F458670

General Info

Members Datasets Scaffolds Average Seq Length
521 239 1042 370

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100005780|Ga0070704_1000057804
Length 376
Sequence VPILDEITEAVLSREEIARYLEGSHGESGRAARAKIKGYLEELRTTQRYSLYRSLKHPLYPILRKIERIPEHIEAARTATRGAGRVIYASNHKSHTDYLVELLVLDEHGVRPPIIAAGINLFGGPLGLLHRHVTGAIPIRRNTKDPAYLMTLKAYVAELLRKHDLFFYPEGGRSYSGEIKTPKTGLMHAALQAEHPHLVVLPTAVAYDLVLEDHVLSRQRVKRIQRPFSRELAEMVRYAVGYRSRAFVTFGKPMAVEIDAASRKDVLDFTHTVMDAIGRLYKVLPTAVVANAMRPSITLSDLEARADAVIDTLRANRANLGVQSGAEAVAAAIEPLETRGIVVMDRGRVRVRDRNVLRYYGRTLDHLLASPSRRTH

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 2.5
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 7.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100005780 3300005549 Bacteria 7236
2 JGI25406J46586_10006003 3300003203 Bacteria 5616
3 JGI25406J46586_10006091 3300003203 Bacteria 5572
4 Ga0065715_10092297 3300005293 Bacteria 5202
5 Ga0065715_10102934 3300005293 Bacteria 3074
6 Ga0065707_10000760 3300005295 Bacteria 16028
7 Ga0070676_10076679 3300005328 Bacteria 2019
8 Ga0070690_100036898 3300005330 Bacteria 3076
9 Ga0070670_100000629 3300005331 Bacteria 27591
10 Ga0070670_100006802 3300005331 Bacteria 9681
11 Ga0070670_100026727 3300005331 Bacteria 4965
12 Ga0070680_100259078 3300005336 Unclassified 1471
13 Ga0070680_100264326 3300005336 Unclassified 1456
14 Ga0070660_100104354 3300005339 Bacteria 2249
15 Ga0070689_100034472 3300005340 Bacteria 3862
16 Ga0070691_10003313 3300005341 Bacteria 7224
17 Ga0070687_100021508 3300005343 Unclassified 3034
18 Ga0070687_100035239 3300005343 Bacteria 2483
19 Ga0070687_100046199 3300005343 Bacteria 2228
20 Ga0070687_100105059 3300005343 Bacteria 1589
21 Ga0070661_100035511 3300005344 Bacteria 3620
22 Ga0070692_10007070 3300005345 Bacteria 4923
23 Ga0070692_10057962 3300005345 Unclassified 2033
24 Ga0070692_10062392 3300005345 Bacteria 1967
25 Ga0070668_100048981 3300005347 Bacteria 3250
26 Ga0070668_100181019 3300005347 Bacteria 1722
27 Ga0070669_100001105 3300005353 Bacteria 19696
28 Ga0070669_100017293 3300005353 Bacteria 5143
29 Ga0070669_100136203 3300005353 Bacteria 1889
30 Ga0070669_100189523 3300005353 Bacteria 1613
31 Ga0070669_100215203 3300005353 Bacteria 1517
32 Ga0070675_100022490 3300005354 Bacteria 5038
33 Ga0070675_100243797 3300005354 Bacteria 1571
34 Ga0070671_100005817 3300005355 Bacteria 9821
35 Ga0070674_100003553 3300005356 Bacteria 8756
36 Ga0070673_100001036 3300005364 Bacteria 15753
37 Ga0070673_100015170 3300005364 Bacteria 5401
38 Ga0070673_100059771 3300005364 Bacteria 3018
39 Ga0070673_100347950 3300005364 Bacteria 1315
40 Ga0070688_100003624 3300005365 Bacteria 7969
41 Ga0070688_100026455 3300005365 Bacteria 3447
42 Ga0070659_100053220 3300005366 Bacteria 3186
43 Ga0070667_100271116 3300005367 Unclassified 1522
44 Ga0070709_10019296 3300005434 Bacteria 3939
45 Ga0070713_100060163 3300005436 Unclassified 3175
46 Ga0070701_10008427 3300005438 Bacteria 4460
47 Ga0070705_100003619 3300005440 Bacteria 7566
48 Ga0070705_100004620 3300005440 Bacteria 6702
49 Ga0070705_100020626 3300005440 Bacteria 3492
50 Ga0070700_100011176 3300005441 Bacteria 4969
51 Ga0070700_100020621 3300005441 Bacteria 3821
52 Ga0070700_100076033 3300005441 Bacteria 2155
53 Ga0070694_100000279 3300005444 Bacteria 27271
54 Ga0070694_100011197 3300005444 Bacteria 5554
55 Ga0070694_100016697 3300005444 Bacteria 4623
56 Ga0070708_100144829 3300005445 Bacteria 2206
57 Ga0070662_100005750 3300005457 Bacteria 7947
58 Ga0070662_100068804 3300005457 Bacteria 2604
59 Ga0070681_10005726 3300005458 Bacteria 12012
60 Ga0070681_10091003 3300005458 Bacteria 3001
61 Ga0070681_10146189 3300005458 Unclassified 2293
62 Ga0068867_100000222 3300005459 Bacteria 37537
63 Ga0068867_100005323 3300005459 Bacteria 9094
64 Ga0068867_100042914 3300005459 Bacteria 3310
65 Ga0068867_100104536 3300005459 Bacteria 2167
66 Ga0070706_100339893 3300005467 Bacteria 1400
67 Ga0070707_100067085 3300005468 Bacteria 3450
68 Ga0070698_100009874 3300005471 Bacteria 10205
69 Ga0070698_100014852 3300005471 Bacteria 8232
70 Ga0070698_100029690 3300005471 Bacteria 5676
71 Ga0070698_100128478 3300005471 Bacteria 2490
72 Ga0070699_100001245 3300005518 Bacteria 23460
73 Ga0070699_100005432 3300005518 Bacteria 11175
74 Ga0070679_100075248 3300005530 Bacteria 3366
75 Ga0070684_100277926 3300005535 Bacteria 1534
76 Ga0070697_100032297 3300005536 Bacteria 4212
77 Ga0070697_100147902 3300005536 Bacteria 1979
78 Ga0070672_100025815 3300005543 Bacteria 4364
79 Ga0070672_100125870 3300005543 Bacteria 2102
80 Ga0070695_100000255 3300005545 Bacteria 26665
81 Ga0070695_100006166 3300005545 Bacteria 7085
82 Ga0070695_100022215 3300005545 Bacteria 3890
83 Ga0070696_100008853 3300005546 Bacteria 6731
84 Ga0070696_100049342 3300005546 Bacteria 2924
85 Ga0070665_100025666 3300005548 Bacteria 5936
86 Ga0070704_100000485 3300005549 Bacteria 18882
87 Ga0070704_100003547 3300005549 Bacteria 8967
88 Ga0070704_100055628 3300005549 Bacteria 2806
89 Ga0070704_100061224 3300005549 Bacteria 2693
90 Ga0068855_100068338 3300005563 Bacteria 4136
91 Ga0068855_100168629 3300005563 Unclassified 2480
92 Ga0070664_100022865 3300005564 Bacteria 5157
93 Ga0070664_100042433 3300005564 Bacteria 3840
94 Ga0068857_100033987 3300005577 Bacteria 4511
95 Ga0068854_100029433 3300005578 Bacteria 3802
96 Ga0068854_100066039 3300005578 Bacteria 2632
97 Ga0068854_100202154 3300005578 Unclassified 1562
98 Ga0068856_100024826 3300005614 Bacteria 5839
99 Ga0070702_100007736 3300005615 Bacteria 5161
100 Ga0070702_100167265 3300005615 Bacteria 1427
101 Ga0068852_100056782 3300005616 Bacteria 3385
102 Ga0068859_100004506 3300005617 Bacteria 14214
103 Ga0068859_100005710 3300005617 Bacteria 12657
104 Ga0068859_100013075 3300005617 Bacteria 8341
105 Ga0068859_100098248 3300005617 Bacteria 2982
106 Ga0068859_100360868 3300005617 Bacteria 1548
107 Ga0068859_100449444 3300005617 Bacteria 1385
108 Ga0068864_100005495 3300005618 Bacteria 10383
109 Ga0068864_100007279 3300005618 Bacteria 9101
110 Ga0068864_100029016 3300005618 Bacteria 4680
111 Ga0068864_100115546 3300005618 Unclassified 2394
112 Ga0068864_100158180 3300005618 Bacteria 2058
113 Ga0068861_100014182 3300005719 Bacteria 5589
114 Ga0068870_10001502 3300005840 Bacteria 9457
115 Ga0068863_100007042 3300005841 Bacteria 11020
116 Ga0068863_100047346 3300005841 Bacteria 4078
117 Ga0068858_100002099 3300005842 Bacteria 20232
118 Ga0068858_100048871 3300005842 Bacteria 3918
119 Ga0068858_100058067 3300005842 Bacteria 3577
120 Ga0068858_100092750 3300005842 Bacteria 2811
121 Ga0068862_100000612 3300005844 Bacteria 37096
122 Ga0081455_10078000 3300005937 Bacteria 2723
123 Ga0081538_10033129 3300005981 Bacteria 3445
124 Ga0081539_10000012 3300005985 Bacteria 440369
125 Ga0081539_10000291 3300005985 Bacteria 113769
126 Ga0081539_10003521 3300005985 Bacteria 19070
127 Ga0097621_100008050 3300006237 Bacteria 7567
128 Ga0068871_100039150 3300006358 Bacteria 3792
129 Ga0068871_100337938 3300006358 Bacteria 1329
130 Ga0068871_100374825 3300006358 Bacteria 1263
131 Ga0075428_100000060 3300006844 Bacteria 88550
132 Ga0075428_100000862 3300006844 Bacteria 31924
133 Ga0075428_100001853 3300006844 Bacteria 22653
134 Ga0075428_100011882 3300006844 Bacteria 9682
135 Ga0075430_100001840 3300006846 Bacteria 17361
136 Ga0075430_100128389 3300006846 Bacteria 2113
137 Ga0075431_100091365 3300006847 Unclassified 3142
138 Ga0075433_10011585 3300006852 Bacteria 7102
139 Ga0075433_10026751 3300006852 Bacteria 4888
140 Ga0075434_100004387 3300006871 Bacteria 12709
141 Ga0075434_100012231 3300006871 Bacteria 8132
142 Ga0075434_100016714 3300006871 Bacteria 7058
143 Ga0075434_100035383 3300006871 Bacteria 4937
144 Ga0075429_100007529 3300006880 Bacteria 9452
145 Ga0075429_100018798 3300006880 Bacteria 5985
146 Ga0075429_100093575 3300006880 Bacteria 2621
147 Ga0075429_100319988 3300006880 Bacteria 1358
148 Ga0068865_100013010 3300006881 Bacteria 5247
149 Ga0075436_100007726 3300006914 Bacteria 7349
150 Ga0097620_100004506 3300006931 Bacteria 14214
151 Ga0097620_100005711 3300006931 Bacteria 12657
152 Ga0097620_100013075 3300006931 Bacteria 8341
153 Ga0097620_100098248 3300006931 Bacteria 2982
154 Ga0097620_100360807 3300006931 Bacteria 1548
155 Ga0097620_100449455 3300006931 Bacteria 1385
156 Ga0075435_100000663 3300007076 Bacteria 21212
157 Ga0075435_100006600 3300007076 Bacteria 8214
158 Ga0075435_100014795 3300007076 Bacteria 5848
159 Ga0075435_100053739 3300007076 Bacteria 3249
160 Ga0075435_100105976 3300007076 Bacteria 2334
161 Ga0099794_10119597 3300007265 Bacteria 1324
162 Ga0111539_10000002 3300009094 Bacteria 983359
163 Ga0111539_10001647 3300009094 Bacteria 29819
164 Ga0111539_10003630 3300009094 Bacteria 20329
165 Ga0111539_10007980 3300009094 Bacteria 13502
166 Ga0111539_10074073 3300009094 Bacteria 4012
167 Ga0111539_10133649 3300009094 Bacteria 2905
168 Ga0111539_10361204 3300009094 Bacteria 1690
169 Ga0105245_10034722 3300009098 Bacteria 4473
170 Ga0105245_10223930 3300009098 Bacteria 1816
171 Ga0105247_10002871 3300009101 Bacteria 11489
172 Ga0105247_10012165 3300009101 Bacteria 5173
173 Ga0114129_10001294 3300009147 Bacteria 33348
174 Ga0114129_10006090 3300009147 Bacteria 17102
175 Ga0114129_10009873 3300009147 Bacteria 13608
176 Ga0114129_10014134 3300009147 Bacteria 11372
177 Ga0114129_10017722 3300009147 Bacteria 10141
178 Ga0114129_10030544 3300009147 Bacteria 7624
179 Ga0114129_10042517 3300009147 Bacteria 6399
180 Ga0114129_10086702 3300009147 Bacteria 4342
181 Ga0114129_10086916 3300009147 Bacteria 4336
182 Ga0114129_10189438 3300009147 Bacteria 2794
183 Ga0114129_10274502 3300009147 Unclassified 2254
184 Ga0114129_10560124 3300009147 Bacteria 1485
185 Ga0105243_10020299 3300009148 Bacteria 5038
186 Ga0105243_10039267 3300009148 Bacteria 3689
187 Ga0105243_10162217 3300009148 Bacteria 1928
188 Ga0105243_10191411 3300009148 Bacteria 1787
189 Ga0105242_10009175 3300009176 Bacteria 7594
190 Ga0105242_10013615 3300009176 Bacteria 6295
191 Ga0105248_10009460 3300009177 Bacteria 10725
192 Ga0105248_10020526 3300009177 Bacteria 7322
193 Ga0105248_10129297 3300009177 Bacteria 2849
194 Ga0105249_10019962 3300009553 Bacteria 5984
195 Ga0105249_10251719 3300009553 Unclassified 1751
196 Ga0105249_10352524 3300009553 Bacteria 1491
197 Ga0157374_10031300 3300013296 Bacteria 4834
198 Ga0157374_10083827 3300013296 Bacteria 3029
199 Ga0157378_10071772 3300013297 Bacteria 3110
200 Ga0157378_10085368 3300013297 Bacteria 2859
201 Ga0157378_10217961 3300013297 Bacteria 1813
202 Ga0157375_10067611 3300013308 Bacteria 3571
203 Ga0163163_10017165 3300014325 Bacteria 6744
204 Ga0163163_10031366 3300014325 Bacteria 5128
205 Ga0163163_10049496 3300014325 Bacteria 4137
206 Ga0163163_10066895 3300014325 Bacteria 3571
207 Ga0163163_10440878 3300014325 Bacteria 1362
208 Ga0157380_10011586 3300014326 Bacteria 6374
209 Ga0157380_10012703 3300014326 Bacteria 6115
210 Ga0157380_10030470 3300014326 Bacteria 4132
211 Ga0157380_10054559 3300014326 Bacteria 3172
212 Ga0157380_10082645 3300014326 Bacteria 2629
213 Ga0157380_10147977 3300014326 Bacteria 2026
214 Ga0157380_10357293 3300014326 Bacteria 1369
215 Ga0157377_10031057 3300014745 Bacteria 2900
216 Ga0157379_10013873 3300014968 Bacteria 7064
217 Ga0157379_10082940 3300014968 Unclassified 2873
218 Ga0157379_10168243 3300014968 Bacteria 1979
219 Ga0157376_10010717 3300014969 Bacteria 6721
220 Ga0157376_10144492 3300014969 Bacteria 2138
221 Ga0157376_10146625 3300014969 Unclassified 2124
222 Ga0163161_10188914 3300017792 Bacteria 1583
223 Ga0207653_10019417 3300025885 Unclassified 2143
224 Ga0207710_10078287 3300025900 Unclassified 1529
225 Ga0207680_10056590 3300025903 Bacteria 2369
226 Ga0207680_10099441 3300025903 Bacteria 1866
227 Ga0207699_10004735 3300025906 Bacteria 6499
228 Ga0207645_10001127 3300025907 Bacteria 22111
229 Ga0207645_10093123 3300025907 Bacteria 1939
230 Ga0207643_10001393 3300025908 Bacteria 13876
231 Ga0207643_10012751 3300025908 Bacteria 4544
232 Ga0207643_10104654 3300025908 Bacteria 1662
233 Ga0207684_10100131 3300025910 Bacteria 2476
234 Ga0207684_10214791 3300025910 Bacteria 1659
235 Ga0207707_10015793 3300025912 Bacteria 6583
236 Ga0207707_10100527 3300025912 Bacteria 2527
237 Ga0207660_10088118 3300025917 Bacteria 2295
238 Ga0207660_10147104 3300025917 Bacteria 1807
239 Ga0207660_10270887 3300025917 Unclassified 1345
240 Ga0207662_10025658 3300025918 Bacteria 3394
241 Ga0207662_10036541 3300025918 Bacteria 2872
242 Ga0207657_10011612 3300025919 Bacteria 8735
243 Ga0207649_10070528 3300025920 Bacteria 2229
244 Ga0207652_10110528 3300025921 Bacteria 2437
245 Ga0207646_10039575 3300025922 Bacteria 4243
246 Ga0207646_10343460 3300025922 Bacteria 1349
247 Ga0207681_10001212 3300025923 Bacteria 16585
248 Ga0207681_10028625 3300025923 Bacteria 3610
249 Ga0207681_10042381 3300025923 Bacteria 3040
250 Ga0207681_10106335 3300025923 Bacteria 2033
251 Ga0207650_10093840 3300025925 Bacteria 2298
252 Ga0207650_10171569 3300025925 Bacteria 1724
253 Ga0207659_10000188 3300025926 Bacteria 36927
254 Ga0207659_10007454 3300025926 Bacteria 6728
255 Ga0207659_10091482 3300025926 Unclassified 2273
256 Ga0207687_10052748 3300025927 Unclassified 2839
257 Ga0207700_10012599 3300025928 Bacteria 5462
258 Ga0207644_10022641 3300025931 Bacteria 4294
259 Ga0207690_10162855 3300025932 Bacteria 1664
260 Ga0207706_10068160 3300025933 Bacteria 3131
261 Ga0207706_10116616 3300025933 Bacteria 2349
262 Ga0207686_10055481 3300025934 Bacteria 2486
263 Ga0207709_10071090 3300025935 Unclassified 2208
264 Ga0207709_10080381 3300025935 Bacteria 2099
265 Ga0207709_10225944 3300025935 Bacteria 1353
266 Ga0207670_10004537 3300025936 Bacteria 7494
267 Ga0207670_10028608 3300025936 Bacteria 3541
268 Ga0207670_10034353 3300025936 Bacteria 3277
269 Ga0207669_10015282 3300025937 Bacteria 3868
270 Ga0207704_10007205 3300025938 Bacteria 5238
271 Ga0207704_10081980 3300025938 Bacteria 2088
272 Ga0207691_10029953 3300025940 Bacteria 5089
273 Ga0207691_10071556 3300025940 Bacteria 3129
274 Ga0207691_10149979 3300025940 Bacteria 2050
275 Ga0207711_10007457 3300025941 Bacteria 9152
276 Ga0207711_10047114 3300025941 Bacteria 3685
277 Ga0207711_10067498 3300025941 Bacteria 3096
278 Ga0207711_10076039 3300025941 Bacteria 2923
279 Ga0207689_10055559 3300025942 Bacteria 3259
280 Ga0207689_10143106 3300025942 Unclassified 1970
281 Ga0207689_10220029 3300025942 Bacteria 1569
282 Ga0207679_10047809 3300025945 Bacteria 3111
283 Ga0207679_10242863 3300025945 Bacteria 1527
284 Ga0207667_10121824 3300025949 Bacteria 2687
285 Ga0207651_10010774 3300025960 Bacteria 5082
286 Ga0207651_10050471 3300025960 Bacteria 2825
287 Ga0207651_10174425 3300025960 Unclassified 1699
288 Ga0207712_10094453 3300025961 Bacteria 2209
289 Ga0207668_10027120 3300025972 Bacteria 3729
290 Ga0207640_10031314 3300025981 Bacteria 3285
291 Ga0207640_10137408 3300025981 Bacteria 1776
292 Ga0207703_10037804 3300026035 Bacteria 3847
293 Ga0207703_10053494 3300026035 Bacteria 3281
294 Ga0207639_10248505 3300026041 Unclassified 1550
295 Ga0207708_10021002 3300026075 Bacteria 4927
296 Ga0207708_10032018 3300026075 Bacteria 3992
297 Ga0207708_10035743 3300026075 Bacteria 3781
298 Ga0207708_10208081 3300026075 Bacteria 1563
299 Ga0207702_10020533 3300026078 Bacteria 5468
300 Ga0207641_10007307 3300026088 Bacteria 9204
301 Ga0207641_10281549 3300026088 Unclassified 1564
302 Ga0207648_10001673 3300026089 Bacteria 24273
303 Ga0207648_10009704 3300026089 Bacteria 9205
304 Ga0207648_10081496 3300026089 Bacteria 2822
305 Ga0207648_10085002 3300026089 Bacteria 2760
306 Ga0207676_10013381 3300026095 Bacteria 5893
307 Ga0207676_10019750 3300026095 Bacteria 4921
308 Ga0207676_10071582 3300026095 Bacteria 2784
309 Ga0207674_10006964 3300026116 Bacteria 13233
310 Ga0207675_100016948 3300026118 Bacteria 6808
311 Ga0207675_100025648 3300026118 Bacteria 5486
312 Ga0207675_100036001 3300026118 Bacteria 4616
313 Ga0207675_100042903 3300026118 Bacteria 4223
314 Ga0207675_100086496 3300026118 Bacteria 2944
315 Ga0207675_100127883 3300026118 Bacteria 2408
316 Ga0207675_100157222 3300026118 Bacteria 2166
317 Ga0207675_100213124 3300026118 Bacteria 1859
318 Ga0207683_10072747 3300026121 Unclassified 3040
319 Ga0207683_10121368 3300026121 Bacteria 2346
320 Ga0207428_10000026 3300027907 Bacteria 255539
321 Ga0207428_10000319 3300027907 Bacteria 62926
322 Ga0207428_10001344 3300027907 Bacteria 26177
323 Ga0207428_10008335 3300027907 Bacteria 9364
324 Ga0207428_10021167 3300027907 Bacteria 5508
325 Ga0207428_10051677 3300027907 Bacteria 3285
326 Ga0268266_10022883 3300028379 Bacteria 5318
327 Ga0268266_10042195 3300028379 Bacteria 3895
328 Ga0268265_10000618 3300028380 Bacteria 35420
329 Ga0268265_10032416 3300028380 Bacteria 3786
330 Ga0268264_10068812 3300028381 Bacteria 2993
331 Ga0265318_10027180 3300028577 Bacteria 2250
332 Ga0265336_10011428 3300028666 Bacteria 3019
333 Ga0265314_10014222 3300031711 Bacteria 6382
334 Ga0265314_10062200 3300031711 Bacteria 2538
335 Ga0307405_10048790 3300031731 Bacteria 2613
336 Ga0307413_10012898 3300031824 Bacteria 4178
337 Ga0307410_10004658 3300031852 Bacteria 7127
338 Ga0307410_10015855 3300031852 Bacteria 4479
339 Ga0307410_10085150 3300031852 Bacteria 2230
340 Ga0307410_10132213 3300031852 Bacteria 1834
341 Ga0307406_10003443 3300031901 Bacteria 8613
342 Ga0307407_10000594 3300031903 Bacteria 11505
343 Ga0307407_10002881 3300031903 Bacteria 6873
344 Ga0307407_10115084 3300031903 Bacteria 1695
345 Ga0307412_10023355 3300031911 Bacteria 3804
346 Ga0307412_10161075 3300031911 Bacteria 1667
347 Ga0307409_100004132 3300031995 Bacteria 8077
348 Ga0307409_100130439 3300031995 Bacteria 2147
349 Ga0307416_100001749 3300032002 Bacteria 12020
350 Ga0307416_100010946 3300032002 Bacteria 6020
351 Ga0307416_100026028 3300032002 Bacteria 4303
352 Ga0307416_100082874 3300032002 Bacteria 2718
353 Ga0307411_10004812 3300032005 Bacteria 6544
354 Ga0307411_10045368 3300032005 Bacteria 2827
355 Ga0307411_10048334 3300032005 Bacteria 2757
356 Ga0307411_10200110 3300032005 Bacteria 1533
357 Ga0307411_10232701 3300032005 Bacteria 1437
358 Ga0307415_100000792 3300032126 Bacteria 14346
359 Ga0373934_0012475 3300035086 Bacteria 3208
360 Ga0373936_0093920 3300035113 Bacteria 1260
361 Ga0373941_0003435 3300035115 Bacteria 3588
362 Ga0373945_0009789 3300035116 Bacteria 3145
363 Ga0373945_0012515 3300035116 Bacteria 2820
364 Ga0373956_0082597 3300035119 Unclassified 1476
365 Ga0373943_0029545 3300035170 Bacteria 2590
366 Ga0373924_0023620 3300035410 Unclassified 2415
367 Ga0373935_0013430 3300035692 Bacteria 4940
368 Ga0373935_0151450 3300035692 Unclassified 1574
369 Ga0373947_0088331 3300035725 Bacteria 1929
370 Ga0373937_0019372 3300036401 Bacteria 6091
371 Ga0373937_0029155 3300036401 Bacteria 4997
372 Ga0373925_0003038 3300037068 Bacteria 13202
373 Ga0439450_021371 3300042008 Bacteria 1389
374 Ga0439435_0000707 3300042436 Bacteria 5562
375 Ga0439435_0005481 3300042436 Bacteria 2794
376 Ga0451576_0004119 3300045051 Bacteria 19176
377 Ga0451576_0033485 3300045051 Bacteria 5462
378 Ga0451576_0087899 3300045051 Bacteria 3232
379 Ga0466967_0283988 3300045976 Bacteria 1589
380 Ga0495603_0006301 3300046455 Bacteria 7096
381 Ga0495629_0085276 3300046459 Bacteria 2204
382 Ga0495582_0059902 3300046473 Bacteria 2100
383 Ga0495662_0069018 3300046476 Bacteria 1712
384 Ga0495594_0007743 3300046499 Bacteria 5524
385 Ga0495594_0155658 3300046499 Unclassified 1298
386 Ga0495608_0016159 3300046511 Bacteria 5162
387 Ga0495630_0011908 3300046517 Bacteria 6305
388 Ga0495663_0018674 3300046525 Bacteria 1975
389 Ga0495642_0013170 3300046528 Bacteria 3194
390 Ga0495652_0016588 3300046529 Bacteria 6586
391 Ga0495598_0016800 3300046537 Bacteria 1875
392 Ga0495609_0020285 3300046538 Bacteria 3071
393 Ga0495621_0001780 3300046539 Bacteria 5657
394 Ga0495621_0005952 3300046539 Bacteria 3537
395 Ga0495621_0010567 3300046539 Bacteria 2829
396 Ga0495621_0013671 3300046539 Bacteria 2555
397 Ga0495645_0037167 3300046543 Bacteria 3548
398 Ga0495634_0128133 3300046642 Bacteria 1620
399 Ga0495659_0004533 3300046664 Bacteria 4370
400 Ga0495659_0011402 3300046664 Bacteria 2864
401 Ga0495659_0022810 3300046664 Bacteria 2121
402 Ga0495659_0023239 3300046664 Bacteria 2105
403 Ga0495659_0056516 3300046664 Bacteria 1440
404 Ga0495588_0028140 3300046674 Bacteria 2812
405 Ga0495669_0013119 3300046684 Bacteria 3529
406 Ga0495613_0000270 3300046689 Bacteria 48533
407 Ga0495604_0010810 3300047317 Bacteria 7248
408 Ga0495636_0019808 3300047318 Bacteria 2706
409 Ga0495674_0004142 3300047319 Bacteria 14004
410 Ga0495674_0188884 3300047319 Unclassified 1713
411 Ga0495676_0016670 3300047321 Bacteria 6508
412 Ga0495684_0000011 3300047471 Bacteria 195144
413 Ga0496101_0153451 3300048904 Unclassified 1763
414 Ga0496104_0286344 3300048907 Bacteria 1560
415 Ga0496104_0364110 3300048907 Unclassified 1358
416 Ga0496104_0398374 3300048907 Bacteria 1289
417 Ga0496107_0290062 3300048910 Bacteria 1218
418 Ga0496108_0049339 3300048911 Bacteria 3521
419 Ga0496108_0051540 3300048911 Bacteria 3448
420 Ga0496108_0076481 3300048911 Unclassified 2830
421 Ga0496109_0056590 3300048912 Bacteria 3579
422 Ga0496112_0036226 3300048915 Bacteria 4812
423 Ga0496113_0109829 3300048916 Bacteria 2145
424 Ga0496114_0088590 3300048917 Bacteria 2625
425 Ga0496114_0284535 3300048917 Bacteria 1458
426 Ga0501033_0122526 3300049570 Unclassified 1886
427 Ga0501036_0010626 3300049572 Bacteria 7606
428 Ga0501036_0072457 3300049572 Bacteria 2912
429 Ga0501036_0175907 3300049572 Bacteria 1802
430 Ga0501038_0019145 3300049574 Bacteria 6174
431 Ga0501040_0000719 3300049576 Bacteria 20451
432 Ga0501041_0055648 3300049577 Unclassified 2415
433 Ga0501042_0006212 3300049578 Bacteria 7755
434 Ga0501042_0010100 3300049578 Bacteria 6314
435 Ga0501042_0150126 3300049578 Bacteria 1680
436 Ga0501046_0002475 3300049580 Bacteria 17314
437 Ga0501046_0057811 3300049580 Bacteria 3042
438 Ga0501047_0064780 3300049581 Bacteria 3525
439 Ga0501068_0042903 3300049584 Bacteria 2720
440 Ga0501071_0007286 3300049587 Bacteria 7241
441 Ga0501071_0008594 3300049587 Bacteria 6750
442 Ga0501072_0012525 3300049588 Bacteria 6485
443 Ga0501072_0025698 3300049588 Bacteria 4587
444 Ga0501072_0079596 3300049588 Bacteria 2595
445 Ga0501073_0002679 3300049589 Bacteria 13335
446 Ga0501075_0000043 3300049591 Bacteria 51143
447 Ga0501075_0030526 3300049591 Bacteria 3993
448 Ga0501075_0129667 3300049591 Unclassified 1921
449 Ga0501075_0218535 3300049591 Unclassified 1454
450 Ga0501076_0061193 3300049592 Bacteria 2996
451 Ga0501077_0007615 3300049593 Bacteria 6684
452 Ga0501077_0160811 3300049593 Bacteria 1426
453 Ga0501079_0001578 3300049741 Bacteria 16191
454 Ga0501079_0075165 3300049741 Bacteria 2612
455 Ga0501079_0094540 3300049741 Bacteria 2316
456 Ga0501081_0002138 3300049743 Bacteria 12373
457 Ga0501035_0084172 3300049822 Bacteria 2805
458 Ga0501045_0016266 3300049824 Bacteria 5282
459 Ga0501045_0044965 3300049824 Bacteria 3215
460 Ga0501045_0080247 3300049824 Bacteria 2405
461 nmdc:mga05p37_124218_c1 3300050507 Bacteria 3170
462 nmdc:mga05p37_14340_c1 3300050507 Bacteria 9515
463 nmdc:mga05p37_179975_c1 3300050507 Bacteria 2573
464 nmdc:mga05p37_21858_c2 3300050507 Bacteria 5645
465 nmdc:mga05p37_228117_c1 3300050507 Unclassified 2245
466 nmdc:mga05p37_29565_c1 3300050507 Bacteria 4975
467 nmdc:mga05p37_3618_c1 3300050507 Bacteria 18067
468 nmdc:mga05p37_49197_c1 3300050507 Bacteria 5185
469 nmdc:mga05p37_644_c1 3300050507 Bacteria 38645
470 nmdc:mga05p37_9709_c1 3300050507 Bacteria 11411
471 nmdc:mga09592_11229_c1 3300050508 Bacteria 7288
472 nmdc:mga0qj67_2070_c1 3300050509 Bacteria 14319
473 nmdc:mga0qj67_21426_c1 3300050509 Bacteria 4958
474 nmdc:mga0qj67_81320_c1 3300050509 Bacteria 2597
475 nmdc:mga06r32_3246_c1 3300050510 Bacteria 14550
476 nmdc:mga06r32_72230_c1 3300050510 Bacteria 3341
477 nmdc:mga08y16_1387_c1 3300050511 Bacteria 24239
478 nmdc:mga08y16_13945_c1 3300050511 Bacteria 8460
479 nmdc:mga08y16_144609_c1 3300050511 Bacteria 2472
480 nmdc:mga08y16_208867_c1 3300050511 Bacteria 2022
481 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
482 nmdc:mga08y16_34796_c1 3300050511 Bacteria 5293
483 nmdc:mga08y16_385233_c1 3300050511 Bacteria 1437
484 nmdc:mga08y16_64032_c1 3300050511 Bacteria 3840
485 nmdc:mga08y16_8286_c1 3300050511 Bacteria 10875
486 nmdc:mga08y16_86164_c1 3300050511 Bacteria 3274
487 nmdc:mga0n895_18715_c1 3300050512 Bacteria 6417
488 nmdc:mga0n895_361552_c1 3300050512 Bacteria 1470
489 nmdc:mga0n895_7444_c1 3300050512 Bacteria 9395
490 nmdc:mga0rr50_11809_c1 3300050513 Bacteria 5609
491 nmdc:mga0rr50_248211_c1 3300050513 Bacteria 1477
492 nmdc:mga0rr50_70316_c1 3300050513 Bacteria 2667
493 nmdc:mga08x19_18047_c1 3300050514 Bacteria 4323
494 nmdc:mga08x19_31050_c1 3300050514 Bacteria 3359
495 nmdc:mga0a205_14352_c1 3300050515 Bacteria 7388
496 nmdc:mga0a205_15836_c2 3300050515 Bacteria 6656
497 nmdc:mga0a205_34268_c1 3300050515 Bacteria 4872
498 nmdc:mga0a205_432220_c1 3300050515 Bacteria 1178
499 nmdc:mga0a205_68050_c1 3300050515 Bacteria 3439
500 nmdc:mga0a205_71176_c1 3300050515 Bacteria 3359
501 Ga0495601_0010849 3300053077 Bacteria 5437
502 Ga0495601_0013734 3300053077 Bacteria 4873
503 Ga0495601_0035949 3300053077 Bacteria 3093
504 Ga0495619_0002253 3300053085 Bacteria 12750
505 Ga0495619_0012337 3300053085 Bacteria 5378
506 Ga0500556_0047735 3300053104 Bacteria 1537
507 Ga0501084_0010055 3300054114 Bacteria 7819
508 Ga0501084_0024503 3300054114 Bacteria 5035
509 Ga0590071_000006 3300059421 Bacteria 60899
510 Ga0590071_001300 3300059421 Bacteria 6680
511 Ga0590071_010383 3300059421 Bacteria 2181
512 Ga0590074_001634 3300059423 Bacteria 3650
513 Ga0590075_000335 3300059424 Bacteria 13095
514 Ga0590075_008589 3300059424 Bacteria 2440
515 Ga0590077_000034 3300059426 Bacteria 31653
516 Ga0590077_001330 3300059426 Bacteria 5832
517 Ga0501082_0045164 3300060353 Bacteria 3799
518 Ga0530510_0016549 3300061734 Bacteria 5221
519 Ga0530510_0052935 3300061734 Bacteria 2933
520 Ga0530510_0094501 3300061734 Unclassified 2183
521 Ga0530510_0154460 3300061734 Bacteria 1695
522 Ga0070704_100005780
523 JGI25406J46586_10006003
524 JGI25406J46586_10006091
525 Ga0065715_10092297
526 Ga0065715_10102934
527 Ga0065707_10000760
528 Ga0070676_10076679
529 Ga0070690_100036898
530 Ga0070670_100000629
531 Ga0070670_100006802
532 Ga0070670_100026727
533 Ga0070680_100259078
534 Ga0070680_100264326
535 Ga0070660_100104354
536 Ga0070689_100034472
537 Ga0070691_10003313
538 Ga0070687_100021508
539 Ga0070687_100035239
540 Ga0070687_100046199
541 Ga0070687_100105059
542 Ga0070661_100035511
543 Ga0070692_10007070
544 Ga0070692_10057962
545 Ga0070692_10062392
546 Ga0070668_100048981
547 Ga0070668_100181019
548 Ga0070669_100001105
549 Ga0070669_100017293
550 Ga0070669_100136203
551 Ga0070669_100189523
552 Ga0070669_100215203
553 Ga0070675_100022490
554 Ga0070675_100243797
555 Ga0070671_100005817
556 Ga0070674_100003553
557 Ga0070673_100001036
558 Ga0070673_100015170
559 Ga0070673_100059771
560 Ga0070673_100347950
561 Ga0070688_100003624
562 Ga0070688_100026455
563 Ga0070659_100053220
564 Ga0070667_100271116
565 Ga0070709_10019296
566 Ga0070713_100060163
567 Ga0070701_10008427
568 Ga0070705_100003619
569 Ga0070705_100004620
570 Ga0070705_100020626
571 Ga0070700_100011176
572 Ga0070700_100020621
573 Ga0070700_100076033
574 Ga0070694_100000279
575 Ga0070694_100011197
576 Ga0070694_100016697
577 Ga0070708_100144829
578 Ga0070662_100005750
579 Ga0070662_100068804
580 Ga0070681_10005726
581 Ga0070681_10091003
582 Ga0070681_10146189
583 Ga0068867_100000222
584 Ga0068867_100005323
585 Ga0068867_100042914
586 Ga0068867_100104536
587 Ga0070706_100339893
588 Ga0070707_100067085
589 Ga0070698_100009874
590 Ga0070698_100014852
591 Ga0070698_100029690
592 Ga0070698_100128478
593 Ga0070699_100001245
594 Ga0070699_100005432
595 Ga0070679_100075248
596 Ga0070684_100277926
597 Ga0070697_100032297
598 Ga0070697_100147902
599 Ga0070672_100025815
600 Ga0070672_100125870
601 Ga0070695_100000255
602 Ga0070695_100006166
603 Ga0070695_100022215
604 Ga0070696_100008853
605 Ga0070696_100049342
606 Ga0070665_100025666
607 Ga0070704_100000485
608 Ga0070704_100003547
609 Ga0070704_100055628
610 Ga0070704_100061224
611 Ga0068855_100068338
612 Ga0068855_100168629
613 Ga0070664_100022865
614 Ga0070664_100042433
615 Ga0068857_100033987
616 Ga0068854_100029433
617 Ga0068854_100066039
618 Ga0068854_100202154
619 Ga0068856_100024826
620 Ga0070702_100007736
621 Ga0070702_100167265
622 Ga0068852_100056782
623 Ga0068859_100004506
624 Ga0068859_100005710
625 Ga0068859_100013075
626 Ga0068859_100098248
627 Ga0068859_100360868
628 Ga0068859_100449444
629 Ga0068864_100005495
630 Ga0068864_100007279
631 Ga0068864_100029016
632 Ga0068864_100115546
633 Ga0068864_100158180
634 Ga0068861_100014182
635 Ga0068870_10001502
636 Ga0068863_100007042
637 Ga0068863_100047346
638 Ga0068858_100002099
639 Ga0068858_100048871
640 Ga0068858_100058067
641 Ga0068858_100092750
642 Ga0068862_100000612
643 Ga0081455_10078000
644 Ga0081538_10033129
645 Ga0081539_10000012
646 Ga0081539_10000291
647 Ga0081539_10003521
648 Ga0097621_100008050
649 Ga0068871_100039150
650 Ga0068871_100337938
651 Ga0068871_100374825
652 Ga0075428_100000060
653 Ga0075428_100000862
654 Ga0075428_100001853
655 Ga0075428_100011882
656 Ga0075430_100001840
657 Ga0075430_100128389
658 Ga0075431_100091365
659 Ga0075433_10011585
660 Ga0075433_10026751
661 Ga0075434_100004387
662 Ga0075434_100012231
663 Ga0075434_100016714
664 Ga0075434_100035383
665 Ga0075429_100007529
666 Ga0075429_100018798
667 Ga0075429_100093575
668 Ga0075429_100319988
669 Ga0068865_100013010
670 Ga0075436_100007726
671 Ga0097620_100004506
672 Ga0097620_100005711
673 Ga0097620_100013075
674 Ga0097620_100098248
675 Ga0097620_100360807
676 Ga0097620_100449455
677 Ga0075435_100000663
678 Ga0075435_100006600
679 Ga0075435_100014795
680 Ga0075435_100053739
681 Ga0075435_100105976
682 Ga0099794_10119597
683 Ga0111539_10000002
684 Ga0111539_10001647
685 Ga0111539_10003630
686 Ga0111539_10007980
687 Ga0111539_10074073
688 Ga0111539_10133649
689 Ga0111539_10361204
690 Ga0105245_10034722
691 Ga0105245_10223930
692 Ga0105247_10002871
693 Ga0105247_10012165
694 Ga0114129_10001294
695 Ga0114129_10006090
696 Ga0114129_10009873
697 Ga0114129_10014134
698 Ga0114129_10017722
699 Ga0114129_10030544
700 Ga0114129_10042517
701 Ga0114129_10086702
702 Ga0114129_10086916
703 Ga0114129_10189438
704 Ga0114129_10274502
705 Ga0114129_10560124
706 Ga0105243_10020299
707 Ga0105243_10039267
708 Ga0105243_10162217
709 Ga0105243_10191411
710 Ga0105242_10009175
711 Ga0105242_10013615
712 Ga0105248_10009460
713 Ga0105248_10020526
714 Ga0105248_10129297
715 Ga0105249_10019962
716 Ga0105249_10251719
717 Ga0105249_10352524
718 Ga0157374_10031300
719 Ga0157374_10083827
720 Ga0157378_10071772
721 Ga0157378_10085368
722 Ga0157378_10217961
723 Ga0157375_10067611
724 Ga0163163_10017165
725 Ga0163163_10031366
726 Ga0163163_10049496
727 Ga0163163_10066895
728 Ga0163163_10440878
729 Ga0157380_10011586
730 Ga0157380_10012703
731 Ga0157380_10030470
732 Ga0157380_10054559
733 Ga0157380_10082645
734 Ga0157380_10147977
735 Ga0157380_10357293
736 Ga0157377_10031057
737 Ga0157379_10013873
738 Ga0157379_10082940
739 Ga0157379_10168243
740 Ga0157376_10010717
741 Ga0157376_10144492
742 Ga0157376_10146625
743 Ga0163161_10188914
744 Ga0207653_10019417
745 Ga0207710_10078287
746 Ga0207680_10056590
747 Ga0207680_10099441
748 Ga0207699_10004735
749 Ga0207645_10001127
750 Ga0207645_10093123
751 Ga0207643_10001393
752 Ga0207643_10012751
753 Ga0207643_10104654
754 Ga0207684_10100131
755 Ga0207684_10214791
756 Ga0207707_10015793
757 Ga0207707_10100527
758 Ga0207660_10088118
759 Ga0207660_10147104
760 Ga0207660_10270887
761 Ga0207662_10025658
762 Ga0207662_10036541
763 Ga0207657_10011612
764 Ga0207649_10070528
765 Ga0207652_10110528
766 Ga0207646_10039575
767 Ga0207646_10343460
768 Ga0207681_10001212
769 Ga0207681_10028625
770 Ga0207681_10042381
771 Ga0207681_10106335
772 Ga0207650_10093840
773 Ga0207650_10171569
774 Ga0207659_10000188
775 Ga0207659_10007454
776 Ga0207659_10091482
777 Ga0207687_10052748
778 Ga0207700_10012599
779 Ga0207644_10022641
780 Ga0207690_10162855
781 Ga0207706_10068160
782 Ga0207706_10116616
783 Ga0207686_10055481
784 Ga0207709_10071090
785 Ga0207709_10080381
786 Ga0207709_10225944
787 Ga0207670_10004537
788 Ga0207670_10028608
789 Ga0207670_10034353
790 Ga0207669_10015282
791 Ga0207704_10007205
792 Ga0207704_10081980
793 Ga0207691_10029953
794 Ga0207691_10071556
795 Ga0207691_10149979
796 Ga0207711_10007457
797 Ga0207711_10047114
798 Ga0207711_10067498
799 Ga0207711_10076039
800 Ga0207689_10055559
801 Ga0207689_10143106
802 Ga0207689_10220029
803 Ga0207679_10047809
804 Ga0207679_10242863
805 Ga0207667_10121824
806 Ga0207651_10010774
807 Ga0207651_10050471
808 Ga0207651_10174425
809 Ga0207712_10094453
810 Ga0207668_10027120
811 Ga0207640_10031314
812 Ga0207640_10137408
813 Ga0207703_10037804
814 Ga0207703_10053494
815 Ga0207639_10248505
816 Ga0207708_10021002
817 Ga0207708_10032018
818 Ga0207708_10035743
819 Ga0207708_10208081
820 Ga0207702_10020533
821 Ga0207641_10007307
822 Ga0207641_10281549
823 Ga0207648_10001673
824 Ga0207648_10009704
825 Ga0207648_10081496
826 Ga0207648_10085002
827 Ga0207676_10013381
828 Ga0207676_10019750
829 Ga0207676_10071582
830 Ga0207674_10006964
831 Ga0207675_100016948
832 Ga0207675_100025648
833 Ga0207675_100036001
834 Ga0207675_100042903
835 Ga0207675_100086496
836 Ga0207675_100127883
837 Ga0207675_100157222
838 Ga0207675_100213124
839 Ga0207683_10072747
840 Ga0207683_10121368
841 Ga0207428_10000026
842 Ga0207428_10000319
843 Ga0207428_10001344
844 Ga0207428_10008335
845 Ga0207428_10021167
846 Ga0207428_10051677
847 Ga0268266_10022883
848 Ga0268266_10042195
849 Ga0268265_10000618
850 Ga0268265_10032416
851 Ga0268264_10068812
852 Ga0265318_10027180
853 Ga0265336_10011428
854 Ga0265314_10014222
855 Ga0265314_10062200
856 Ga0307405_10048790
857 Ga0307413_10012898
858 Ga0307410_10004658
859 Ga0307410_10015855
860 Ga0307410_10085150
861 Ga0307410_10132213
862 Ga0307406_10003443
863 Ga0307407_10000594
864 Ga0307407_10002881
865 Ga0307407_10115084
866 Ga0307412_10023355
867 Ga0307412_10161075
868 Ga0307409_100004132
869 Ga0307409_100130439
870 Ga0307416_100001749
871 Ga0307416_100010946
872 Ga0307416_100026028
873 Ga0307416_100082874
874 Ga0307411_10004812
875 Ga0307411_10045368
876 Ga0307411_10048334
877 Ga0307411_10200110
878 Ga0307411_10232701
879 Ga0307415_100000792
880 Ga0373934_0012475
881 Ga0373936_0093920
882 Ga0373941_0003435
883 Ga0373945_0009789
884 Ga0373945_0012515
885 Ga0373956_0082597
886 Ga0373943_0029545
887 Ga0373924_0023620
888 Ga0373935_0013430
889 Ga0373935_0151450
890 Ga0373947_0088331
891 Ga0373937_0019372
892 Ga0373937_0029155
893 Ga0373925_0003038
894 Ga0439450_021371
895 Ga0439435_0000707
896 Ga0439435_0005481
897 Ga0451576_0004119
898 Ga0451576_0033485
899 Ga0451576_0087899
900 Ga0466967_0283988
901 Ga0495603_0006301
902 Ga0495629_0085276
903 Ga0495582_0059902
904 Ga0495662_0069018
905 Ga0495594_0007743
906 Ga0495594_0155658
907 Ga0495608_0016159
908 Ga0495630_0011908
909 Ga0495663_0018674
910 Ga0495642_0013170
911 Ga0495652_0016588
912 Ga0495598_0016800
913 Ga0495609_0020285
914 Ga0495621_0001780
915 Ga0495621_0005952
916 Ga0495621_0010567
917 Ga0495621_0013671
918 Ga0495645_0037167
919 Ga0495634_0128133
920 Ga0495659_0004533
921 Ga0495659_0011402
922 Ga0495659_0022810
923 Ga0495659_0023239
924 Ga0495659_0056516
925 Ga0495588_0028140
926 Ga0495669_0013119
927 Ga0495613_0000270
928 Ga0495604_0010810
929 Ga0495636_0019808
930 Ga0495674_0004142
931 Ga0495674_0188884
932 Ga0495676_0016670
933 Ga0495684_0000011
934 Ga0496101_0153451
935 Ga0496104_0286344
936 Ga0496104_0364110
937 Ga0496104_0398374
938 Ga0496107_0290062
939 Ga0496108_0049339
940 Ga0496108_0051540
941 Ga0496108_0076481
942 Ga0496109_0056590
943 Ga0496112_0036226
944 Ga0496113_0109829
945 Ga0496114_0088590
946 Ga0496114_0284535
947 Ga0501033_0122526
948 Ga0501036_0010626
949 Ga0501036_0072457
950 Ga0501036_0175907
951 Ga0501038_0019145
952 Ga0501040_0000719
953 Ga0501041_0055648
954 Ga0501042_0006212
955 Ga0501042_0010100
956 Ga0501042_0150126
957 Ga0501046_0002475
958 Ga0501046_0057811
959 Ga0501047_0064780
960 Ga0501068_0042903
961 Ga0501071_0007286
962 Ga0501071_0008594
963 Ga0501072_0012525
964 Ga0501072_0025698
965 Ga0501072_0079596
966 Ga0501073_0002679
967 Ga0501075_0000043
968 Ga0501075_0030526
969 Ga0501075_0129667
970 Ga0501075_0218535
971 Ga0501076_0061193
972 Ga0501077_0007615
973 Ga0501077_0160811
974 Ga0501079_0001578
975 Ga0501079_0075165
976 Ga0501079_0094540
977 Ga0501081_0002138
978 Ga0501035_0084172
979 Ga0501045_0016266
980 Ga0501045_0044965
981 Ga0501045_0080247
982 nmdc:mga05p37_124218_c1
983 nmdc:mga05p37_14340_c1
984 nmdc:mga05p37_179975_c1
985 nmdc:mga05p37_21858_c2
986 nmdc:mga05p37_228117_c1
987 nmdc:mga05p37_29565_c1
988 nmdc:mga05p37_3618_c1
989 nmdc:mga05p37_49197_c1
990 nmdc:mga05p37_644_c1
991 nmdc:mga05p37_9709_c1
992 nmdc:mga09592_11229_c1
993 nmdc:mga0qj67_2070_c1
994 nmdc:mga0qj67_21426_c1
995 nmdc:mga0qj67_81320_c1
996 nmdc:mga06r32_3246_c1
997 nmdc:mga06r32_72230_c1
998 nmdc:mga08y16_1387_c1
999 nmdc:mga08y16_13945_c1
1000 nmdc:mga08y16_144609_c1
1001 nmdc:mga08y16_208867_c1
1002 nmdc:mga08y16_2_c1
1003 nmdc:mga08y16_34796_c1
1004 nmdc:mga08y16_385233_c1
1005 nmdc:mga08y16_64032_c1
1006 nmdc:mga08y16_8286_c1
1007 nmdc:mga08y16_86164_c1
1008 nmdc:mga0n895_18715_c1
1009 nmdc:mga0n895_361552_c1
1010 nmdc:mga0n895_7444_c1
1011 nmdc:mga0rr50_11809_c1
1012 nmdc:mga0rr50_248211_c1
1013 nmdc:mga0rr50_70316_c1
1014 nmdc:mga08x19_18047_c1
1015 nmdc:mga08x19_31050_c1
1016 nmdc:mga0a205_14352_c1
1017 nmdc:mga0a205_15836_c2
1018 nmdc:mga0a205_34268_c1
1019 nmdc:mga0a205_432220_c1
1020 nmdc:mga0a205_68050_c1
1021 nmdc:mga0a205_71176_c1
1022 Ga0495601_0010849
1023 Ga0495601_0013734
1024 Ga0495601_0035949
1025 Ga0495619_0002253
1026 Ga0495619_0012337
1027 Ga0500556_0047735
1028 Ga0501084_0010055
1029 Ga0501084_0024503
1030 Ga0590071_000006
1031 Ga0590071_001300
1032 Ga0590071_010383
1033 Ga0590074_001634
1034 Ga0590075_000335
1035 Ga0590075_008589
1036 Ga0590077_000034
1037 Ga0590077_001330
1038 Ga0501082_0045164
1039 Ga0530510_0016549
1040 Ga0530510_0052935
1041 Ga0530510_0094501
1042 Ga0530510_0154460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

63

206

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7u-assembly1.cif.gz_A 2.3 a structure of putative catechol degradative operon regulator from rhodococcus sp. rha1 0.7797 283 349
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.7656 5 365
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.74 5 365
1omi-assembly3.cif.gz_A crystal structure of prfa,the transcriptional regulator in listeria monocytogenes 0.7357 325 365
6ob1-assembly1.cif.gz_C structure of whb in complex with ubiquitin variant 0.7128 285 349
ID Description Score Start End Superfamily
af_P0A7A7_281_425_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8932 70 203 3.40.50.620
af_P9WI59_103_242_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.874 72 203 3.40.50.620
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8657 71 197 3.40.50.620
af_Q9HCL2_203_355_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8594 71 203 3.40.50.620
af_Q9Y137_236_387_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8568 71 203 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6A7L7D4-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.961 1 368 GO:0008374
GO:0012505
AF-A0A2E6ZYN2-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.959 3 374 GO:0008374
GO:0012505
AF-A0A2E4FML4-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9572 61 374 GO:0008374
GO:0012505
AF-A0A3N5P707-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9564 3 374 GO:0008374
GO:0012505
AF-A0A2E6ZYN2-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9515 3 374 GO:0008374
GO:0012505

Map