F458672

General Info

Members Datasets Scaffolds Average Seq Length
521 216 1042 166

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100529884|Ga0068859_1005298841
Length 192
Sequence MRRHYEGHFRQTSVRLQTLEPFFFFDMNVFVINALVSFFAALVLHELGHYFAARLCAVPIKQAGIGWGPKLFGVRVNSVDWHVRLFPIGAYVQMDMTALQRRPLWQQLLVLGAGIGVNLVLCVLTWGSLFGALNLALAIGNLIPLYQLDGWKSGMVIVRRMFGRPSPVAEWSLTLGGGAIALAVLVRALLNI

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
168 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
169 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
170 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
171 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
172 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
173 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
174 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
175 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
176 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
179 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
180 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
181 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
184 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
185 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
186 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
187 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
188 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
189 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
190 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
191 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
194 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
197 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
200 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
201 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
202 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
203 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
204 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
205 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
208 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
209 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.69
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 17.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100529884 3300005617 Bacteria 1273
2 MBSR1b_contig_6182337 2162886012 Unclassified 854
3 MBSR1b_contig_8296271 2162886012 Bacteria 962
4 CNAas_1000813 3300000532 Bacteria 2966
5 JGI24751J29686_10000094 3300002459 Bacteria 49568
6 JGI24751J29686_10000191 3300002459 Bacteria 27160
7 JGI25406J46586_10002534 3300003203 Bacteria 8646
8 rootL2_10010078 3300003322 Unclassified 2276
9 Ga0065714_10090016 3300005288 Bacteria 1959
10 Ga0065714_10107832 3300005288 Bacteria 1525
11 Ga0065712_10000026 3300005290 Bacteria 2499
12 Ga0065712_10000150 3300005290 Bacteria 45182
13 Ga0065712_10011835 3300005290 Bacteria 2574
14 Ga0065712_10014351 3300005290 Bacteria 2904
15 Ga0065712_10188864 3300005290 Unclassified 1157
16 Ga0065715_10003027 3300005293 Bacteria 4596
17 Ga0065715_10006857 3300005293 Bacteria 2992
18 Ga0065715_10089167 3300005293 Bacteria 13256
19 Ga0065715_10092978 3300005293 Bacteria 4853
20 Ga0065715_10134192 3300005293 Bacteria 1959
21 Ga0065707_10001430 3300005295 Bacteria 17678
22 Ga0065707_10228099 3300005295 Bacteria 1195
23 Ga0070676_10467751 3300005328 Unclassified 890
24 Ga0070690_100048424 3300005330 Bacteria 2707
25 Ga0070670_100000114 3300005331 Bacteria 75910
26 Ga0070670_100027344 3300005331 Bacteria 4907
27 Ga0070670_100155741 3300005331 Bacteria 1978
28 Ga0070670_100511439 3300005331 Bacteria 1069
29 Ga0068869_100161045 3300005334 Bacteria 1747
30 Ga0068869_100221870 3300005334 Bacteria 1499
31 Ga0068869_100487709 3300005334 Bacteria 1027
32 Ga0068869_100524397 3300005334 Unclassified 992
33 Ga0068869_100916520 3300005334 Bacteria 759
34 Ga0070680_100809308 3300005336 Bacteria 807
35 Ga0070682_100007620 3300005337 Bacteria 6098
36 Ga0070682_100171707 3300005337 Bacteria 1507
37 Ga0070660_100992516 3300005339 Bacteria 709
38 Ga0070689_100001291 3300005340 Bacteria 15949
39 Ga0070689_100362462 3300005340 Bacteria 1218
40 Ga0070689_100572744 3300005340 Bacteria 975
41 Ga0070689_100818441 3300005340 Bacteria 820
42 Ga0070689_100863433 3300005340 Unclassified 799
43 Ga0070687_100072670 3300005343 Bacteria 1852
44 Ga0070687_100173559 3300005343 Bacteria 1285
45 Ga0070687_100534395 3300005343 Unclassified 795
46 Ga0070692_10003489 3300005345 Bacteria 6384
47 Ga0070692_10013825 3300005345 Bacteria 3773
48 Ga0070692_10026794 3300005345 Bacteria 2852
49 Ga0070692_10109109 3300005345 Bacteria 1528
50 Ga0070692_10143402 3300005345 Bacteria 1354
51 Ga0070669_100355746 3300005353 Bacteria 1190
52 Ga0070669_100648840 3300005353 Bacteria 888
53 Ga0070675_100601942 3300005354 Bacteria 997
54 Ga0070671_100177519 3300005355 Bacteria 1802
55 Ga0070673_100021392 3300005364 Bacteria 4688
56 Ga0070673_100333401 3300005364 Bacteria 1343
57 Ga0070673_100958295 3300005364 Bacteria 795
58 Ga0070701_10015561 3300005438 Bacteria 3517
59 Ga0070701_10505206 3300005438 Bacteria 786
60 Ga0070705_100042665 3300005440 Bacteria 2594
61 Ga0070705_100216988 3300005440 Unclassified 1322
62 Ga0070705_100269052 3300005440 Bacteria 1206
63 Ga0070700_100011960 3300005441 Bacteria 4822
64 Ga0070694_100028428 3300005444 Bacteria 3639
65 Ga0070694_100119960 3300005444 Bacteria 1886
66 Ga0070694_100222334 3300005444 Bacteria 1417
67 Ga0070694_100364818 3300005444 Unclassified 1122
68 Ga0070694_100376701 3300005444 Bacteria 1106
69 Ga0070694_100883618 3300005444 Bacteria 737
70 Ga0070694_100977931 3300005444 Unclassified 702
71 Ga0070694_101280433 3300005444 Unclassified 616
72 Ga0070708_100421531 3300005445 Unclassified 1259
73 Ga0070681_10003996 3300005458 Bacteria 13914
74 Ga0068867_100034521 3300005459 Bacteria 3666
75 Ga0068867_101508715 3300005459 Unclassified 626
76 Ga0070685_10871693 3300005466 Unclassified 668
77 Ga0070706_100000490 3300005467 Bacteria 46631
78 Ga0070706_100127589 3300005467 Bacteria 2373
79 Ga0070707_100023711 3300005468 Bacteria 5803
80 Ga0070707_100894771 3300005468 Bacteria 852
81 Ga0070698_100300674 3300005471 Bacteria 1535
82 Ga0070699_100002299 3300005518 Bacteria 17201
83 Ga0070699_100025772 3300005518 Bacteria 5068
84 Ga0070699_100924861 3300005518 Bacteria 799
85 Ga0070679_100100531 3300005530 Bacteria 2878
86 Ga0070697_100222017 3300005536 Unclassified 1610
87 Ga0070697_100606884 3300005536 Bacteria 962
88 Ga0068853_100348528 3300005539 Bacteria 1377
89 Ga0068853_100688164 3300005539 Bacteria 975
90 Ga0070672_100185993 3300005543 Bacteria 1732
91 Ga0070672_100646222 3300005543 Bacteria 924
92 Ga0070695_100018422 3300005545 Bacteria 4240
93 Ga0070695_100069691 3300005545 Bacteria 2299
94 Ga0070695_100124268 3300005545 Unclassified 1770
95 Ga0070695_100201765 3300005545 Bacteria 1422
96 Ga0070695_100272559 3300005545 Bacteria 1240
97 Ga0070695_100294397 3300005545 Unclassified 1197
98 Ga0070695_100637551 3300005545 Bacteria 840
99 Ga0070695_100656236 3300005545 Unclassified 829
100 Ga0070696_100100093 3300005546 Bacteria 2075
101 Ga0070696_101273539 3300005546 Unclassified 623
102 Ga0070693_100014447 3300005547 Bacteria 4046
103 Ga0070693_100115806 3300005547 Bacteria 1656
104 Ga0070704_100074112 3300005549 Bacteria 2482
105 Ga0070704_100133129 3300005549 Bacteria 1930
106 Ga0070704_100252967 3300005549 Bacteria 1448
107 Ga0070704_100287650 3300005549 Unclassified 1364
108 Ga0070704_100319741 3300005549 Unclassified 1300
109 Ga0070704_100372680 3300005549 Bacteria 1211
110 Ga0070704_100550678 3300005549 Bacteria 1008
111 Ga0070704_100668739 3300005549 Unclassified 918
112 Ga0070664_100114642 3300005564 Bacteria 2355
113 Ga0070664_100797646 3300005564 Bacteria 883
114 Ga0070664_101076779 3300005564 Bacteria 757
115 Ga0068857_101228320 3300005577 Bacteria 726
116 Ga0068854_100116658 3300005578 Bacteria 2021
117 Ga0070702_100019304 3300005615 Bacteria 3552
118 Ga0070702_100048072 3300005615 Bacteria 2426
119 Ga0070702_100094116 3300005615 Bacteria 1824
120 Ga0070702_100315856 3300005615 Bacteria 1087
121 Ga0070702_100360138 3300005615 Unclassified 1028
122 Ga0068852_100179497 3300005616 Bacteria 1990
123 Ga0068859_100048622 3300005617 Bacteria 4260
124 Ga0068859_100050801 3300005617 Bacteria 4166
125 Ga0068859_100052948 3300005617 Bacteria 4081
126 Ga0068859_100069188 3300005617 Bacteria 3564
127 Ga0068859_100071467 3300005617 Bacteria 3506
128 Ga0068859_100184213 3300005617 Bacteria 2171
129 Ga0068859_100222899 3300005617 Bacteria 1973
130 Ga0068859_100322956 3300005617 Bacteria 1638
131 Ga0068859_100560688 3300005617 Bacteria 1236
132 Ga0068859_100658661 3300005617 Bacteria 1139
133 Ga0068859_101315180 3300005617 Bacteria 797
134 Ga0068859_101381839 3300005617 Bacteria 776
135 Ga0068864_100022039 3300005618 Bacteria 5339
136 Ga0068864_100055714 3300005618 Bacteria 3414
137 Ga0068864_100077307 3300005618 Bacteria 2910
138 Ga0068864_100084669 3300005618 Bacteria 2786
139 Ga0068864_100089935 3300005618 Bacteria 2706
140 Ga0068864_100145679 3300005618 Bacteria 2141
141 Ga0068864_100199571 3300005618 Bacteria 1837
142 Ga0068864_100216890 3300005618 Bacteria 1764
143 Ga0068864_100428348 3300005618 Bacteria 1262
144 Ga0068864_100742471 3300005618 Bacteria 961
145 Ga0068864_101013571 3300005618 Unclassified 824
146 Ga0068866_10238499 3300005718 Bacteria 1106
147 Ga0068861_100001938 3300005719 Bacteria 13331
148 Ga0068861_100024377 3300005719 Bacteria 4375
149 Ga0068861_101054659 3300005719 Bacteria 779
150 Ga0068851_10002380 3300005834 Bacteria 8264
151 Ga0068870_10009011 3300005840 Bacteria 4515
152 Ga0068870_10567033 3300005840 Bacteria 767
153 Ga0068863_100022262 3300005841 Bacteria 6051
154 Ga0068863_100054708 3300005841 Bacteria 3781
155 Ga0068863_100120665 3300005841 Bacteria 2499
156 Ga0068863_100242027 3300005841 Bacteria 1741
157 Ga0068863_100421902 3300005841 Bacteria 1307
158 Ga0068858_100128663 3300005842 Bacteria 2373
159 Ga0068858_100148611 3300005842 Bacteria 2202
160 Ga0068858_100202495 3300005842 Bacteria 1877
161 Ga0068858_100224823 3300005842 Bacteria 1778
162 Ga0068858_100440605 3300005842 Bacteria 1255
163 Ga0068858_100777680 3300005842 Unclassified 933
164 Ga0068860_100041953 3300005843 Bacteria 4372
165 Ga0068860_100054126 3300005843 Bacteria 3814
166 Ga0068860_100149532 3300005843 Bacteria 2248
167 Ga0068860_100457499 3300005843 Bacteria 1269
168 Ga0068860_100641585 3300005843 Bacteria 1069
169 Ga0068860_101044756 3300005843 Unclassified 835
170 Ga0068862_100183775 3300005844 Bacteria 1878
171 Ga0068862_100282896 3300005844 Bacteria 1520
172 Ga0068862_100367198 3300005844 Bacteria 1339
173 Ga0068862_101927227 3300005844 Unclassified 601
174 Ga0081539_10000407 3300005985 Bacteria 91696
175 Ga0081539_10002678 3300005985 Bacteria 24222
176 Ga0097621_100001860 3300006237 Bacteria 14473
177 Ga0097621_100210968 3300006237 Bacteria 1690
178 Ga0068871_100081661 3300006358 Bacteria 2678
179 Ga0075428_100247006 3300006844 Bacteria 1924
180 Ga0075428_101421069 3300006844 Unclassified 728
181 Ga0075431_100090024 3300006847 Bacteria 3167
182 Ga0075433_10058530 3300006852 Bacteria 3371
183 Ga0075433_10114764 3300006852 Bacteria 2390
184 Ga0075433_10127233 3300006852 Bacteria 2262
185 Ga0075433_10181808 3300006852 Bacteria 1871
186 Ga0075433_10245680 3300006852 Bacteria 1589
187 Ga0075433_10323138 3300006852 Bacteria 1365
188 Ga0075433_10841867 3300006852 Bacteria 801
189 Ga0075433_10976844 3300006852 Unclassified 738
190 Ga0075434_100080060 3300006871 Bacteria 3263
191 Ga0075434_100104812 3300006871 Bacteria 2837
192 Ga0075429_100013969 3300006880 Bacteria 6960
193 Ga0068865_100270104 3300006881 Bacteria 1350
194 Ga0075436_100813289 3300006914 Bacteria 696
195 Ga0097620_100048617 3300006931 Bacteria 4260
196 Ga0097620_100050800 3300006931 Bacteria 4166
197 Ga0097620_100052949 3300006931 Bacteria 4081
198 Ga0097620_100069186 3300006931 Bacteria 3564
199 Ga0097620_100071463 3300006931 Bacteria 3506
200 Ga0097620_100184220 3300006931 Bacteria 2171
201 Ga0097620_100222900 3300006931 Bacteria 1973
202 Ga0097620_100322953 3300006931 Bacteria 1638
203 Ga0097620_100529824 3300006931 Bacteria 1273
204 Ga0097620_100560715 3300006931 Bacteria 1236
205 Ga0097620_100658667 3300006931 Bacteria 1139
206 Ga0097620_101315006 3300006931 Bacteria 797
207 Ga0097620_101381855 3300006931 Bacteria 776
208 Ga0075435_100047253 3300007076 Bacteria 3455
209 Ga0105240_10503911 3300009093 Unclassified 1346
210 Ga0111539_10003247 3300009094 Bacteria 21499
211 Ga0111539_10005504 3300009094 Bacteria 16388
212 Ga0111539_10018262 3300009094 Bacteria 8687
213 Ga0111539_10621076 3300009094 Unclassified 1258
214 Ga0105245_10215814 3300009098 Bacteria 1849
215 Ga0105245_10903634 3300009098 Bacteria 925
216 Ga0105247_10062610 3300009101 Bacteria 2308
217 Ga0105247_10154792 3300009101 Bacteria 1513
218 Ga0105247_10297635 3300009101 Bacteria 1118
219 Ga0105247_10471436 3300009101 Bacteria 909
220 Ga0114129_10405228 3300009147 Bacteria 1797
221 Ga0105243_10125842 3300009148 Bacteria 2168
222 Ga0105243_10140295 3300009148 Bacteria 2061
223 Ga0105243_10262335 3300009148 Bacteria 1547
224 Ga0105243_11346117 3300009148 Unclassified 733
225 Ga0105241_10151537 3300009174 Bacteria 1897
226 Ga0105241_10247673 3300009174 Bacteria 1509
227 Ga0105241_10253185 3300009174 Bacteria 1494
228 Ga0105241_10281654 3300009174 Bacteria 1420
229 Ga0105241_10313809 3300009174 Bacteria 1349
230 Ga0105241_10387486 3300009174 Bacteria 1223
231 Ga0105241_10571143 3300009174 Bacteria 1018
232 Ga0105241_10611709 3300009174 Bacteria 985
233 Ga0105241_10641404 3300009174 Unclassified 964
234 Ga0105241_11254315 3300009174 Unclassified 704
235 Ga0105241_11417740 3300009174 Unclassified 666
236 Ga0105242_10122818 3300009176 Bacteria 2231
237 Ga0105242_10636467 3300009176 Bacteria 1035
238 Ga0105248_10045544 3300009177 Bacteria 4918
239 Ga0105248_10123290 3300009177 Bacteria 2923
240 Ga0105248_10793154 3300009177 Bacteria 1069
241 Ga0105248_10800368 3300009177 Bacteria 1064
242 Ga0105248_12178843 3300009177 Unclassified 631
243 Ga0105237_10016612 3300009545 Bacteria 7645
244 Ga0105237_10565574 3300009545 Bacteria 1144
245 Ga0105237_10600237 3300009545 Bacteria 1108
246 Ga0105238_10077977 3300009551 Bacteria 3304
247 Ga0105249_10143011 3300009553 Bacteria 2296
248 Ga0105249_10194186 3300009553 Bacteria 1983
249 Ga0105249_10792195 3300009553 Unclassified 1011
250 Ga0105249_11486540 3300009553 Unclassified 750
251 Ga0105239_10989990 3300010375 Unclassified 966
252 Ga0105246_10144415 3300011119 Unclassified 1793
253 Ga0105246_10209630 3300011119 Bacteria 1520
254 Ga0157373_10011195 3300013100 Bacteria 6601
255 Ga0157373_10115950 3300013100 Bacteria 1883
256 Ga0157373_10197780 3300013100 Bacteria 1417
257 Ga0157371_10411077 3300013102 Bacteria 991
258 Ga0157378_10282667 3300013297 Bacteria 1600
259 Ga0157378_10563363 3300013297 Bacteria 1146
260 Ga0163162_10068941 3300013306 Bacteria 3589
261 Ga0163162_10140754 3300013306 Bacteria 2526
262 Ga0163162_10297169 3300013306 Bacteria 1746
263 Ga0163162_10516620 3300013306 Bacteria 1324
264 Ga0157372_10069752 3300013307 Bacteria 3954
265 Ga0157372_10303551 3300013307 Bacteria 1857
266 Ga0157372_11485974 3300013307 Bacteria 781
267 Ga0157375_10087116 3300013308 Bacteria 3174
268 Ga0157375_10137883 3300013308 Bacteria 2565
269 Ga0157375_10396047 3300013308 Bacteria 1548
270 Ga0157375_11016729 3300013308 Bacteria 968
271 Ga0163163_10000207 3300014325 Bacteria 60848
272 Ga0163163_10011038 3300014325 Bacteria 8169
273 Ga0163163_10965588 3300014325 Bacteria 915
274 Ga0163163_12196721 3300014325 Unclassified 611
275 Ga0157380_10192888 3300014326 Bacteria 1800
276 Ga0157380_10822823 3300014326 Unclassified 948
277 Ga0157377_11268077 3300014745 Bacteria 574
278 Ga0157379_10689293 3300014968 Bacteria 958
279 Ga0157379_11249660 3300014968 Unclassified 716
280 Ga0163161_10582405 3300017792 Bacteria 920
281 Ga0207697_10072970 3300025315 Bacteria 1440
282 Ga0207656_10001259 3300025321 Bacteria 8343
283 Ga0207653_10009376 3300025885 Bacteria 3047
284 Ga0207642_10452436 3300025899 Bacteria 778
285 Ga0207710_10003532 3300025900 Bacteria 6947
286 Ga0207710_10075757 3300025900 Bacteria 1551
287 Ga0207647_10022391 3300025904 Bacteria 4197
288 Ga0207647_10072243 3300025904 Bacteria 2081
289 Ga0207647_10160705 3300025904 Bacteria 1310
290 Ga0207645_10480617 3300025907 Unclassified 840
291 Ga0207643_10006418 3300025908 Bacteria 6297
292 Ga0207643_10139072 3300025908 Bacteria 1449
293 Ga0207684_10000172 3300025910 Bacteria 106888
294 Ga0207654_10007830 3300025911 Bacteria 5387
295 Ga0207654_10010329 3300025911 Bacteria 4753
296 Ga0207654_10189679 3300025911 Bacteria 1346
297 Ga0207654_10300616 3300025911 Bacteria 1091
298 Ga0207654_10464202 3300025911 Unclassified 890
299 Ga0207654_10563979 3300025911 Unclassified 810
300 Ga0207707_10044447 3300025912 Bacteria 3873
301 Ga0207707_10059188 3300025912 Bacteria 3333
302 Ga0207707_10168509 3300025912 Bacteria 1914
303 Ga0207707_10572508 3300025912 Bacteria 958
304 Ga0207695_10352182 3300025913 Unclassified 1359
305 Ga0207695_10800289 3300025913 Bacteria 823
306 Ga0207671_10005880 3300025914 Bacteria 11137
307 Ga0207671_10363090 3300025914 Bacteria 1149
308 Ga0207660_10741880 3300025917 Bacteria 801
309 Ga0207662_10119100 3300025918 Bacteria 1654
310 Ga0207662_10211880 3300025918 Bacteria 1258
311 Ga0207657_10961955 3300025919 Bacteria 656
312 Ga0207646_10247238 3300025922 Unclassified 1611
313 Ga0207681_10015117 3300025923 Bacteria 4813
314 Ga0207681_10193616 3300025923 Bacteria 1557
315 Ga0207694_10026932 3300025924 Bacteria 4378
316 Ga0207694_10054534 3300025924 Bacteria 3102
317 Ga0207650_10000022 3300025925 Bacteria 318878
318 Ga0207650_10018149 3300025925 Bacteria 4934
319 Ga0207650_10190833 3300025925 Bacteria 1637
320 Ga0207644_10368169 3300025931 Bacteria 1170
321 Ga0207706_10409009 3300025933 Bacteria 1176
322 Ga0207686_10750941 3300025934 Bacteria 779
323 Ga0207709_10005750 3300025935 Bacteria 7007
324 Ga0207709_10091663 3300025935 Bacteria 1988
325 Ga0207709_10470620 3300025935 Bacteria 975
326 Ga0207670_10001189 3300025936 Bacteria 13765
327 Ga0207670_11183192 3300025936 Unclassified 647
328 Ga0207704_10171608 3300025938 Bacteria 1556
329 Ga0207704_10852437 3300025938 Bacteria 764
330 Ga0207691_10088505 3300025940 Bacteria 2777
331 Ga0207691_10916447 3300025940 Bacteria 733
332 Ga0207711_10015991 3300025941 Bacteria 6226
333 Ga0207711_10119886 3300025941 Bacteria 2348
334 Ga0207711_10148741 3300025941 Bacteria 2112
335 Ga0207711_10330575 3300025941 Bacteria 1409
336 Ga0207711_10490498 3300025941 Bacteria 1145
337 Ga0207689_10060235 3300025942 Bacteria 3121
338 Ga0207689_10445640 3300025942 Bacteria 1082
339 Ga0207689_10544222 3300025942 Bacteria 975
340 Ga0207689_10651863 3300025942 Bacteria 887
341 Ga0207679_10214407 3300025945 Bacteria 1616
342 Ga0207679_10488539 3300025945 Bacteria 1097
343 Ga0207679_10700425 3300025945 Bacteria 919
344 Ga0207651_10691741 3300025960 Bacteria 898
345 Ga0207651_10785434 3300025960 Bacteria 843
346 Ga0207651_11185093 3300025960 Bacteria 686
347 Ga0207712_10157741 3300025961 Bacteria 1760
348 Ga0207712_10283855 3300025961 Bacteria 1352
349 Ga0207712_10704234 3300025961 Unclassified 882
350 Ga0207640_10056359 3300025981 Bacteria 2579
351 Ga0207640_10577437 3300025981 Bacteria 948
352 Ga0207640_10967658 3300025981 Bacteria 747
353 Ga0207640_11309042 3300025981 Bacteria 647
354 Ga0207703_10127237 3300026035 Bacteria 2195
355 Ga0207703_10172790 3300026035 Bacteria 1902
356 Ga0207703_10383546 3300026035 Bacteria 1300
357 Ga0207639_10242302 3300026041 Bacteria 1568
358 Ga0207639_10550117 3300026041 Bacteria 1060
359 Ga0207708_10006775 3300026075 Bacteria 8478
360 Ga0207708_10019092 3300026075 Bacteria 5163
361 Ga0207708_10177555 3300026075 Bacteria 1689
362 Ga0207708_10982864 3300026075 Bacteria 733
363 Ga0207641_10057062 3300026088 Bacteria 3320
364 Ga0207641_10247808 3300026088 Bacteria 1663
365 Ga0207641_10387732 3300026088 Bacteria 1339
366 Ga0207641_10392869 3300026088 Bacteria 1330
367 Ga0207641_10685459 3300026088 Bacteria 1008
368 Ga0207641_10728467 3300026088 Bacteria 978
369 Ga0207648_10019666 3300026089 Bacteria 6095
370 Ga0207648_10067084 3300026089 Bacteria 3129
371 Ga0207648_10088132 3300026089 Bacteria 2710
372 Ga0207676_10028195 3300026095 Bacteria 4192
373 Ga0207676_10139913 3300026095 Bacteria 2071
374 Ga0207676_10336898 3300026095 Bacteria 1390
375 Ga0207676_10610122 3300026095 Bacteria 1049
376 Ga0207676_10640778 3300026095 Bacteria 1024
377 Ga0207676_10912430 3300026095 Unclassified 862
378 Ga0207676_10949980 3300026095 Bacteria 845
379 Ga0207676_11246516 3300026095 Bacteria 738
380 Ga0207674_10025246 3300026116 Bacteria 6341
381 Ga0207674_10037289 3300026116 Bacteria 5057
382 Ga0207674_10051891 3300026116 Bacteria 4183
383 Ga0207675_100003417 3300026118 Bacteria 15504
384 Ga0207675_100096435 3300026118 Bacteria 2784
385 Ga0207675_101281344 3300026118 Bacteria 753
386 Ga0207675_101669670 3300026118 Bacteria 657
387 Ga0207698_10388504 3300026142 Bacteria 1330
388 Ga0207428_10001056 3300027907 Bacteria 30236
389 Ga0207428_10276113 3300027907 Bacteria 1248
390 Ga0268265_10297724 3300028380 Bacteria 1451
391 Ga0268265_10465637 3300028380 Bacteria 1184
392 Ga0268265_10777226 3300028380 Unclassified 931
393 Ga0268265_11877452 3300028380 Unclassified 606
394 Ga0268264_10011117 3300028381 Bacteria 7436
395 Ga0268264_10015671 3300028381 Bacteria 6207
396 Ga0268264_10742530 3300028381 Bacteria 977
397 Ga0307408_100033990 3300031548 Bacteria 3567
398 Ga0307408_100985754 3300031548 Bacteria 776
399 Ga0307405_10050811 3300031731 Bacteria 2569
400 Ga0307405_10606638 3300031731 Bacteria 894
401 Ga0307410_10263527 3300031852 Bacteria 1345
402 Ga0307410_11369199 3300031852 Unclassified 620
403 Ga0307406_10314949 3300031901 Bacteria 1208
404 Ga0307406_10751504 3300031901 Bacteria 819
405 Ga0307407_10744289 3300031903 Unclassified 742
406 Ga0307409_100568443 3300031995 Bacteria 1116
407 Ga0307416_100256060 3300032002 Bacteria 1707
408 Ga0307416_100537652 3300032002 Unclassified 1240
409 Ga0307414_10024607 3300032004 Bacteria 3843
410 Ga0307414_10525137 3300032004 Unclassified 1051
411 Ga0307411_10041980 3300032005 Bacteria 2915
412 Ga0307415_100210212 3300032126 Unclassified 1551
413 Ga0307415_100465142 3300032126 Bacteria 1097
414 Ga0373949_0013419 3300035090 Bacteria 1816
415 Ga0373951_0011014 3300035091 Bacteria 2028
416 Ga0373942_0012109 3300035207 Bacteria 2055
417 Ga0395900_0255737 3300037418 Bacteria 1751
418 Ga0395898_0104275 3300037466 Bacteria 2720
419 Ga0395898_0732592 3300037466 Bacteria 930
420 Ga0242422_01280 3300038699 Bacteria 1730
421 Ga0439453_0018801 3300041408 Bacteria 1225
422 Ga0453683_0418353 3300044673 Bacteria 865
423 Ga0451576_0542547 3300045051 Bacteria 1222
424 Ga0451576_0678030 3300045051 Bacteria 1083
425 Ga0495643_0406265 3300046522 Unclassified 600
426 Ga0496102_1405414 3300048905 Unclassified 617
427 Ga0496104_0487620 3300048907 Bacteria 1144
428 Ga0496107_0105252 3300048910 Bacteria 2071
429 Ga0496108_0104422 3300048911 Bacteria 2418
430 Ga0496108_0143158 3300048911 Bacteria 2060
431 Ga0496108_1370248 3300048911 Bacteria 593
432 Ga0496109_0351424 3300048912 Bacteria 1393
433 Ga0496109_0900654 3300048912 Bacteria 823
434 Ga0496112_0147066 3300048915 Bacteria 2325
435 Ga0496112_0383289 3300048915 Bacteria 1347
436 Ga0496112_0605228 3300048915 Bacteria 1028
437 Ga0496112_0750677 3300048915 Unclassified 902
438 Ga0496112_0867418 3300048915 Bacteria 826
439 Ga0496112_1087243 3300048915 Unclassified 718
440 Ga0501291_020104 3300049514 Bacteria 1054
441 Ga0501292_024995 3300049515 Unclassified 982
442 Ga0501293_008632 3300049516 Unclassified 858
443 Ga0501295_019982 3300049518 Unclassified 1209
444 Ga0501296_001116 3300049519 Bacteria 2689
445 Ga0501296_012999 3300049519 Unclassified 1010
446 Ga0501296_015125 3300049519 Bacteria 950
447 Ga0501297_019217 3300049520 Bacteria 844
448 Ga0501298_001304 3300049521 Bacteria 3650
449 Ga0501298_022972 3300049521 Bacteria 1179
450 Ga0501299_000826 3300049522 Bacteria 3776
451 Ga0501300_003424 3300049523 Bacteria 2371
452 Ga0501303_005040 3300049526 Unclassified 1111
453 Ga0501048_0686739 3300049582 Bacteria 735
454 Ga0501202_068376 3300049652 Bacteria 814
455 Ga0501207_014336 3300049654 Unclassified 1209
456 Ga0501209_070391 3300049656 Bacteria 993
457 Ga0501216_024092 3300049660 Unclassified 1086
458 Ga0501216_038695 3300049660 Bacteria 905
459 Ga0501217_004226 3300049661 Bacteria 2944
460 Ga0501217_028636 3300049661 Unclassified 1358
461 Ga0501217_063421 3300049661 Bacteria 992
462 Ga0501223_007279 3300049663 Bacteria 2270
463 Ga0501223_009736 3300049663 Bacteria 1941
464 Ga0501223_021339 3300049663 Unclassified 1267
465 Ga0501224_004187 3300049664 Bacteria 2039
466 Ga0501227_064162 3300049665 Bacteria 946
467 Ga0501228_017678 3300049666 Bacteria 780
468 Ga0501233_057624 3300049668 Unclassified 956
469 Ga0501233_072496 3300049668 Bacteria 875
470 Ga0501235_006751 3300049669 Bacteria 2499
471 Ga0501235_115352 3300049669 Unclassified 667
472 Ga0501235_213860 3300049669 Bacteria 526
473 Ga0501239_000832 3300049672 Bacteria 2488
474 Ga0501239_022523 3300049672 Unclassified 782
475 Ga0501243_002790 3300049675 Bacteria 2577
476 Ga0501243_011933 3300049675 Unclassified 1368
477 Ga0501243_018436 3300049675 Bacteria 1137
478 Ga0501246_003002 3300049676 Bacteria 1347
479 Ga0501249_023518 3300049679 Unclassified 1353
480 Ga0501251_002685 3300049681 Bacteria 1740
481 Ga0501253_046774 3300049683 Unclassified 893
482 Ga0501257_015170 3300049686 Bacteria 1778
483 Ga0501257_020583 3300049686 Bacteria 1550
484 Ga0501259_021099 3300049688 Bacteria 1160
485 Ga0501259_061005 3300049688 Unclassified 788
486 Ga0501260_002107 3300049689 Unclassified 1697
487 Ga0501225_0033718 3300049705 Bacteria 1409
488 Ga0501225_0268717 3300049705 Unclassified 567
489 Ga0501229_011336 3300049706 Unclassified 1130
490 Ga0501234_014107 3300049707 Unclassified 1254
491 Ga0501234_021077 3300049707 Bacteria 1037
492 Ga0501234_022424 3300049707 Unclassified 1008
493 Ga0501232_011549 3300049757 Unclassified 1015
494 Ga0501232_088155 3300049757 Unclassified 532
495 Ga0501265_012803 3300049762 Bacteria 1050
496 Ga0501266_009788 3300049763 Bacteria 1215
497 Ga0501268_070370 3300049765 Unclassified 707
498 Ga0501272_047457 3300049769 Unclassified 588
499 Ga0501273_015092 3300049770 Unclassified 1000
500 Ga0501273_025043 3300049770 Bacteria 826
501 Ga0501275_093497 3300049772 Bacteria 503
502 Ga0501283_001858 3300049779 Bacteria 2738
503 Ga0501283_033033 3300049779 Unclassified 875
504 Ga0501226_006290 3300049853 Bacteria 1345
505 Ga0501226_012162 3300049853 Bacteria 953
506 nmdc:mga09592_292932_c1 3300050508 Bacteria 1411
507 nmdc:mga09592_54415_c1 3300050508 Bacteria 3381
508 nmdc:mga0qj67_339247_c1 3300050509 Bacteria 1216
509 nmdc:mga0qj67_517450_c1 3300050509 Unclassified 959
510 nmdc:mga06r32_149834_c1 3300050510 Bacteria 2311
511 nmdc:mga08y16_489851_c1 3300050511 Bacteria 1250
512 nmdc:mga08y16_565248_c1 3300050511 Bacteria 1150
513 nmdc:mga08y16_9882_c1 3300050511 Bacteria 10016
514 nmdc:mga0n895_277410_c1 3300050512 Bacteria 1700
515 nmdc:mga0n895_40947_c1 3300050512 Bacteria 4502
516 nmdc:mga0rr50_22382_c1 3300050513 Bacteria 3319
517 nmdc:mga0a205_144227_c1 3300050515 Bacteria 2281
518 nmdc:mga0a205_196984_c1 3300050515 Unclassified 1905
519 nmdc:mga0a205_259988_c1 3300050515 Bacteria 1614
520 nmdc:mga0a205_318083_c1 3300050515 Bacteria 1428
521 nmdc:mga0a205_81367_c1 3300050515 Bacteria 3129
522 Ga0068859_100529884
523 MBSR1b_contig_6182337
524 MBSR1b_contig_8296271
525 CNAas_1000813
526 JGI24751J29686_10000094
527 JGI24751J29686_10000191
528 JGI25406J46586_10002534
529 rootL2_10010078
530 Ga0065714_10090016
531 Ga0065714_10107832
532 Ga0065712_10000026
533 Ga0065712_10000150
534 Ga0065712_10011835
535 Ga0065712_10014351
536 Ga0065712_10188864
537 Ga0065715_10003027
538 Ga0065715_10006857
539 Ga0065715_10089167
540 Ga0065715_10092978
541 Ga0065715_10134192
542 Ga0065707_10001430
543 Ga0065707_10228099
544 Ga0070676_10467751
545 Ga0070690_100048424
546 Ga0070670_100000114
547 Ga0070670_100027344
548 Ga0070670_100155741
549 Ga0070670_100511439
550 Ga0068869_100161045
551 Ga0068869_100221870
552 Ga0068869_100487709
553 Ga0068869_100524397
554 Ga0068869_100916520
555 Ga0070680_100809308
556 Ga0070682_100007620
557 Ga0070682_100171707
558 Ga0070660_100992516
559 Ga0070689_100001291
560 Ga0070689_100362462
561 Ga0070689_100572744
562 Ga0070689_100818441
563 Ga0070689_100863433
564 Ga0070687_100072670
565 Ga0070687_100173559
566 Ga0070687_100534395
567 Ga0070692_10003489
568 Ga0070692_10013825
569 Ga0070692_10026794
570 Ga0070692_10109109
571 Ga0070692_10143402
572 Ga0070669_100355746
573 Ga0070669_100648840
574 Ga0070675_100601942
575 Ga0070671_100177519
576 Ga0070673_100021392
577 Ga0070673_100333401
578 Ga0070673_100958295
579 Ga0070701_10015561
580 Ga0070701_10505206
581 Ga0070705_100042665
582 Ga0070705_100216988
583 Ga0070705_100269052
584 Ga0070700_100011960
585 Ga0070694_100028428
586 Ga0070694_100119960
587 Ga0070694_100222334
588 Ga0070694_100364818
589 Ga0070694_100376701
590 Ga0070694_100883618
591 Ga0070694_100977931
592 Ga0070694_101280433
593 Ga0070708_100421531
594 Ga0070681_10003996
595 Ga0068867_100034521
596 Ga0068867_101508715
597 Ga0070685_10871693
598 Ga0070706_100000490
599 Ga0070706_100127589
600 Ga0070707_100023711
601 Ga0070707_100894771
602 Ga0070698_100300674
603 Ga0070699_100002299
604 Ga0070699_100025772
605 Ga0070699_100924861
606 Ga0070679_100100531
607 Ga0070697_100222017
608 Ga0070697_100606884
609 Ga0068853_100348528
610 Ga0068853_100688164
611 Ga0070672_100185993
612 Ga0070672_100646222
613 Ga0070695_100018422
614 Ga0070695_100069691
615 Ga0070695_100124268
616 Ga0070695_100201765
617 Ga0070695_100272559
618 Ga0070695_100294397
619 Ga0070695_100637551
620 Ga0070695_100656236
621 Ga0070696_100100093
622 Ga0070696_101273539
623 Ga0070693_100014447
624 Ga0070693_100115806
625 Ga0070704_100074112
626 Ga0070704_100133129
627 Ga0070704_100252967
628 Ga0070704_100287650
629 Ga0070704_100319741
630 Ga0070704_100372680
631 Ga0070704_100550678
632 Ga0070704_100668739
633 Ga0070664_100114642
634 Ga0070664_100797646
635 Ga0070664_101076779
636 Ga0068857_101228320
637 Ga0068854_100116658
638 Ga0070702_100019304
639 Ga0070702_100048072
640 Ga0070702_100094116
641 Ga0070702_100315856
642 Ga0070702_100360138
643 Ga0068852_100179497
644 Ga0068859_100048622
645 Ga0068859_100050801
646 Ga0068859_100052948
647 Ga0068859_100069188
648 Ga0068859_100071467
649 Ga0068859_100184213
650 Ga0068859_100222899
651 Ga0068859_100322956
652 Ga0068859_100560688
653 Ga0068859_100658661
654 Ga0068859_101315180
655 Ga0068859_101381839
656 Ga0068864_100022039
657 Ga0068864_100055714
658 Ga0068864_100077307
659 Ga0068864_100084669
660 Ga0068864_100089935
661 Ga0068864_100145679
662 Ga0068864_100199571
663 Ga0068864_100216890
664 Ga0068864_100428348
665 Ga0068864_100742471
666 Ga0068864_101013571
667 Ga0068866_10238499
668 Ga0068861_100001938
669 Ga0068861_100024377
670 Ga0068861_101054659
671 Ga0068851_10002380
672 Ga0068870_10009011
673 Ga0068870_10567033
674 Ga0068863_100022262
675 Ga0068863_100054708
676 Ga0068863_100120665
677 Ga0068863_100242027
678 Ga0068863_100421902
679 Ga0068858_100128663
680 Ga0068858_100148611
681 Ga0068858_100202495
682 Ga0068858_100224823
683 Ga0068858_100440605
684 Ga0068858_100777680
685 Ga0068860_100041953
686 Ga0068860_100054126
687 Ga0068860_100149532
688 Ga0068860_100457499
689 Ga0068860_100641585
690 Ga0068860_101044756
691 Ga0068862_100183775
692 Ga0068862_100282896
693 Ga0068862_100367198
694 Ga0068862_101927227
695 Ga0081539_10000407
696 Ga0081539_10002678
697 Ga0097621_100001860
698 Ga0097621_100210968
699 Ga0068871_100081661
700 Ga0075428_100247006
701 Ga0075428_101421069
702 Ga0075431_100090024
703 Ga0075433_10058530
704 Ga0075433_10114764
705 Ga0075433_10127233
706 Ga0075433_10181808
707 Ga0075433_10245680
708 Ga0075433_10323138
709 Ga0075433_10841867
710 Ga0075433_10976844
711 Ga0075434_100080060
712 Ga0075434_100104812
713 Ga0075429_100013969
714 Ga0068865_100270104
715 Ga0075436_100813289
716 Ga0097620_100048617
717 Ga0097620_100050800
718 Ga0097620_100052949
719 Ga0097620_100069186
720 Ga0097620_100071463
721 Ga0097620_100184220
722 Ga0097620_100222900
723 Ga0097620_100322953
724 Ga0097620_100529824
725 Ga0097620_100560715
726 Ga0097620_100658667
727 Ga0097620_101315006
728 Ga0097620_101381855
729 Ga0075435_100047253
730 Ga0105240_10503911
731 Ga0111539_10003247
732 Ga0111539_10005504
733 Ga0111539_10018262
734 Ga0111539_10621076
735 Ga0105245_10215814
736 Ga0105245_10903634
737 Ga0105247_10062610
738 Ga0105247_10154792
739 Ga0105247_10297635
740 Ga0105247_10471436
741 Ga0114129_10405228
742 Ga0105243_10125842
743 Ga0105243_10140295
744 Ga0105243_10262335
745 Ga0105243_11346117
746 Ga0105241_10151537
747 Ga0105241_10247673
748 Ga0105241_10253185
749 Ga0105241_10281654
750 Ga0105241_10313809
751 Ga0105241_10387486
752 Ga0105241_10571143
753 Ga0105241_10611709
754 Ga0105241_10641404
755 Ga0105241_11254315
756 Ga0105241_11417740
757 Ga0105242_10122818
758 Ga0105242_10636467
759 Ga0105248_10045544
760 Ga0105248_10123290
761 Ga0105248_10793154
762 Ga0105248_10800368
763 Ga0105248_12178843
764 Ga0105237_10016612
765 Ga0105237_10565574
766 Ga0105237_10600237
767 Ga0105238_10077977
768 Ga0105249_10143011
769 Ga0105249_10194186
770 Ga0105249_10792195
771 Ga0105249_11486540
772 Ga0105239_10989990
773 Ga0105246_10144415
774 Ga0105246_10209630
775 Ga0157373_10011195
776 Ga0157373_10115950
777 Ga0157373_10197780
778 Ga0157371_10411077
779 Ga0157378_10282667
780 Ga0157378_10563363
781 Ga0163162_10068941
782 Ga0163162_10140754
783 Ga0163162_10297169
784 Ga0163162_10516620
785 Ga0157372_10069752
786 Ga0157372_10303551
787 Ga0157372_11485974
788 Ga0157375_10087116
789 Ga0157375_10137883
790 Ga0157375_10396047
791 Ga0157375_11016729
792 Ga0163163_10000207
793 Ga0163163_10011038
794 Ga0163163_10965588
795 Ga0163163_12196721
796 Ga0157380_10192888
797 Ga0157380_10822823
798 Ga0157377_11268077
799 Ga0157379_10689293
800 Ga0157379_11249660
801 Ga0163161_10582405
802 Ga0207697_10072970
803 Ga0207656_10001259
804 Ga0207653_10009376
805 Ga0207642_10452436
806 Ga0207710_10003532
807 Ga0207710_10075757
808 Ga0207647_10022391
809 Ga0207647_10072243
810 Ga0207647_10160705
811 Ga0207645_10480617
812 Ga0207643_10006418
813 Ga0207643_10139072
814 Ga0207684_10000172
815 Ga0207654_10007830
816 Ga0207654_10010329
817 Ga0207654_10189679
818 Ga0207654_10300616
819 Ga0207654_10464202
820 Ga0207654_10563979
821 Ga0207707_10044447
822 Ga0207707_10059188
823 Ga0207707_10168509
824 Ga0207707_10572508
825 Ga0207695_10352182
826 Ga0207695_10800289
827 Ga0207671_10005880
828 Ga0207671_10363090
829 Ga0207660_10741880
830 Ga0207662_10119100
831 Ga0207662_10211880
832 Ga0207657_10961955
833 Ga0207646_10247238
834 Ga0207681_10015117
835 Ga0207681_10193616
836 Ga0207694_10026932
837 Ga0207694_10054534
838 Ga0207650_10000022
839 Ga0207650_10018149
840 Ga0207650_10190833
841 Ga0207644_10368169
842 Ga0207706_10409009
843 Ga0207686_10750941
844 Ga0207709_10005750
845 Ga0207709_10091663
846 Ga0207709_10470620
847 Ga0207670_10001189
848 Ga0207670_11183192
849 Ga0207704_10171608
850 Ga0207704_10852437
851 Ga0207691_10088505
852 Ga0207691_10916447
853 Ga0207711_10015991
854 Ga0207711_10119886
855 Ga0207711_10148741
856 Ga0207711_10330575
857 Ga0207711_10490498
858 Ga0207689_10060235
859 Ga0207689_10445640
860 Ga0207689_10544222
861 Ga0207689_10651863
862 Ga0207679_10214407
863 Ga0207679_10488539
864 Ga0207679_10700425
865 Ga0207651_10691741
866 Ga0207651_10785434
867 Ga0207651_11185093
868 Ga0207712_10157741
869 Ga0207712_10283855
870 Ga0207712_10704234
871 Ga0207640_10056359
872 Ga0207640_10577437
873 Ga0207640_10967658
874 Ga0207640_11309042
875 Ga0207703_10127237
876 Ga0207703_10172790
877 Ga0207703_10383546
878 Ga0207639_10242302
879 Ga0207639_10550117
880 Ga0207708_10006775
881 Ga0207708_10019092
882 Ga0207708_10177555
883 Ga0207708_10982864
884 Ga0207641_10057062
885 Ga0207641_10247808
886 Ga0207641_10387732
887 Ga0207641_10392869
888 Ga0207641_10685459
889 Ga0207641_10728467
890 Ga0207648_10019666
891 Ga0207648_10067084
892 Ga0207648_10088132
893 Ga0207676_10028195
894 Ga0207676_10139913
895 Ga0207676_10336898
896 Ga0207676_10610122
897 Ga0207676_10640778
898 Ga0207676_10912430
899 Ga0207676_10949980
900 Ga0207676_11246516
901 Ga0207674_10025246
902 Ga0207674_10037289
903 Ga0207674_10051891
904 Ga0207675_100003417
905 Ga0207675_100096435
906 Ga0207675_101281344
907 Ga0207675_101669670
908 Ga0207698_10388504
909 Ga0207428_10001056
910 Ga0207428_10276113
911 Ga0268265_10297724
912 Ga0268265_10465637
913 Ga0268265_10777226
914 Ga0268265_11877452
915 Ga0268264_10011117
916 Ga0268264_10015671
917 Ga0268264_10742530
918 Ga0307408_100033990
919 Ga0307408_100985754
920 Ga0307405_10050811
921 Ga0307405_10606638
922 Ga0307410_10263527
923 Ga0307410_11369199
924 Ga0307406_10314949
925 Ga0307406_10751504
926 Ga0307407_10744289
927 Ga0307409_100568443
928 Ga0307416_100256060
929 Ga0307416_100537652
930 Ga0307414_10024607
931 Ga0307414_10525137
932 Ga0307411_10041980
933 Ga0307415_100210212
934 Ga0307415_100465142
935 Ga0373949_0013419
936 Ga0373951_0011014
937 Ga0373942_0012109
938 Ga0395900_0255737
939 Ga0395898_0104275
940 Ga0395898_0732592
941 Ga0242422_01280
942 Ga0439453_0018801
943 Ga0453683_0418353
944 Ga0451576_0542547
945 Ga0451576_0678030
946 Ga0495643_0406265
947 Ga0496102_1405414
948 Ga0496104_0487620
949 Ga0496107_0105252
950 Ga0496108_0104422
951 Ga0496108_0143158
952 Ga0496108_1370248
953 Ga0496109_0351424
954 Ga0496109_0900654
955 Ga0496112_0147066
956 Ga0496112_0383289
957 Ga0496112_0605228
958 Ga0496112_0750677
959 Ga0496112_0867418
960 Ga0496112_1087243
961 Ga0501291_020104
962 Ga0501292_024995
963 Ga0501293_008632
964 Ga0501295_019982
965 Ga0501296_001116
966 Ga0501296_012999
967 Ga0501296_015125
968 Ga0501297_019217
969 Ga0501298_001304
970 Ga0501298_022972
971 Ga0501299_000826
972 Ga0501300_003424
973 Ga0501303_005040
974 Ga0501048_0686739
975 Ga0501202_068376
976 Ga0501207_014336
977 Ga0501209_070391
978 Ga0501216_024092
979 Ga0501216_038695
980 Ga0501217_004226
981 Ga0501217_028636
982 Ga0501217_063421
983 Ga0501223_007279
984 Ga0501223_009736
985 Ga0501223_021339
986 Ga0501224_004187
987 Ga0501227_064162
988 Ga0501228_017678
989 Ga0501233_057624
990 Ga0501233_072496
991 Ga0501235_006751
992 Ga0501235_115352
993 Ga0501235_213860
994 Ga0501239_000832
995 Ga0501239_022523
996 Ga0501243_002790
997 Ga0501243_011933
998 Ga0501243_018436
999 Ga0501246_003002
1000 Ga0501249_023518
1001 Ga0501251_002685
1002 Ga0501253_046774
1003 Ga0501257_015170
1004 Ga0501257_020583
1005 Ga0501259_021099
1006 Ga0501259_061005
1007 Ga0501260_002107
1008 Ga0501225_0033718
1009 Ga0501225_0268717
1010 Ga0501229_011336
1011 Ga0501234_014107
1012 Ga0501234_021077
1013 Ga0501234_022424
1014 Ga0501232_011549
1015 Ga0501232_088155
1016 Ga0501265_012803
1017 Ga0501266_009788
1018 Ga0501268_070370
1019 Ga0501272_047457
1020 Ga0501273_015092
1021 Ga0501273_025043
1022 Ga0501275_093497
1023 Ga0501283_001858
1024 Ga0501283_033033
1025 Ga0501226_006290
1026 Ga0501226_012162
1027 nmdc:mga09592_292932_c1
1028 nmdc:mga09592_54415_c1
1029 nmdc:mga0qj67_339247_c1
1030 nmdc:mga0qj67_517450_c1
1031 nmdc:mga06r32_149834_c1
1032 nmdc:mga08y16_489851_c1
1033 nmdc:mga08y16_565248_c1
1034 nmdc:mga08y16_9882_c1
1035 nmdc:mga0n895_277410_c1
1036 nmdc:mga0n895_40947_c1
1037 nmdc:mga0rr50_22382_c1
1038 nmdc:mga0a205_144227_c1
1039 nmdc:mga0a205_196984_c1
1040 nmdc:mga0a205_259988_c1
1041 nmdc:mga0a205_318083_c1
1042 nmdc:mga0a205_81367_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

33

131

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w6x-assembly1.cif.gz_A crystal structure of e. coli rsep in complex with batimastat 0.775 9 98
7w6y-assembly1.cif.gz_A crystal structure of kangiella koreensis rsep orthologue in complex with batimastat in space group p1 0.7541 5 98
7w6z-assembly1.cif.gz_A crystal structure of kangiella koreensis rsep orthologue in complex with batimastat in space group p21 0.701 5 98
5u5n-assembly1.cif.gz_B the dimeric crystal structure of htpa reductase from sellaginella moellendorffii 0.4568 21 58
7w6y-assembly1.cif.gz_A crystal structure of kangiella koreensis rsep orthologue in complex with batimastat in space group p1 0.4535 5 98
ID Description Score Start End Superfamily
3zssA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5337 81 161 1.20.58.80
af_K7KPX4_11_123_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.471 69 166 1.20.1070.10
af_A0A0P0X468_16_347_1.20.1280.170 Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 0.4631 75 162 1.20.1280.170
af_Q9HBV1_25_249_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.458 85 163 2.60.120.10
af_A0A1D6NCH6_24_137_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4434 78 166 1.20.1070.10
ID Description Score Start End GO Terms
AF-X1SN78-F1-model_v4 Peptidase M50 domain-containing protein 0.9111 1 68 GO:0004222
GO:0006508
GO:0016020
AF-A0A2M6Y818-F1-model_v4 RIP metalloprotease RseP 0.9102 1 88 GO:0004222
GO:0006508
GO:0016020
AF-A0A419G3Y2-F1-model_v4 deleted 0.8875 9 96
AF-A0A0S7WXQ5-F1-model_v4 PDZ domain-containing protein 0.8855 1 98 GO:0004222
GO:0006508
GO:0016020
AF-A0A424TKK3-F1-model_v4 RIP metalloprotease 0.8854 10 96 GO:0004222
GO:0006508
GO:0016020

Map