
975 Ga0495652_0052866
976 Ga0495665_0051443
977 Ga0495586_0002862
978 Ga0495586_0020143
979 Ga0495586_0062889
980 Ga0495587_0004678
981 Ga0495587_0028061
982 Ga0495621_0002663
983 Ga0495645_0004165
984 Ga0495645_0033114
985 Ga0495645_0071933
986 Ga0495645_0189715
987 Ga0495667_0060063
988 Ga0495657_0010758
989 Ga0495657_0159501
990 Ga0495599_0068228
991 Ga0495599_0116870
992 Ga0495623_0013945
993 Ga0495623_0087356
994 Ga0495613_0025753
995 Ga0495600_0010933
996 Ga0495581_0023828
997 Ga0495674_0040725
998 Ga0495672_0005103
999 Ga0495675_0003445
1000 Ga0495684_0016783
1001 Ga0495593_0099070
1002 Ga0496100_0043601
1003 Ga0496109_0011666
1004 Ga0496109_0023629
1005 Ga0496112_0002617
1006 Ga0496112_0086398
1007 Ga0496112_0110874
1008 Ga0496112_0167508
1009 Ga0496115_0000615
1010 Ga0501031_0200118
1011 Ga0501033_0024735
1012 Ga0501033_0127137
1013 Ga0501034_0006077
1014 Ga0501034_0052943
1015 Ga0501036_0157040
1016 Ga0501046_0184752
1017 Ga0501075_0202277
1018 Ga0501076_0162768
1019 Ga0501076_0180488
1020 Ga0501198_003037
1021 Ga0501202_001560
1022 Ga0501224_001138
1023 Ga0501235_000757
1024 Ga0501242_002647
1025 Ga0501225_0007566
1026 Ga0501262_001058
1027 Ga0501266_003973
1028 Ga0501268_000173
1029 Ga0501045_0027354
1030 nmdc:mga09592_25324_c1
1031 nmdc:mga0qj67_13821_c1
1032 nmdc:mga0qj67_26934_c1
1033 nmdc:mga0qj67_96888_c1
1034 nmdc:mga06r32_173404_c1
1035 nmdc:mga06r32_175363_c1
1036 nmdc:mga06r32_98147_c1
1037 nmdc:mga08y16_29810_c1
1038 nmdc:mga08y16_38442_c1
1039 nmdc:mga08y16_48370_c1
1040 nmdc:mga0n895_11757_c1
1041 nmdc:mga0rr50_210520_c1
1042 nmdc:mga0a205_16311_c1
1043 nmdc:mga0a205_19503_c1
1044 Ga0495619_0081807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

245

406

0.96

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

134

503

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zof-assembly1.cif.gz_B crystal structure of mouse carnosinase cn2 complexed with mn and bestatin 0.9254 7 457
4g1p-assembly1.cif.gz_A-2 structural and mechanistic basis of substrate recognition by novel di-peptidase dug1p from saccharomyces cerevisiae 0.921 5 457
3dlj-assembly3.cif.gz_A crystal structure of human carnosine dipeptidase 1 0.9151 2 457
3dlj-assembly3.cif.gz_B crystal structure of human carnosine dipeptidase 1 0.9081 6 457
2zof-assembly1.cif.gz_B crystal structure of mouse carnosinase cn2 complexed with mn and bestatin 0.9023 7 457
ID Description Score Start End Superfamily
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.915 18 457 3.40.630.10
4ruhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9032 4 457 3.40.630.10
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8987 18 457 3.40.630.10
4ruhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8913 4 457 3.40.630.10
5xoyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8816 18 457 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A4Q0M971-F1-model_v4 Dipeptidase 0.9804 4 457 GO:0016787
AF-A0A3D4YRV1-F1-model_v4 Dipeptidase 0.9781 1 352 GO:0016787
AF-A0A1Z9KK64-F1-model_v4 deleted 0.9767 4 457
AF-A0A4Q3TWI8-F1-model_v4 deleted 0.9767 46 457
AF-A0A4Q3DWH6-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9765 153 462 GO:0016787

Map