F458605

General Info

Members Datasets Scaffolds Average Seq Length
520 319 1012 191

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0063109|Ga0501033_0063109_1158_1805
Length 215
Sequence VRFRAAPDAQDTSSSTIPGRTSIMGVTLAKGGNVSLSKAAPNLTNVLVGLGWDARSTTGAPFDLDASALLCSGANRVLGDEWFVFYNQLKSPDGSVEHTGDNLTGEGEGDDETILVDLAKVPPQCEKIVFPVSIHMADERGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGELYRYQGEWKFRAVGQGYASGLRGIALDFGVNVS

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
44 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
98 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
99 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
100 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
101 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
106 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
109 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
115 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
116 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
117 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
118 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
119 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
120 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
121 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
237 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
240 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
241 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
242 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
246 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
252 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
253 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
254 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
255 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
256 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
257 2643221548 Streptomyces sp. Root55 Isolate Unclassified
258 2643221578 Streptomyces sp. Root63 Isolate Unclassified
259 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
260 2643221670 Streptomyces sp. Root431 Isolate Unclassified
261 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
262 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
263 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
264 2643221692 Nocardia sp. Root136 Isolate Unclassified
265 2643221714 Streptomyces sp. Root264 Isolate Unclassified
266 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
267 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
268 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
269 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
270 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
271 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
272 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
273 2808606448 Streptomyces sp. 193411 Isolate Unclassified
274 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
275 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
276 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
277 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
278 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
279 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
280 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
281 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
282 2862574272 Streptomyces sp. AcE210 Isolate Nodule
283 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
284 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
285 2867475112 Streptomyces sp. TM32 Isolate Unclassified
286 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
287 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
288 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
289 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
290 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
291 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
292 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
293 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
294 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
295 2922554459 Rhodococcus sp. 66b Isolate Unclassified
296 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
297 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
298 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
299 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
300 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
301 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
302 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
303 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
304 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
305 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
306 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
307 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
308 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
309 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
310 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
311 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
312 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
313 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
314 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
315 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
316 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
317 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
318 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
319 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.88
Metatranscriptomes 5.38
Isolates 16.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0.58
Rhizoplane 6.15
Rhizosphere 71.35
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0063109 3300049570 Bacteria 2727
2 JGI24739J22299_10004389 3300001989 Bacteria 5401
3 JGI24738J21930_10002000 3300002075 Bacteria 5475
4 JGI25153J46596_10060586 3300003215 Bacteria 1030
5 rootH1_10064527 3300003316 Bacteria 1002
6 rootH2_10073453 3300003320 Bacteria 2355
7 rootL2_10076609 3300003322 Bacteria 2424
8 rootL2_10115488 3300003322 Bacteria 1653
9 rootH1_10006727 3300003323 Bacteria 4790
10 JGI25160J50197_1036463 3300003354 Bacteria 1192
11 JGI25160J50197_1044259 3300003354 Bacteria 995
12 Ga0058863_11797955 3300004799 Bacteria 1232
13 Ga0058863_11918979 3300004799 Bacteria 934
14 Ga0058861_11947018 3300004800 Bacteria 844
15 Ga0058860_11977955 3300004801 Bacteria 923
16 Ga0070670_100628686 3300005331 Bacteria 962
17 Ga0070682_100849529 3300005337 Bacteria 746
18 Ga0070688_100138063 3300005365 Bacteria 1653
19 Ga0070696_100001573 3300005546 Bacteria 14951
20 Ga0068855_100228422 3300005563 Bacteria 2085
21 Ga0068855_101125395 3300005563 Bacteria 820
22 Ga0068854_100695693 3300005578 Bacteria 877
23 Ga0068856_100378348 3300005614 Bacteria 1435
24 Ga0068852_100007953 3300005616 Bacteria 7773
25 Ga0068859_100002859 3300005617 Bacteria 17517
26 Ga0081455_10062375 3300005937 Bacteria 3133
27 Ga0081539_10100593 3300005985 Bacteria 1474
28 Ga0075365_10058258 3300006038 Bacteria 2572
29 Ga0075367_10412168 3300006178 Bacteria 855
30 Ga0075367_10457802 3300006178 Bacteria 809
31 Ga0097620_100002859 3300006931 Bacteria 17517
32 Ga0105251_10025339 3300009011 Bacteria 3035
33 Ga0105250_10085309 3300009092 Bacteria 1282
34 Ga0105240_10018286 3300009093 Bacteria 9420
35 Ga0105245_10035546 3300009098 Bacteria 4422
36 Ga0105245_11040124 3300009098 Bacteria 864
37 Ga0105247_10006083 3300009101 Bacteria 7501
38 Ga0105247_10535160 3300009101 Bacteria 859
39 Ga0105241_11751363 3300009174 Bacteria 605
40 Ga0105237_10096399 3300009545 Bacteria 2948
41 Ga0105237_10243787 3300009545 Bacteria 1798
42 Ga0105238_10576153 3300009551 Bacteria 1132
43 Ga0105239_10050099 3300010375 Bacteria 4581
44 Ga0105239_11361399 3300010375 Bacteria 819
45 Ga0157374_10146881 3300013296 Bacteria 2290
46 Ga0157374_10313101 3300013296 Bacteria 1554
47 Ga0157372_10109059 3300013307 Bacteria 3169
48 Ga0157372_10435257 3300013307 Bacteria 1529
49 Ga0157372_10825804 3300013307 Bacteria 1076
50 Ga0157375_10220087 3300013308 Bacteria 2057
51 Ga0157375_11295457 3300013308 Bacteria 856
52 Ga0163163_10430137 3300014325 Bacteria 1379
53 Ga0157376_10084912 3300014969 Bacteria 2727
54 Ga0197907_10314402 3300020069 Bacteria 1063
55 Ga0197907_10502508 3300020069 Bacteria 2451
56 Ga0206356_10888047 3300020070 Bacteria 3852
57 Ga0206355_1507932 3300020076 Bacteria 1003
58 Ga0206351_10331716 3300020077 Bacteria 706
59 Ga0206352_10095512 3300020078 Bacteria 2054
60 Ga0206352_10635133 3300020078 Bacteria 667
61 Ga0206350_10334124 3300020080 Bacteria 1902
62 Ga0206354_10429769 3300020081 Bacteria 2730
63 Ga0206354_10627402 3300020081 Bacteria 843
64 Ga0206353_10584597 3300020082 Bacteria 8649
65 Ga0154015_1667376 3300020610 Bacteria 906
66 Ga0224712_10017027 3300022467 Bacteria 2401
67 Ga0224712_10043731 3300022467 Bacteria 1704
68 Ga0224712_10077376 3300022467 Bacteria 1365
69 Ga0224712_10235786 3300022467 Bacteria 841
70 Ga0256744_152369 3300023309 Bacteria 1082
71 Ga0209758_1005060 3300025297 Bacteria 10460
72 Ga0207426_1003062 3300025302 Bacteria 9626
73 Ga0207710_10012885 3300025900 Bacteria 3522
74 Ga0207647_10014586 3300025904 Bacteria 5414
75 Ga0207654_10762081 3300025911 Bacteria 698
76 Ga0207671_10188671 3300025914 Bacteria 1607
77 Ga0207652_10073536 3300025921 Bacteria 2974
78 Ga0207687_10018769 3300025927 Bacteria 4571
79 Ga0207687_10313913 3300025927 Bacteria 1267
80 Ga0207664_10338061 3300025929 Bacteria 1331
81 Ga0207709_10007535 3300025935 Bacteria 6048
82 Ga0207709_11193360 3300025935 Bacteria 627
83 Ga0207669_10235601 3300025937 Bacteria 1354
84 Ga0207661_10060904 3300025944 Bacteria 3048
85 Ga0207667_10234370 3300025949 Bacteria 1879
86 Ga0207640_10344542 3300025981 Bacteria 1195
87 Ga0207639_10202210 3300026041 Bacteria 1704
88 Ga0207639_11041032 3300026041 Bacteria 767
89 Ga0207678_10325492 3300026067 Bacteria 1323
90 Ga0207698_10006477 3300026142 Bacteria 7309
91 Ga0207698_10892595 3300026142 Bacteria 896
92 Ga0209371_1020434 3300027312 Bacteria 1631
93 Ga0268266_10414268 3300028379 Bacteria 1276
94 Ga0307517_10001523 3300028786 Bacteria 38580
95 Ga0307517_10012448 3300028786 Bacteria 11669
96 Ga0307517_10235549 3300028786 Bacteria 1093
97 Ga0307515_10030929 3300028794 Bacteria 8959
98 Ga0307515_10040409 3300028794 Bacteria 7375
99 Ga0268256_1022862 3300030500 Bacteria 1633
100 Ga0307511_10052075 3300030521 Bacteria 3268
101 Ga0307511_10074803 3300030521 Bacteria 2438
102 Ga0265327_10001096 3300031251 Bacteria 37556
103 Ga0307513_10012203 3300031456 Bacteria 10622
104 Ga0307513_10241268 3300031456 Bacteria 1612
105 Ga0307509_10120765 3300031507 Bacteria 2598
106 Ga0307509_10213165 3300031507 Bacteria 1753
107 Ga0307408_100633771 3300031548 Bacteria 954
108 Ga0307508_10008912 3300031616 Bacteria 9246
109 Ga0307508_10044489 3300031616 Bacteria 3971
110 Ga0307508_10330444 3300031616 Bacteria 1116
111 Ga0307514_10124365 3300031649 Bacteria 1791
112 Ga0307514_10274476 3300031649 Bacteria 972
113 Ga0307516_10068674 3300031730 Bacteria 3412
114 Ga0307405_10078499 3300031731 Bacteria 2149
115 Ga0307413_10563585 3300031824 Bacteria 926
116 Ga0307518_10074840 3300031838 Bacteria 2448
117 Ga0307410_10073530 3300031852 Bacteria 2377
118 Ga0307407_10188159 3300031903 Bacteria 1374
119 Ga0307412_10132787 3300031911 Bacteria 1811
120 Ga0307416_100189387 3300032002 Bacteria 1938
121 Ga0307415_100076402 3300032126 Bacteria 2374
122 Ga0307507_10097007 3300033179 Bacteria 2489
123 Ga0307510_10077002 3300033180 Bacteria 3275
124 Ga0307510_10135431 3300033180 Bacteria 2122
125 Ga0307510_10354738 3300033180 Bacteria 916
126 Ga0307510_10419439 3300033180 Bacteria 780
127 Ga0316592_1015489 3300033524 Unclassified 1588
128 Ga0395899_0229879 3300037312 Bacteria 1281
129 Ga0395900_0033438 3300037418 Bacteria 5292
130 Ga0395898_0005295 3300037466 Bacteria 13949
131 Ga0395898_0136881 3300037466 Bacteria 2345
132 Ga0395901_0164432 3300038443 Bacteria 2330
133 Ga0395901_0685012 3300038443 Bacteria 1024
134 Ga0439436_0002787 3300041404 Bacteria 5286
135 Ga0439436_0006279 3300041404 Bacteria 3649
136 Ga0439439_0000579 3300041406 Bacteria 6400
137 Ga0439439_0057492 3300041406 Bacteria 1029
138 Ga0451787_210864 3300041441 Bacteria 831
139 Ga0451789_0738776 3300041443 Bacteria 1361
140 Ga0451794_12656 3300041446 Bacteria 947
141 Ga0451791_1156465 3300041451 Bacteria 780
142 Ga0451791_1861924 3300041451 Bacteria 1120
143 Ga0451797_1143015 3300041453 Bacteria 795
144 Ga0451802_0077486 3300041460 Bacteria 1319
145 Ga0451837_0283319 3300041494 Bacteria 1401
146 Ga0451841_1309315 3300041498 Bacteria 1058
147 Ga0451853_2486755 3300041512 Bacteria 1325
148 Ga0451853_2566164 3300041512 Bacteria 3047
149 Ga0451853_2965109 3300041512 Bacteria 1783
150 Ga0451853_3707679 3300041512 Bacteria 828
151 Ga0439433_0022707 3300041999 Bacteria 1409
152 Ga0439442_007448 3300042002 Bacteria 2200
153 Ga0439448_0006662 3300042005 Bacteria 3328
154 Ga0439449_0002117 3300042007 Bacteria 7792
155 Ga0439449_0047442 3300042007 Bacteria 1590
156 Ga0439457_000026 3300042014 Bacteria 29814
157 Ga0439457_000712 3300042014 Bacteria 9856
158 Ga0439462_0003344 3300042015 Bacteria 3840
159 Ga0450894_001249 3300042131 Bacteria 3728
160 Ga0450896_003131 3300042133 Bacteria 2179
161 Ga0450898_000118 3300042134 Bacteria 7563
162 Ga0450899_002347 3300042135 Bacteria 2053
163 Ga0450900_030461 3300042136 Bacteria 783
164 Ga0450903_013234 3300042138 Bacteria 1313
165 Ga0450903_015322 3300042138 Bacteria 1208
166 Ga0450906_003712 3300042145 Bacteria 3249
167 Ga0450908_011841 3300042184 Bacteria 1590
168 Ga0466969_0172047 3300044656 Bacteria 993
169 Ga0466972_0004502 3300044658 Bacteria 6973
170 Ga0466972_0013383 3300044658 Bacteria 4120
171 Ga0466972_0013894 3300044658 Bacteria 4039
172 Ga0466965_0002548 3300044683 Bacteria 7785
173 Ga0466965_0077461 3300044683 Bacteria 1679
174 Ga0466965_0263774 3300044683 Bacteria 926
175 Ga0466966_0000262 3300044684 Bacteria 35143
176 Ga0466966_0058424 3300044684 Bacteria 2437
177 Ga0466966_0120011 3300044684 Bacteria 1616
178 Ga0466966_0264167 3300044684 Bacteria 1036
179 Ga0466961_0000547 3300044693 Bacteria 23953
180 Ga0466961_0170998 3300044693 Bacteria 1351
181 Ga0466961_0227515 3300044693 Bacteria 1148
182 Ga0466963_0000176 3300044694 Bacteria 26457
183 Ga0466963_0014753 3300044694 Bacteria 4823
184 Ga0466963_0050797 3300044694 Bacteria 2745
185 Ga0466964_0071088 3300044706 Bacteria 1472
186 Ga0466964_0149168 3300044706 Bacteria 1082
187 Ga0466971_0000306 3300044719 Bacteria 18885
188 Ga0466968_0244623 3300044735 Bacteria 850
189 Ga0466968_0406757 3300044735 Bacteria 668
190 Ga0466970_0000912 3300044765 Bacteria 14276
191 Ga0466970_0001700 3300044765 Bacteria 10580
192 Ga0466970_0214080 3300044765 Bacteria 1074
193 Ga0466957_0000275 3300044842 Bacteria 24997
194 Ga0466960_0003328 3300044901 Bacteria 6165
195 Ga0466960_0089801 3300044901 Bacteria 1564
196 Ga0466960_0176702 3300044901 Bacteria 1155
197 Ga0466960_0183422 3300044901 Bacteria 1135
198 Ga0466959_0000453 3300045049 Bacteria 23862
199 Ga0466959_0092773 3300045049 Bacteria 2167
200 Ga0466959_0241368 3300045049 Bacteria 1248
201 Ga0466959_0469993 3300045049 Bacteria 852
202 Ga0466958_0010897 3300045836 Bacteria 5105
203 Ga0466958_0066858 3300045836 Bacteria 2195
204 Ga0466967_0011426 3300045976 Bacteria 6723
205 Ga0466967_0013864 3300045976 Bacteria 6250
206 Ga0466967_0017870 3300045976 Bacteria 5649
207 Ga0466967_0042991 3300045976 Bacteria 3910
208 Ga0466967_0070256 3300045976 Bacteria 3132
209 Ga0466967_0085445 3300045976 Bacteria 2857
210 Ga0466967_0093734 3300045976 Bacteria 2733
211 Ga0466967_0117851 3300045976 Bacteria 2448
212 Ga0466967_0489560 3300045976 Bacteria 1206
213 Ga0466967_0581500 3300045976 Bacteria 1104
214 Ga0466967_0867912 3300045976 Bacteria 897
215 Ga0495627_122789 3300046453 Bacteria 733
216 Ga0495592_0003306 3300046454 Bacteria 11552
217 Ga0495603_0012450 3300046455 Bacteria 5149
218 Ga0495603_0020679 3300046455 Bacteria 3986
219 Ga0495603_0056101 3300046455 Bacteria 2333
220 Ga0495603_0059063 3300046455 Bacteria 2267
221 Ga0495603_0080685 3300046455 Bacteria 1906
222 Ga0495629_0003639 3300046459 Bacteria 11659
223 Ga0495629_0045370 3300046459 Bacteria 3084
224 Ga0495629_0438698 3300046459 Bacteria 885
225 Ga0495638_0108606 3300046460 Bacteria 1650
226 Ga0495651_0026835 3300046462 Bacteria 4485
227 Ga0495651_0031705 3300046462 Bacteria 4120
228 Ga0495653_0125635 3300046463 Bacteria 1822
229 Ga0495582_0228827 3300046473 Bacteria 1064
230 Ga0495639_0033239 3300046475 Bacteria 2303
231 Ga0495662_0098141 3300046476 Bacteria 1432
232 Ga0495662_0176967 3300046476 Bacteria 1052
233 Ga0495662_0357806 3300046476 Bacteria 717
234 Ga0495664_0002878 3300046477 Bacteria 9275
235 Ga0495585_0013453 3300046492 Bacteria 4788
236 Ga0495585_0219039 3300046492 Bacteria 961
237 Ga0495594_0024609 3300046499 Bacteria 3235
238 Ga0495594_0028394 3300046499 Bacteria 3019
239 Ga0495594_0041613 3300046499 Bacteria 2515
240 Ga0495607_0061691 3300046501 Bacteria 2129
241 Ga0495583_0194036 3300046506 Bacteria 827
242 Ga0495608_0466896 3300046511 Bacteria 767
243 Ga0495618_0014678 3300046514 Bacteria 4776
244 Ga0495618_0064186 3300046514 Bacteria 2333
245 Ga0495628_0050332 3300046516 Bacteria 3295
246 Ga0495631_0067129 3300046518 Bacteria 1552
247 Ga0495652_0023845 3300046529 Bacteria 5420
248 Ga0495640_0007170 3300046533 Bacteria 8779
249 Ga0495640_0033607 3300046533 Bacteria 3642
250 Ga0495640_0036290 3300046533 Bacteria 3483
251 Ga0495587_0004564 3300046536 Bacteria 9091
252 Ga0495587_0252076 3300046536 Bacteria 992
253 Ga0495645_0128811 3300046543 Bacteria 1776
254 Ga0495667_0016398 3300046559 Bacteria 5007
255 Ga0495667_0297716 3300046559 Bacteria 1022
256 Ga0495668_0003711 3300046616 Bacteria 11242
257 Ga0495668_0551387 3300046616 Bacteria 636
258 Ga0495634_0010876 3300046642 Bacteria 6648
259 Ga0495625_0003493 3300046660 Bacteria 15586
260 Ga0495625_0009274 3300046660 Bacteria 8252
261 Ga0495635_0000563 3300046663 Bacteria 23671
262 Ga0495588_0018282 3300046674 Bacteria 3415
263 Ga0495588_0186893 3300046674 Bacteria 1094
264 Ga0495588_0469637 3300046674 Bacteria 660
265 Ga0495657_0026186 3300046675 Bacteria 4131
266 Ga0495657_0039076 3300046675 Bacteria 3262
267 Ga0495599_0092503 3300046678 Bacteria 1887
268 Ga0495623_0085582 3300046679 Bacteria 1944
269 Ga0495646_0019844 3300046680 Bacteria 4251
270 Ga0495646_0041737 3300046680 Bacteria 2817
271 Ga0495658_0128232 3300046683 Bacteria 1542
272 Ga0495658_0182834 3300046683 Bacteria 1301
273 Ga0495613_0013564 3300046689 Bacteria 6050
274 Ga0495624_0010572 3300046690 Bacteria 6359
275 Ga0495670_0120395 3300046691 Bacteria 1363
276 Ga0495671_0005352 3300046692 Bacteria 7530
277 Ga0495589_0004951 3300046794 Bacteria 7057
278 Ga0495589_0007558 3300046794 Bacteria 5695
279 Ga0495589_0322742 3300046794 Bacteria 713
280 Ga0495600_0023168 3300046809 Bacteria 3993
281 Ga0495600_0048000 3300046809 Bacteria 2785
282 Ga0495600_0189576 3300046809 Bacteria 1323
283 Ga0495600_0271473 3300046809 Bacteria 1076
284 Ga0495581_0004731 3300047315 Bacteria 7857
285 Ga0495581_0072894 3300047315 Bacteria 1987
286 Ga0495581_0164684 3300047315 Bacteria 1296
287 Ga0495581_0564386 3300047315 Bacteria 660
288 Ga0495604_0000177 3300047317 Bacteria 56559
289 Ga0495604_0019851 3300047317 Bacteria 5376
290 Ga0495604_0027712 3300047317 Bacteria 4505
291 Ga0495604_0030719 3300047317 Bacteria 4265
292 Ga0495604_0076542 3300047317 Bacteria 2516
293 Ga0495636_0040070 3300047318 Bacteria 1941
294 Ga0495674_0139097 3300047319 Bacteria 2042
295 Ga0495676_0002684 3300047321 Bacteria 15938
296 Ga0495676_0003140 3300047321 Bacteria 14944
297 Ga0495680_0250191 3300047322 Bacteria 1256
298 Ga0495687_000989 3300047443 Bacteria 28561
299 Ga0495687_005687 3300047443 Bacteria 7865
300 Ga0495675_0020811 3300047444 Bacteria 4175
301 Ga0495675_0107432 3300047444 Bacteria 1743
302 Ga0495685_032410 3300047447 Bacteria 1795
303 Ga0495685_055677 3300047447 Bacteria 1337
304 Ga0495685_085331 3300047447 Bacteria 1049
305 Ga0495685_103075 3300047447 Bacteria 941
306 Ga0495681_0001788 3300047470 Bacteria 15829
307 Ga0495681_0058195 3300047470 Bacteria 1791
308 Ga0495593_0002856 3300047673 Bacteria 10408
309 Ga0495602_0065869 3300048088 Bacteria 3124
310 Ga0495602_0449562 3300048088 Bacteria 910
311 Ga0495614_0001819 3300048089 Bacteria 9340
312 Ga0495614_0046084 3300048089 Bacteria 1869
313 Ga0496100_0197233 3300048903 Bacteria 1465
314 Ga0496101_0892406 3300048904 Bacteria 700
315 Ga0496102_0000212 3300048905 Bacteria 77755
316 Ga0496102_0653389 3300048905 Bacteria 975
317 Ga0496103_0000147 3300048906 Bacteria 73208
318 Ga0496104_0002789 3300048907 Bacteria 15050
319 Ga0496105_0042636 3300048908 Bacteria 3741
320 Ga0496105_0642081 3300048908 Bacteria 820
321 Ga0496107_0319398 3300048910 Bacteria 1156
322 Ga0496108_0000815 3300048911 Bacteria 24243
323 Ga0496108_0079363 3300048911 Bacteria 2779
324 Ga0496108_0438535 3300048911 Bacteria 1141
325 Ga0496109_0012233 3300048912 Bacteria 7405
326 Ga0496109_0035331 3300048912 Bacteria 4507
327 Ga0496110_0002794 3300048913 Bacteria 13174
328 Ga0496110_0011927 3300048913 Bacteria 7140
329 Ga0496111_0002161 3300048914 Bacteria 11767
330 Ga0496111_0088951 3300048914 Bacteria 2262
331 Ga0496112_0038278 3300048915 Bacteria 4683
332 Ga0496112_0274747 3300048915 Bacteria 1633
333 Ga0496113_0048914 3300048916 Bacteria 3147
334 Ga0496114_0024894 3300048917 Bacteria 4887
335 Ga0496114_0233830 3300048917 Bacteria 1615
336 Ga0496114_0843047 3300048917 Bacteria 796
337 Ga0496115_0425850 3300048918 Bacteria 1075
338 Ga0496117_0156480 3300048920 Bacteria 1341
339 Ga0496118_0384260 3300048921 Bacteria 735
340 Ga0496119_0027711 3300048922 Bacteria 3886
341 Ga0496125_0048445 3300048928 Bacteria 3543
342 Ga0496125_0222467 3300048928 Bacteria 1215
343 Ga0496126_0000022 3300048929 Bacteria 464393
344 Ga0501304_004733 3300049160 Bacteria 1041
345 Ga0501323_003464 3300049539 Bacteria 1613
346 Ga0501325_025159 3300049541 Bacteria 652
347 Ga0501032_0036927 3300049569 Bacteria 3333
348 Ga0501032_0301007 3300049569 Bacteria 1037
349 Ga0501033_0000315 3300049570 Bacteria 45917
350 Ga0501033_0014548 3300049570 Bacteria 5973
351 Ga0501033_0019979 3300049570 Bacteria 5062
352 Ga0501034_0002686 3300049571 Bacteria 20954
353 Ga0501034_0013420 3300049571 Bacteria 8432
354 Ga0501034_0160407 3300049571 Bacteria 2220
355 Ga0501034_0562800 3300049571 Bacteria 1048
356 Ga0501036_0000081 3300049572 Bacteria 58719
357 Ga0501036_0006500 3300049572 Bacteria 9497
358 Ga0501036_0012967 3300049572 Bacteria 6919
359 Ga0501037_0016097 3300049573 Bacteria 5503
360 Ga0501037_0046880 3300049573 Bacteria 3168
361 Ga0501038_0022166 3300049574 Bacteria 5692
362 Ga0501038_0281437 3300049574 Bacteria 1309
363 Ga0501039_0027509 3300049575 Bacteria 4372
364 Ga0501039_0112859 3300049575 Bacteria 2125
365 Ga0501042_0042488 3300049578 Bacteria 3236
366 Ga0501043_0049472 3300049579 Bacteria 3304
367 Ga0501043_0051417 3300049579 Bacteria 3237
368 Ga0501043_0247562 3300049579 Bacteria 1373
369 Ga0501046_0040251 3300049580 Bacteria 3736
370 Ga0501046_0089095 3300049580 Bacteria 2375
371 Ga0501046_0242374 3300049580 Bacteria 1329
372 Ga0501046_0540142 3300049580 Bacteria 832
373 Ga0501047_0019313 3300049581 Bacteria 6538
374 Ga0501047_0105696 3300049581 Bacteria 2695
375 Ga0501047_0271482 3300049581 Bacteria 1542
376 Ga0501048_0004349 3300049582 Bacteria 10780
377 Ga0501048_0076714 3300049582 Bacteria 2358
378 Ga0501070_0056402 3300049586 Bacteria 3256
379 Ga0501070_0072187 3300049586 Bacteria 2857
380 Ga0501070_0099273 3300049586 Bacteria 2409
381 Ga0501070_0652196 3300049586 Bacteria 836
382 Ga0501071_0918302 3300049587 Bacteria 676
383 Ga0501074_0000299 3300049590 Bacteria 28549
384 Ga0501080_0549262 3300049742 Bacteria 1029
385 Ga0501279_034899 3300049775 Bacteria 756
386 Ga0501035_0001623 3300049822 Bacteria 22760
387 Ga0501035_0148884 3300049822 Bacteria 2032
388 Ga0501044_0003629 3300049823 Bacteria 17366
389 Ga0501044_0014128 3300049823 Bacteria 8620
390 Ga0501044_0037386 3300049823 Bacteria 5074
391 Ga0501044_0055231 3300049823 Bacteria 4079
392 Ga0501044_0300093 3300049823 Bacteria 1535
393 Ga0501044_0434559 3300049823 Bacteria 1221
394 Ga0501044_0520217 3300049823 Bacteria 1089
395 Ga0501045_0223687 3300049824 Bacteria 1401
396 Ga0501045_0225700 3300049824 Bacteria 1394
397 nmdc:mga03n38_14468_c1 3300050490 Bacteria 3024
398 nmdc:mga06z11_153840_c1 3300050494 Bacteria 1309
399 nmdc:mga06z11_364042_c1 3300050494 Bacteria 867
400 nmdc:mga07m45_248905_c1 3300050496 Bacteria 1034
401 Ga0495612_0094634 3300053078 Bacteria 1268
402 Ga0500610_0233157 3300053079 Bacteria 862
403 Ga0500610_0292167 3300053079 Bacteria 724
404 Ga0495655_0079659 3300053083 Bacteria 934
405 Ga0495619_0105572 3300053085 Bacteria 1921
406 Ga0495619_0227391 3300053085 Bacteria 1292
407 Ga0500578_0230649 3300053086 Bacteria 1122
408 Ga0500640_133700 3300053095 Bacteria 973
409 Ga0500553_195819 3300053101 Bacteria 700
410 Ga0500560_019942 3300053107 Bacteria 1894
411 Ga0500572_077761 3300053111 Bacteria 1035
412 Ga0500559_0251496 3300053136 Bacteria 833
413 Ga0500573_0349828 3300053140 Bacteria 718
414 Ga0500624_040118 3300053157 Bacteria 838
415 Ga0500636_0225599 3300053177 Bacteria 973
416 Ga0587106_007200 3300059605 Bacteria 1343
417 Ga0587062_037770 3300059639 Bacteria 770
418 Ga0466962_0001438 3300061719 Bacteria 11099
419 Ga0466962_0085993 3300061719 Bacteria 1505
420 2547407788 2547132111 Bacteria 8013147
421 2552110581 2551306166 Bacteria 9731570
422 2554258762 2554235005 Bacteria 6457341
423 2566993050 2565956761 Bacteria 6601618
424 2585312949 2582581314 Bacteria 11452267
425 2585313221 2582581314 Bacteria 11452267
426 2617919273 2617270889 Bacteria 9064343
427 2643762539 2643221548 Bacteria 8053412
428 2643904867 2643221578 Bacteria 9213798
429 2643944891 2643221587 Bacteria 7586415
430 2644385160 2643221670 Bacteria 6497041
431 2644402925 2643221673 Bacteria 9196637
432 2644431790 2643221677 Bacteria 7584031
433 2644460510 2643221682 Bacteria 6743283
434 2644513868 2643221692 Bacteria 7282860
435 2644632048 2643221714 Bacteria 9015452
436 2738892170 2738541308 Bacteria 7020677
437 2768643102 2767802112 Bacteria 6465194
438 2768643496 2767802112 Bacteria 6465194
439 2784470814 2784132109 Bacteria 3141763
440 2784592433 2784132148 Bacteria 8627943
441 2785344632 2784746763 Bacteria 9783172
442 2785366406 2784746768 Bacteria 10036182
443 2785368266 2784746768 Bacteria 10036182
444 2804846508 2802429296 Bacteria 7227771
445 2809236064 2808606448 Bacteria 8656184
446 2811845458 2808606982 Bacteria 7791042
447 2811847940 2808606982 Bacteria 7791042
448 2812359279 2811994879 Bacteria 9313447
449 2812360893 2811994879 Bacteria 9313447
450 2812479980 2811994917 Bacteria 7761064
451 2812481446 2811994917 Bacteria 7761064
452 2842892385 2842888712 Bacteria 4279094
453 2852640775 2852635781 Bacteria 8251373
454 2862180856 2862178590 Bacteria 8583590
455 2862182691 2862178590 Bacteria 8583590
456 2862388088 2862382967 Bacteria 10317375
457 2862513969 2862507626 Bacteria 9425308
458 2862513970 2862507626 Bacteria 9425308
459 2862515768 2862507626 Bacteria 9425308
460 2862582617 2862574272 Bacteria 10567477
461 2863405896 2863404153 Bacteria 9672205
462 2863405897 2863404153 Bacteria 9672205
463 2867348914 2867346516 Bacteria 7608576
464 2867476221 2867475112 Bacteria 6909112
465 2873158152 2873151551 Bacteria 8625867
466 2875392336 2875391855 Bacteria 7600475
467 2877682311 2877676314 Bacteria 9512378
468 2904541813 2904535858 Bacteria 6308016
469 2912721208 2912715099 Bacteria 9460473
470 2912725232 2912723979 Bacteria 8557534
471 2912758433 2912757875 Bacteria 7940295
472 2913914372 2913912277 Bacteria 9037797
473 2918501399 2918501144 Bacteria 8668083
474 2918503617 2918501144 Bacteria 8668083
475 2922556107 2922554459 Bacteria 6683962
476 2946052521 2946045630 Bacteria 8527308
477 2946064978 2946064051 Bacteria 8957905
478 2946066606 2946064051 Bacteria 8957905
479 2946074878 2946072368 Bacteria 8999607
480 2947230588 2947224130 Bacteria 9938529
481 2954004004 2954002825 Bacteria 9173742
482 2954387443 2954380949 Bacteria 10050426
483 2990048102 2990044586 Bacteria 6603797
484 2990066728 2990059506 Bacteria 9321252
485 2990066729 2990059506 Bacteria 9321252
486 2990067762 2990059506 Bacteria 9321252
487 2990090985 2990088156 Bacteria 6657676
488 2995467657 2995463766 Bacteria 8577691
489 3003002902 3002998708 Bacteria 11715108
490 3006322019 3006321560 Bacteria 8247479
491 3006427466 3006425503 Bacteria 6491253
492 3006427467 3006425503 Bacteria 6491253
493 3006487173 3006486233 Bacteria 8157040
494 3006492037 3006486233 Bacteria 8157040
495 3006501954 3006493962 Bacteria 8825450
496 8008560730 8008558824 Bacteria 10610750
497 8008579826 8008574985 Bacteria 7815457
498 8008579827 8008574985 Bacteria 7815457
499 8023629102 8023623736 Bacteria 8593882
500 8025419383 8025413630 Bacteria 7014048
501 8025531990 8025530807 Bacteria 8495698
502 8033689904 8033684223 Bacteria 6906479
503 8048407989 8048406513 Bacteria 8936924
504 8048410509 8048406513 Bacteria 8936924
505 8053947033 8053945823 Bacteria 8962862
506 8056836702 8056829672 Bacteria 9045328
507 Ga0501033_0063109
508 JGI24739J22299_10004389
509 JGI24738J21930_10002000
510 JGI25153J46596_10060586
511 rootH1_10064527
512 rootH2_10073453
513 rootL2_10076609
514 rootL2_10115488
515 rootH1_10006727
516 JGI25160J50197_1036463
517 JGI25160J50197_1044259
518 Ga0058863_11797955
519 Ga0058863_11918979
520 Ga0058861_11947018
521 Ga0058860_11977955
522 Ga0070670_100628686
523 Ga0070682_100849529
524 Ga0070688_100138063
525 Ga0070696_100001573
526 Ga0068855_100228422
527 Ga0068855_101125395
528 Ga0068854_100695693
529 Ga0068856_100378348
530 Ga0068852_100007953
531 Ga0068859_100002859
532 Ga0081455_10062375
533 Ga0081539_10100593
534 Ga0075365_10058258
535 Ga0075367_10412168
536 Ga0075367_10457802
537 Ga0097620_100002859
538 Ga0105251_10025339
539 Ga0105250_10085309
540 Ga0105240_10018286
541 Ga0105245_10035546
542 Ga0105245_11040124
543 Ga0105247_10006083
544 Ga0105247_10535160
545 Ga0105241_11751363
546 Ga0105237_10096399
547 Ga0105237_10243787
548 Ga0105238_10576153
549 Ga0105239_10050099
550 Ga0105239_11361399
551 Ga0157374_10146881
552 Ga0157374_10313101
553 Ga0157372_10109059
554 Ga0157372_10435257
555 Ga0157372_10825804
556 Ga0157375_10220087
557 Ga0157375_11295457
558 Ga0163163_10430137
559 Ga0157376_10084912
560 Ga0197907_10314402
561 Ga0197907_10502508
562 Ga0206356_10888047
563 Ga0206355_1507932
564 Ga0206351_10331716
565 Ga0206352_10095512
566 Ga0206352_10635133
567 Ga0206350_10334124
568 Ga0206354_10429769
569 Ga0206354_10627402
570 Ga0206353_10584597
571 Ga0154015_1667376
572 Ga0224712_10017027
573 Ga0224712_10043731
574 Ga0224712_10077376
575 Ga0224712_10235786
576 Ga0256744_152369
577 Ga0209758_1005060
578 Ga0207426_1003062
579 Ga0207710_10012885
580 Ga0207647_10014586
581 Ga0207654_10762081
582 Ga0207671_10188671
583 Ga0207652_10073536
584 Ga0207687_10018769
585 Ga0207687_10313913
586 Ga0207664_10338061
587 Ga0207709_10007535
588 Ga0207709_11193360
589 Ga0207669_10235601
590 Ga0207661_10060904
591 Ga0207667_10234370
592 Ga0207640_10344542
593 Ga0207639_10202210
594 Ga0207639_11041032
595 Ga0207678_10325492
596 Ga0207698_10006477
597 Ga0207698_10892595
598 Ga0209371_1020434
599 Ga0268266_10414268
600 Ga0307517_10001523
601 Ga0307517_10012448
602 Ga0307517_10235549
603 Ga0307515_10030929
604 Ga0307515_10040409
605 Ga0268256_1022862
606 Ga0307511_10052075
607 Ga0307511_10074803
608 Ga0265327_10001096
609 Ga0307513_10012203
610 Ga0307513_10241268
611 Ga0307509_10120765
612 Ga0307509_10213165
613 Ga0307408_100633771
614 Ga0307508_10008912
615 Ga0307508_10044489
616 Ga0307508_10330444
617 Ga0307514_10124365
618 Ga0307514_10274476
619 Ga0307516_10068674
620 Ga0307405_10078499
621 Ga0307413_10563585
622 Ga0307518_10074840
623 Ga0307410_10073530
624 Ga0307407_10188159
625 Ga0307412_10132787
626 Ga0307416_100189387
627 Ga0307415_100076402
628 Ga0307507_10097007
629 Ga0307510_10077002
630 Ga0307510_10135431
631 Ga0307510_10354738
632 Ga0307510_10419439
633 Ga0316592_1015489
634 Ga0395899_0229879
635 Ga0395900_0033438
636 Ga0395898_0005295
637 Ga0395898_0136881
638 Ga0395901_0164432
639 Ga0395901_0685012
640 Ga0439436_0002787
641 Ga0439436_0006279
642 Ga0439439_0000579
643 Ga0439439_0057492
644 Ga0451787_210864
645 Ga0451789_0738776
646 Ga0451794_12656
647 Ga0451791_1156465
648 Ga0451791_1861924
649 Ga0451797_1143015
650 Ga0451802_0077486
651 Ga0451837_0283319
652 Ga0451841_1309315
653 Ga0451853_2486755
654 Ga0451853_2566164
655 Ga0451853_2965109
656 Ga0451853_3707679
657 Ga0439433_0022707
658 Ga0439442_007448
659 Ga0439448_0006662
660 Ga0439449_0002117
661 Ga0439449_0047442
662 Ga0439457_000026
663 Ga0439457_000712
664 Ga0439462_0003344
665 Ga0450894_001249
666 Ga0450896_003131
667 Ga0450898_000118
668 Ga0450899_002347
669 Ga0450900_030461
670 Ga0450903_013234
671 Ga0450903_015322
672 Ga0450906_003712
673 Ga0450908_011841
674 Ga0466969_0172047
675 Ga0466972_0004502
676 Ga0466972_0013383
677 Ga0466972_0013894
678 Ga0466965_0002548
679 Ga0466965_0077461
680 Ga0466965_0263774
681 Ga0466966_0000262
682 Ga0466966_0058424
683 Ga0466966_0120011
684 Ga0466966_0264167
685 Ga0466961_0000547
686 Ga0466961_0170998
687 Ga0466961_0227515
688 Ga0466963_0000176
689 Ga0466963_0014753
690 Ga0466963_0050797
691 Ga0466964_0071088
692 Ga0466964_0149168
693 Ga0466971_0000306
694 Ga0466968_0244623
695 Ga0466968_0406757
696 Ga0466970_0000912
697 Ga0466970_0001700
698 Ga0466970_0214080
699 Ga0466957_0000275
700 Ga0466960_0003328
701 Ga0466960_0089801
702 Ga0466960_0176702
703 Ga0466960_0183422
704 Ga0466959_0000453
705 Ga0466959_0092773
706 Ga0466959_0241368
707 Ga0466959_0469993
708 Ga0466958_0010897
709 Ga0466958_0066858
710 Ga0466967_0011426
711 Ga0466967_0013864
712 Ga0466967_0017870
713 Ga0466967_0042991
714 Ga0466967_0070256
715 Ga0466967_0085445
716 Ga0466967_0093734
717 Ga0466967_0117851
718 Ga0466967_0489560
719 Ga0466967_0581500
720 Ga0466967_0867912
721 Ga0495627_122789
722 Ga0495592_0003306
723 Ga0495603_0012450
724 Ga0495603_0020679
725 Ga0495603_0056101
726 Ga0495603_0059063
727 Ga0495603_0080685
728 Ga0495629_0003639
729 Ga0495629_0045370
730 Ga0495629_0438698
731 Ga0495638_0108606
732 Ga0495651_0026835
733 Ga0495651_0031705
734 Ga0495653_0125635
735 Ga0495582_0228827
736 Ga0495639_0033239
737 Ga0495662_0098141
738 Ga0495662_0176967
739 Ga0495662_0357806
740 Ga0495664_0002878
741 Ga0495585_0013453
742 Ga0495585_0219039
743 Ga0495594_0024609
744 Ga0495594_0028394
745 Ga0495594_0041613
746 Ga0495607_0061691
747 Ga0495583_0194036
748 Ga0495608_0466896
749 Ga0495618_0014678
750 Ga0495618_0064186
751 Ga0495628_0050332
752 Ga0495631_0067129
753 Ga0495652_0023845
754 Ga0495640_0007170
755 Ga0495640_0033607
756 Ga0495640_0036290
757 Ga0495587_0004564
758 Ga0495587_0252076
759 Ga0495645_0128811
760 Ga0495667_0016398
761 Ga0495667_0297716
762 Ga0495668_0003711
763 Ga0495668_0551387
764 Ga0495634_0010876
765 Ga0495625_0003493
766 Ga0495625_0009274
767 Ga0495635_0000563
768 Ga0495588_0018282
769 Ga0495588_0186893
770 Ga0495588_0469637
771 Ga0495657_0026186
772 Ga0495657_0039076
773 Ga0495599_0092503
774 Ga0495623_0085582
775 Ga0495646_0019844
776 Ga0495646_0041737
777 Ga0495658_0128232
778 Ga0495658_0182834
779 Ga0495613_0013564
780 Ga0495624_0010572
781 Ga0495670_0120395
782 Ga0495671_0005352
783 Ga0495589_0004951
784 Ga0495589_0007558
785 Ga0495589_0322742
786 Ga0495600_0023168
787 Ga0495600_0048000
788 Ga0495600_0189576
789 Ga0495600_0271473
790 Ga0495581_0004731
791 Ga0495581_0072894
792 Ga0495581_0164684
793 Ga0495581_0564386
794 Ga0495604_0000177
795 Ga0495604_0019851
796 Ga0495604_0027712
797 Ga0495604_0030719
798 Ga0495604_0076542
799 Ga0495636_0040070
800 Ga0495674_0139097
801 Ga0495676_0002684
802 Ga0495676_0003140
803 Ga0495680_0250191
804 Ga0495687_000989
805 Ga0495687_005687
806 Ga0495675_0020811
807 Ga0495675_0107432
808 Ga0495685_032410
809 Ga0495685_055677
810 Ga0495685_085331
811 Ga0495685_103075
812 Ga0495681_0001788
813 Ga0495681_0058195
814 Ga0495593_0002856
815 Ga0495602_0065869
816 Ga0495602_0449562
817 Ga0495614_0001819
818 Ga0495614_0046084
819 Ga0496100_0197233
820 Ga0496101_0892406
821 Ga0496102_0000212
822 Ga0496102_0653389
823 Ga0496103_0000147
824 Ga0496104_0002789
825 Ga0496105_0042636
826 Ga0496105_0642081
827 Ga0496107_0319398
828 Ga0496108_0000815
829 Ga0496108_0079363
830 Ga0496108_0438535
831 Ga0496109_0012233
832 Ga0496109_0035331
833 Ga0496110_0002794
834 Ga0496110_0011927
835 Ga0496111_0002161
836 Ga0496111_0088951
837 Ga0496112_0038278
838 Ga0496112_0274747
839 Ga0496113_0048914
840 Ga0496114_0024894
841 Ga0496114_0233830
842 Ga0496114_0843047
843 Ga0496115_0425850
844 Ga0496117_0156480
845 Ga0496118_0384260
846 Ga0496119_0027711
847 Ga0496125_0048445
848 Ga0496125_0222467
849 Ga0496126_0000022
850 Ga0501304_004733
851 Ga0501323_003464
852 Ga0501325_025159
853 Ga0501032_0036927
854 Ga0501032_0301007
855 Ga0501033_0000315
856 Ga0501033_0014548
857 Ga0501033_0019979
858 Ga0501034_0002686
859 Ga0501034_0013420
860 Ga0501034_0160407
861 Ga0501034_0562800
862 Ga0501036_0000081
863 Ga0501036_0006500
864 Ga0501036_0012967
865 Ga0501037_0016097
866 Ga0501037_0046880
867 Ga0501038_0022166
868 Ga0501038_0281437
869 Ga0501039_0027509
870 Ga0501039_0112859
871 Ga0501042_0042488
872 Ga0501043_0049472
873 Ga0501043_0051417
874 Ga0501043_0247562
875 Ga0501046_0040251
876 Ga0501046_0089095
877 Ga0501046_0242374
878 Ga0501046_0540142
879 Ga0501047_0019313
880 Ga0501047_0105696
881 Ga0501047_0271482
882 Ga0501048_0004349
883 Ga0501048_0076714
884 Ga0501070_0056402
885 Ga0501070_0072187
886 Ga0501070_0099273
887 Ga0501070_0652196
888 Ga0501071_0918302
889 Ga0501074_0000299
890 Ga0501080_0549262
891 Ga0501279_034899
892 Ga0501035_0001623
893 Ga0501035_0148884
894 Ga0501044_0003629
895 Ga0501044_0014128
896 Ga0501044_0037386
897 Ga0501044_0055231
898 Ga0501044_0300093
899 Ga0501044_0434559
900 Ga0501044_0520217
901 Ga0501045_0223687
902 Ga0501045_0225700
903 nmdc:mga03n38_14468_c1
904 nmdc:mga06z11_153840_c1
905 nmdc:mga06z11_364042_c1
906 nmdc:mga07m45_248905_c1
907 Ga0495612_0094634
908 Ga0500610_0233157
909 Ga0500610_0292167
910 Ga0495655_0079659
911 Ga0495619_0105572
912 Ga0495619_0227391
913 Ga0500578_0230649
914 Ga0500640_133700
915 Ga0500553_195819
916 Ga0500560_019942
917 Ga0500572_077761
918 Ga0500559_0251496
919 Ga0500573_0349828
920 Ga0500624_040118
921 Ga0500636_0225599
922 Ga0587106_007200
923 Ga0587062_037770
924 Ga0466962_0001438
925 Ga0466962_0085993
926 2547407788
927 2552110581
928 2554258762
929 2566993050
930 2585312949
931 2585313221
932 2617919273
933 2643762539
934 2643904867
935 2643944891
936 2644385160
937 2644402925
938 2644431790
939 2644460510
940 2644513868
941 2644632048
942 2738892170
943 2768643102
944 2768643496
945 2784470814
946 2784592433
947 2785344632
948 2785366406
949 2785368266
950 2804846508
951 2809236064
952 2811845458
953 2811847940
954 2812359279
955 2812360893
956 2812479980
957 2812481446
958 2842892385
959 2852640775
960 2862180856
961 2862182691
962 2862388088
963 2862513969
964 2862513970
965 2862515768
966 2862582617
967 2863405896
968 2863405897
969 2867348914
970 2867476221
971 2873158152
972 2875392336
973 2877682311
974 2904541813
975 2912721208
976 2912725232
977 2912758433
978 2913914372
979 2918501399
980 2918503617
981 2922556107
982 2946052521
983 2946064978
984 2946066606
985 2946074878
986 2947230588
987 2954004004
988 2954387443
989 2990048102
990 2990066728
991 2990066729
992 2990067762
993 2990090985
994 2995467657
995 3003002902
996 3006322019
997 3006427466
998 3006427467
999 3006487173
1000 3006492037
1001 3006501954
1002 8008560730
1003 8008579826
1004 8008579827
1005 8023629102
1006 8025419383
1007 8025531990
1008 8033689904
1009 8048407989
1010 8048410509
1011 8053947033
1012 8056836702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02342

TerD

TerD domain

24

210

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8955 20 191
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8673 20 191
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8387 19 192
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8344 19 192
2qng-assembly1.cif.gz_A crystal structure of unknown function protein sav2460 0.7903 20 184
ID Description Score Start End Superfamily
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.95 19 184 2.60.60.30
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9231 19 184 2.60.60.30
af_Q63060_9_266_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8888 125 144 3.30.420.40
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8862 19 185 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8764 19 185 2.60.60.30
ID Description Score Start End GO Terms
AF-A0A1R4IM00-F1-model_v4 Tellurium resistance protein TerD 0.985 1 191 GO:0016020
GO:0046690
AF-A0A2S7XNI6-F1-model_v4 Chemical-damaging agent resistance protein C 0.9841 1 191 GO:0046690
AF-A0A5B7RK67-F1-model_v4 TerD family protein 0.9823 1 191
AF-D0L8C1-F1-model_v4 Stress protein 0.9822 1 191
AF-A0A7W4SMZ4-F1-model_v4 deleted 0.9821 3 192

Map