F458572

General Info

Members Datasets Scaffolds Average Seq Length
520 266 1040 179

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1724049|Ga0436365_1724049_60_638
Length 192
Sequence MVEATDRIREHEPEFEVPHLYGILAEFDTPEQLLYATRRAHAAGFRLMDGYAPFPIEGLSDALGFRTSTVPLIALFGGMLGAATGYAMQFYIHTISLPINVGGRPLNTWPSFIPATFELGVLFSALGLFFGLLILNRHPEPYHPVFNVEGFARASRDRFFLSIEARDAHFDPEATRQFLLDVHAREVSDVFD

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 2508501050 Microvirga lupini Lut6 Isolate Nodule
260 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
261 2643221556 Massilia sp. Root1485 Isolate Unclassified
262 2643221684 Massilia sp. Root133 Isolate Unclassified
263 2773857925 Microvirga vignae BR3299 Isolate Unclassified
264 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
265 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
266 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0.77
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0.58
Rhizoplane 5.19
Rhizosphere 87.88
Stem 0
Stem Tuber 0
Unclassified 6.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1724049 3300039437 Bacteria 1417
2 rootL2_10000245 3300003322 Bacteria 2591
3 rootL2_10015708 3300003322 Bacteria 32384
4 rootL2_10046078 3300003322 Bacteria 6690
5 rootH1_10095993 3300003323 Bacteria 1294
6 Ga0055529_1000505 3300003763 Bacteria 35260
7 Ga0070658_10075699 3300005327 Bacteria 2761
8 Ga0070658_10249863 3300005327 Bacteria 1504
9 Ga0070658_10266778 3300005327 Bacteria 1455
10 Ga0070683_101501408 3300005329 Bacteria 648
11 Ga0070690_100542835 3300005330 Unclassified 875
12 Ga0070680_100136145 3300005336 Bacteria 2058
13 Ga0070680_100245769 3300005336 Bacteria 1513
14 Ga0070680_100298166 3300005336 Bacteria 1367
15 Ga0070680_100653028 3300005336 Bacteria 904
16 Ga0068868_101218764 3300005338 Bacteria 696
17 Ga0070660_100029401 3300005339 Bacteria 4118
18 Ga0070660_100077587 3300005339 Bacteria 2603
19 Ga0070660_100130374 3300005339 Bacteria 2011
20 Ga0070660_100300125 3300005339 Bacteria 1317
21 Ga0070661_100274393 3300005344 Bacteria 1306
22 Ga0070692_10109610 3300005345 Bacteria 1525
23 Ga0070659_100026211 3300005366 Bacteria 4483
24 Ga0070659_100347711 3300005366 Bacteria 1243
25 Ga0070659_100432419 3300005366 Unclassified 1114
26 Ga0070709_10025103 3300005434 Bacteria 3518
27 Ga0070709_10114897 3300005434 Unclassified 1815
28 Ga0070709_10477708 3300005434 Unclassified 943
29 Ga0070709_10590962 3300005434 Unclassified 854
30 Ga0070714_100004498 3300005435 Bacteria 10508
31 Ga0070713_100000907 3300005436 Bacteria 18932
32 Ga0070710_10286167 3300005437 Unclassified 1071
33 Ga0070711_100154054 3300005439 Bacteria 1736
34 Ga0070711_100308594 3300005439 Bacteria 1260
35 Ga0070708_100015242 3300005445 Bacteria 6341
36 Ga0070708_100020241 3300005445 Bacteria 5608
37 Ga0070708_100391564 3300005445 Bacteria 1310
38 Ga0070678_100339216 3300005456 Bacteria 1289
39 Ga0070662_100450071 3300005457 Bacteria 1069
40 Ga0070685_10316535 3300005466 Unclassified 1056
41 Ga0070706_100297787 3300005467 Bacteria 1505
42 Ga0070706_100310777 3300005467 Bacteria 1470
43 Ga0070707_100031056 3300005468 Bacteria 5087
44 Ga0070707_100249107 3300005468 Bacteria 1729
45 Ga0070707_100457164 3300005468 Unclassified 1237
46 Ga0070698_100013007 3300005471 Bacteria 8809
47 Ga0070698_100175461 3300005471 Bacteria 2083
48 Ga0070699_100308358 3300005518 Bacteria 1421
49 Ga0070699_100654742 3300005518 Bacteria 959
50 Ga0070679_100540727 3300005530 Unclassified 1109
51 Ga0070679_100915315 3300005530 Bacteria 821
52 Ga0070684_100132339 3300005535 Bacteria 2250
53 Ga0070697_100001253 3300005536 Bacteria 19201
54 Ga0070697_100267886 3300005536 Bacteria 1464
55 Ga0070697_100503214 3300005536 Bacteria 1059
56 Ga0068853_101512905 3300005539 Bacteria 650
57 Ga0068853_101514989 3300005539 Bacteria 649
58 Ga0070665_100001198 3300005548 Bacteria 31613
59 Ga0068855_100267327 3300005563 Bacteria 1903
60 Ga0068855_100303858 3300005563 Bacteria 1766
61 Ga0068855_100450528 3300005563 Bacteria 1404
62 Ga0068855_100996240 3300005563 Bacteria 881
63 Ga0070664_101254839 3300005564 Bacteria 699
64 Ga0068856_100333674 3300005614 Bacteria 1534
65 Ga0068856_100963304 3300005614 Bacteria 872
66 Ga0068852_100848903 3300005616 Bacteria 929
67 Ga0068859_100140010 3300005617 Bacteria 2493
68 Ga0068859_100274302 3300005617 Unclassified 1779
69 Ga0068870_10440900 3300005840 Bacteria 856
70 Ga0068858_100300426 3300005842 Unclassified 1531
71 Ga0068860_100059794 3300005843 Bacteria 3622
72 Ga0068860_100578548 3300005843 Unclassified 1127
73 Ga0081455_10267711 3300005937 Unclassified 1241
74 Ga0075365_10188583 3300006038 Bacteria 1443
75 Ga0070715_10034651 3300006163 Bacteria 2071
76 Ga0070716_100169712 3300006173 Bacteria 1423
77 Ga0070712_100219375 3300006175 Bacteria 1505
78 Ga0070712_101144363 3300006175 Bacteria 676
79 Ga0068871_100937861 3300006358 Bacteria 804
80 Ga0075433_10344756 3300006852 Unclassified 1317
81 Ga0075434_100047072 3300006871 Bacteria 4280
82 Ga0068865_100383695 3300006881 Bacteria 1147
83 Ga0075436_100375946 3300006914 Bacteria 1027
84 Ga0097620_100140009 3300006931 Bacteria 2493
85 Ga0097620_100274297 3300006931 Unclassified 1779
86 Ga0075435_100017280 3300007076 Bacteria 5456
87 Ga0075435_100334545 3300007076 Bacteria 1297
88 Ga0075435_100423113 3300007076 Unclassified 1147
89 Ga0099795_10025064 3300007788 Bacteria 1996
90 Ga0099795_10223110 3300007788 Bacteria 803
91 Ga0105240_10013703 3300009093 Bacteria 11110
92 Ga0105240_10166761 3300009093 Bacteria 2612
93 Ga0105240_10409304 3300009093 Bacteria 1526
94 Ga0111539_10167078 3300009094 Bacteria 2571
95 Ga0105245_10266110 3300009098 Bacteria 1670
96 Ga0105247_10041166 3300009101 Bacteria 2826
97 Ga0105243_10097835 3300009148 Bacteria 2430
98 Ga0105242_10191376 3300009176 Bacteria 1811
99 Ga0105237_10411148 3300009545 Bacteria 1358
100 Ga0105237_10636667 3300009545 Unclassified 1073
101 Ga0105237_10653325 3300009545 Bacteria 1058
102 Ga0105249_10935264 3300009553 Unclassified 934
103 Ga0099796_10010558 3300010159 Bacteria 2543
104 Ga0105246_10078742 3300011119 Bacteria 2342
105 Ga0157373_10675345 3300013100 Bacteria 756
106 Ga0157371_10316431 3300013102 Bacteria 1132
107 Ga0157370_10028486 3300013104 Bacteria 5493
108 Ga0157369_10007889 3300013105 Bacteria 12239
109 Ga0157372_10083761 3300013307 Bacteria 3613
110 Ga0157372_10274594 3300013307 Bacteria 1959
111 Ga0157372_11712116 3300013307 Bacteria 723
112 Ga0157375_10254696 3300013308 Unclassified 1917
113 Ga0157380_10113026 3300014326 Bacteria 2286
114 Ga0182008_10022682 3300014497 Bacteria 3214
115 Ga0157379_10260767 3300014968 Bacteria 1575
116 Ga0182007_10055111 3300015262 Bacteria 1307
117 Ga0206356_10057858 3300020070 Bacteria 978
118 Ga0206353_11087803 3300020082 Bacteria 913
119 Ga0206353_11585650 3300020082 Bacteria 1510
120 Ga0224712_10017526 3300022467 Bacteria 2377
121 Ga0209563_100003 3300025230 Bacteria 1932942
122 Ga0209437_105349 3300025233 Bacteria 2192
123 Ga0209677_105887 3300025253 Bacteria 3069
124 Ga0209148_1003663 3300025254 Bacteria 4098
125 Ga0209455_1000073 3300025272 Bacteria 291417
126 Ga0207656_10154075 3300025321 Bacteria 1090
127 Ga0207642_10073105 3300025899 Bacteria 1639
128 Ga0207685_10034835 3300025905 Bacteria 1832
129 Ga0207685_10106997 3300025905 Bacteria 1206
130 Ga0207699_10024539 3300025906 Bacteria 3299
131 Ga0207699_10360787 3300025906 Bacteria 1027
132 Ga0207643_10503931 3300025908 Bacteria 774
133 Ga0207705_10051542 3300025909 Bacteria 2962
134 Ga0207684_10255154 3300025910 Bacteria 1513
135 Ga0207707_10222030 3300025912 Bacteria 1645
136 Ga0207695_10809466 3300025913 Bacteria 817
137 Ga0207671_10146750 3300025914 Bacteria 1820
138 Ga0207671_10232584 3300025914 Bacteria 1446
139 Ga0207693_10261509 3300025915 Bacteria 1357
140 Ga0207663_10376380 3300025916 Bacteria 1081
141 Ga0207660_10148530 3300025917 Bacteria 1799
142 Ga0207660_10239845 3300025917 Bacteria 1428
143 Ga0207660_10588747 3300025917 Bacteria 906
144 Ga0207657_10008320 3300025919 Bacteria 10555
145 Ga0207657_10021638 3300025919 Bacteria 6045
146 Ga0207657_10042308 3300025919 Bacteria 4021
147 Ga0207649_10253703 3300025920 Bacteria 1268
148 Ga0207652_10400886 3300025921 Bacteria 1238
149 Ga0207646_10002708 3300025922 Bacteria 20768
150 Ga0207646_10138926 3300025922 Bacteria 2188
151 Ga0207646_10141975 3300025922 Unclassified 2163
152 Ga0207687_10299827 3300025927 Bacteria 1294
153 Ga0207700_10248110 3300025928 Bacteria 1520
154 Ga0207690_10214189 3300025932 Bacteria 1470
155 Ga0207690_10492352 3300025932 Bacteria 991
156 Ga0207706_10048175 3300025933 Bacteria 3769
157 Ga0207686_10015672 3300025934 Bacteria 4243
158 Ga0207709_10496881 3300025935 Bacteria 951
159 Ga0207704_10593274 3300025938 Bacteria 906
160 Ga0207665_10214401 3300025939 Bacteria 1408
161 Ga0207665_10415355 3300025939 Unclassified 1027
162 Ga0207689_10342247 3300025942 Bacteria 1242
163 Ga0207661_11372744 3300025944 Bacteria 649
164 Ga0207679_10105148 3300025945 Bacteria 2216
165 Ga0207679_10403313 3300025945 Bacteria 1203
166 Ga0207667_10005389 3300025949 Bacteria 15599
167 Ga0207667_10141169 3300025949 Bacteria 2480
168 Ga0207667_10280756 3300025949 Bacteria 1702
169 Ga0207667_10485611 3300025949 Bacteria 1254
170 Ga0207703_10077317 3300026035 Unclassified 2763
171 Ga0207639_11113294 3300026041 Bacteria 741
172 Ga0207702_10089144 3300026078 Bacteria 2697
173 Ga0207641_10003714 3300026088 Bacteria 13447
174 Ga0207648_10330038 3300026089 Bacteria 1372
175 Ga0207683_10523264 3300026121 Bacteria 1096
176 Ga0207698_10421572 3300026142 Bacteria 1281
177 Ga0268266_10000661 3300028379 Bacteria 46641
178 Ga0268264_10155626 3300028381 Bacteria 2054
179 Ga0265338_10008077 3300028800 Bacteria 12864
180 Ga0265338_10299747 3300028800 Bacteria 1169
181 Ga0307408_100064959 3300031548 Bacteria 2675
182 Ga0307410_10017931 3300031852 Bacteria 4265
183 Ga0307409_100003616 3300031995 Bacteria 8449
184 Ga0307409_100898830 3300031995 Bacteria 899
185 Ga0307416_100089722 3300032002 Bacteria 2633
186 Ga0307415_100091349 3300032126 Bacteria 2205
187 Ga0307510_10108975 3300033180 Bacteria 2521
188 Ga0373946_0199485 3300035171 Unclassified 958
189 Ga0373947_0104426 3300035725 Unclassified 1784
190 Ga0373937_0094756 3300036401 Unclassified 2768
191 Ga0373937_0825184 3300036401 Bacteria 875
192 Ga0395899_0001316 3300037312 Bacteria 21390
193 Ga0395899_0003330 3300037312 Bacteria 12738
194 Ga0395899_0013342 3300037312 Bacteria 6284
195 Ga0395899_0074109 3300037312 Bacteria 2487
196 Ga0395899_0209203 3300037312 Bacteria 1356
197 Ga0395899_0225930 3300037312 Bacteria 1295
198 Ga0395899_0232708 3300037312 Bacteria 1271
199 Ga0395900_0000171 3300037418 Bacteria 105316
200 Ga0395900_0001430 3300037418 Bacteria 28485
201 Ga0395900_0002814 3300037418 Bacteria 18996
202 Ga0395900_0011942 3300037418 Bacteria 8881
203 Ga0395900_0076795 3300037418 Bacteria 3432
204 Ga0395900_0115372 3300037418 Bacteria 2756
205 Ga0395900_0158028 3300037418 Bacteria 2314
206 Ga0395900_0206694 3300037418 Bacteria 1984
207 Ga0395900_0592086 3300037418 Bacteria 1050
208 Ga0395900_0632269 3300037418 Bacteria 1008
209 Ga0395900_1091611 3300037418 Bacteria 715
210 Ga0395900_1155054 3300037418 Bacteria 690
211 Ga0395898_0047954 3300037466 Bacteria 4190
212 Ga0395898_0112856 3300037466 Bacteria 2605
213 Ga0395898_0131527 3300037466 Bacteria 2397
214 Ga0395898_0195674 3300037466 Bacteria 1931
215 Ga0395898_0593174 3300037466 Bacteria 1050
216 Ga0395898_0855172 3300037466 Unclassified 849
217 Ga0395898_0857368 3300037466 Bacteria 847
218 Ga0395898_1104412 3300037466 Bacteria 726
219 Ga0395905_0023708 3300037471 Bacteria 5794
220 Ga0395905_0028961 3300037471 Bacteria 5220
221 Ga0395905_0189680 3300037471 Bacteria 1928
222 Ga0395905_0503366 3300037471 Bacteria 1111
223 Ga0395905_0574640 3300037471 Bacteria 1028
224 Ga0395901_0000083 3300038443 Bacteria 128816
225 Ga0395901_0000414 3300038443 Bacteria 50256
226 Ga0395901_0048957 3300038443 Bacteria 4390
227 Ga0395901_0207919 3300038443 Bacteria 2049
228 Ga0395901_0209013 3300038443 Bacteria 2043
229 Ga0395901_0329901 3300038443 Bacteria 1577
230 Ga0395901_0427562 3300038443 Bacteria 1357
231 Ga0395901_0441968 3300038443 Bacteria 1331
232 Ga0395901_0514125 3300038443 Bacteria 1217
233 Ga0395901_1076707 3300038443 Bacteria 775
234 Ga0395901_1293931 3300038443 Bacteria 691
235 Ga0395901_1537556 3300038443 Bacteria 620
236 Ga0436365_0155025 3300039437 Bacteria 623
237 Ga0436360_0551817 3300039438 Bacteria 999
238 Ga0439448_0022268 3300042005 Bacteria 1968
239 Ga0439448_0067921 3300042005 Bacteria 1185
240 Ga0439450_013641 3300042008 Bacteria 1636
241 Ga0439455_0005831 3300042012 Bacteria 2523
242 Ga0439458_0038567 3300042157 Bacteria 1154
243 Ga0451577_0662164 3300042876 Unclassified 946
244 Ga0466969_0055109 3300044656 Bacteria 1946
245 Ga0466969_0096345 3300044656 Bacteria 1397
246 Ga0466969_0133668 3300044656 Bacteria 1149
247 Ga0466969_0134292 3300044656 Bacteria 1146
248 Ga0466972_0154816 3300044658 Bacteria 1077
249 Ga0466965_0001272 3300044683 Bacteria 10031
250 Ga0466965_0036256 3300044683 Bacteria 2419
251 Ga0466965_0451049 3300044683 Unclassified 716
252 Ga0466966_0008001 3300044684 Bacteria 7008
253 Ga0466966_0018869 3300044684 Bacteria 4544
254 Ga0466966_0062975 3300044684 Bacteria 2337
255 Ga0466966_0094999 3300044684 Bacteria 1847
256 Ga0466966_0139573 3300044684 Bacteria 1481
257 Ga0466966_0172136 3300044684 Bacteria 1315
258 Ga0466961_0018955 3300044693 Bacteria 4428
259 Ga0466963_0028594 3300044694 Unclassified 3581
260 Ga0466964_0000179 3300044706 Bacteria 17466
261 Ga0453684_0055469 3300044712 Bacteria 5152
262 Ga0453684_1878130 3300044712 Bacteria 607
263 Ga0466971_0165338 3300044719 Bacteria 1037
264 Ga0466968_0006230 3300044735 Bacteria 4486
265 Ga0466970_0505574 3300044765 Bacteria 696
266 Ga0466957_0001627 3300044842 Bacteria 11779
267 Ga0466957_0014540 3300044842 Bacteria 4585
268 Ga0466957_0247275 3300044842 Bacteria 1185
269 Ga0466957_0445792 3300044842 Unclassified 891
270 Ga0466960_0130696 3300044901 Bacteria 1325
271 Ga0466959_0009968 3300045049 Bacteria 6771
272 Ga0466959_0066137 3300045049 Bacteria 2622
273 Ga0466959_0120666 3300045049 Bacteria 1864
274 Ga0466959_0781820 3300045049 Bacteria 638
275 Ga0451576_0394570 3300045051 Bacteria 1451
276 Ga0466958_0040722 3300045836 Bacteria 2793
277 Ga0466958_0104373 3300045836 Bacteria 1765
278 Ga0466967_0048540 3300045976 Bacteria 3707
279 Ga0466967_0175745 3300045976 Bacteria 2017
280 Ga0466967_0179881 3300045976 Bacteria 1994
281 Ga0466967_0286106 3300045976 Bacteria 1583
282 Ga0495617_000009 3300046452 Bacteria 312936
283 Ga0495617_042353 3300046452 Bacteria 1522
284 Ga0495627_000226 3300046453 Bacteria 59863
285 Ga0495603_0016700 3300046455 Bacteria 4440
286 Ga0495603_0100530 3300046455 Bacteria 1688
287 Ga0495603_0171425 3300046455 Bacteria 1257
288 Ga0495590_0000193 3300046457 Bacteria 34527
289 Ga0495590_0001371 3300046457 Bacteria 10589
290 Ga0495591_000413 3300046458 Bacteria 35577
291 Ga0495638_0207667 3300046460 Bacteria 1102
292 Ga0495653_0012001 3300046463 Bacteria 7074
293 Ga0495653_0034254 3300046463 Bacteria 4018
294 Ga0495650_0006301 3300046471 Bacteria 7421
295 Ga0495650_0144819 3300046471 Bacteria 857
296 Ga0495580_0012396 3300046472 Bacteria 6536
297 Ga0495580_0085848 3300046472 Bacteria 2192
298 Ga0495605_0000226 3300046474 Bacteria 69648
299 Ga0495605_0005738 3300046474 Bacteria 7201
300 Ga0495605_0005990 3300046474 Bacteria 7026
301 Ga0495605_0012061 3300046474 Bacteria 4803
302 Ga0495605_0012963 3300046474 Bacteria 4610
303 Ga0495584_0000069 3300046491 Bacteria 73277
304 Ga0495584_0000335 3300046491 Bacteria 32656
305 Ga0495584_0007371 3300046491 Bacteria 5737
306 Ga0495585_0016904 3300046492 Bacteria 4225
307 Ga0495585_0031338 3300046492 Bacteria 3018
308 Ga0495585_0058785 3300046492 Bacteria 2120
309 Ga0495585_0060287 3300046492 Bacteria 2088
310 Ga0495585_0103049 3300046492 Bacteria 1524
311 Ga0495585_0131077 3300046492 Bacteria 1319
312 Ga0495594_0008540 3300046499 Bacteria 5281
313 Ga0495594_0154389 3300046499 Bacteria 1303
314 Ga0495594_0184684 3300046499 Bacteria 1187
315 Ga0495594_0378414 3300046499 Bacteria 806
316 Ga0495596_0000468 3300046500 Bacteria 25625
317 Ga0495596_0003795 3300046500 Bacteria 7538
318 Ga0495596_0007325 3300046500 Bacteria 4985
319 Ga0495607_0000855 3300046501 Bacteria 28732
320 Ga0495607_0000864 3300046501 Bacteria 28383
321 Ga0495607_0001992 3300046501 Bacteria 17185
322 Ga0495607_0004549 3300046501 Bacteria 10178
323 Ga0495607_0028277 3300046501 Bacteria 3460
324 Ga0495607_0118947 3300046501 Bacteria 1390
325 Ga0495583_0000325 3300046506 Bacteria 75322
326 Ga0495583_0000482 3300046506 Bacteria 58319
327 Ga0495583_0000942 3300046506 Bacteria 33862
328 Ga0495583_0043713 3300046506 Bacteria 2084
329 Ga0495583_0096780 3300046506 Bacteria 1264
330 Ga0495606_0006428 3300046507 Bacteria 10842
331 Ga0495606_0007988 3300046507 Bacteria 9305
332 Ga0495610_0000183 3300046512 Bacteria 70057
333 Ga0495616_0000398 3300046513 Bacteria 33565
334 Ga0495616_0001144 3300046513 Bacteria 18741
335 Ga0495616_0001747 3300046513 Bacteria 14798
336 Ga0495616_0004144 3300046513 Bacteria 9188
337 Ga0495616_0023854 3300046513 Bacteria 3287
338 Ga0495616_0057068 3300046513 Bacteria 1926
339 Ga0495630_0133400 3300046517 Bacteria 1886
340 Ga0495631_0000406 3300046518 Bacteria 29752
341 Ga0495631_0013609 3300046518 Bacteria 3945
342 Ga0495631_0070553 3300046518 Bacteria 1510
343 Ga0495632_0000244 3300046519 Bacteria 53886
344 Ga0495632_0001124 3300046519 Bacteria 22873
345 Ga0495632_0013402 3300046519 Bacteria 4679
346 Ga0495632_0134564 3300046519 Bacteria 1149
347 Ga0495637_0000012 3300046520 Bacteria 273124
348 Ga0495643_0011107 3300046522 Bacteria 5504
349 Ga0495643_0019369 3300046522 Bacteria 3937
350 Ga0495643_0037928 3300046522 Bacteria 2641
351 Ga0495643_0102489 3300046522 Bacteria 1465
352 Ga0495644_0019603 3300046523 Bacteria 2582
353 Ga0495644_0036730 3300046523 Bacteria 1848
354 Ga0495644_0084517 3300046523 Bacteria 1196
355 Ga0495648_0001175 3300046524 Bacteria 26445
356 Ga0495648_0087409 3300046524 Bacteria 1755
357 Ga0495648_0093213 3300046524 Bacteria 1680
358 Ga0495648_0163013 3300046524 Bacteria 1150
359 Ga0495666_0027646 3300046526 Bacteria 2792
360 Ga0495642_0000669 3300046528 Bacteria 17085
361 Ga0495642_0002186 3300046528 Bacteria 8024
362 Ga0495642_0197958 3300046528 Bacteria 876
363 Ga0495652_0055730 3300046529 Bacteria 3360
364 Ga0495652_0942081 3300046529 Bacteria 568
365 Ga0495654_0012614 3300046530 Bacteria 4537
366 Ga0495654_0057059 3300046530 Bacteria 1887
367 Ga0495586_0018257 3300046535 Bacteria 3734
368 Ga0495587_0106088 3300046536 Bacteria 1616
369 Ga0495587_0129869 3300046536 Bacteria 1440
370 Ga0495609_0000001 3300046538 Bacteria 1060094
371 Ga0495609_0015707 3300046538 Bacteria 3539
372 Ga0495609_0019545 3300046538 Bacteria 3133
373 Ga0495609_0027084 3300046538 Bacteria 2621
374 Ga0495609_0030745 3300046538 Bacteria 2444
375 Ga0495597_0000557 3300046542 Bacteria 31002
376 Ga0495645_0030245 3300046543 Bacteria 3943
377 Ga0495645_0595447 3300046543 Unclassified 681
378 Ga0495633_0006678 3300046558 Bacteria 6795
379 Ga0495656_0072299 3300046615 Bacteria 1535
380 Ga0495656_0152964 3300046615 Bacteria 1115
381 Ga0495656_0360621 3300046615 Bacteria 755
382 Ga0495668_0001940 3300046616 Bacteria 18404
383 Ga0495668_0002252 3300046616 Bacteria 16242
384 Ga0495668_0016074 3300046616 Bacteria 4355
385 Ga0495668_0043384 3300046616 Bacteria 2502
386 Ga0495611_0000290 3300046648 Bacteria 34192
387 Ga0495611_0006489 3300046648 Bacteria 4985
388 Ga0495611_0097723 3300046648 Bacteria 1361
389 Ga0495611_0222735 3300046648 Bacteria 877
390 Ga0495625_0131369 3300046660 Bacteria 1696
391 Ga0495635_0025677 3300046663 Bacteria 4105
392 Ga0495661_0000625 3300046665 Bacteria 36055
393 Ga0495661_0001098 3300046665 Bacteria 23743
394 Ga0495661_0004845 3300046665 Bacteria 9638
395 Ga0495661_0030255 3300046665 Bacteria 3449
396 Ga0495661_0045652 3300046665 Bacteria 2678
397 Ga0495661_0069361 3300046665 Bacteria 2065
398 Ga0495661_0075699 3300046665 Bacteria 1956
399 Ga0495661_0115407 3300046665 Bacteria 1491
400 Ga0495661_0399945 3300046665 Bacteria 668
401 Ga0495588_0000089 3300046674 Bacteria 191894
402 Ga0495588_0035392 3300046674 Bacteria 2530
403 Ga0495588_0387782 3300046674 Bacteria 733
404 Ga0495646_0262749 3300046680 Bacteria 922
405 Ga0495647_0005391 3300046681 Bacteria 4187
406 Ga0495669_0044269 3300046684 Bacteria 1983
407 Ga0495669_0062071 3300046684 Bacteria 1692
408 Ga0495669_0099405 3300046684 Bacteria 1350
409 Ga0495613_0090708 3300046689 Bacteria 2213
410 Ga0495624_0186508 3300046690 Unclassified 1262
411 Ga0495670_0000163 3300046691 Bacteria 29060
412 Ga0495671_0000391 3300046692 Bacteria 36162
413 Ga0495671_0004510 3300046692 Bacteria 8307
414 Ga0495649_0000115 3300046694 Bacteria 71036
415 Ga0495649_0000653 3300046694 Bacteria 28254
416 Ga0495649_0039859 3300046694 Bacteria 2575
417 Ga0495589_0000119 3300046794 Bacteria 73585
418 Ga0495589_0009748 3300046794 Bacteria 4988
419 Ga0495589_0118216 3300046794 Bacteria 1277
420 Ga0495589_0471952 3300046794 Bacteria 573
421 Ga0495660_0007602 3300046810 Bacteria 6365
422 Ga0495660_0009576 3300046810 Bacteria 5648
423 Ga0495660_0026185 3300046810 Bacteria 3307
424 Ga0495581_0067865 3300047315 Unclassified 2062
425 Ga0495674_0035319 3300047319 Bacteria 4511
426 Ga0495672_0000124 3300047320 Bacteria 118878
427 Ga0495676_0077259 3300047321 Bacteria 2539
428 Ga0495680_0154403 3300047322 Bacteria 1671
429 Ga0495683_0000158 3300047323 Bacteria 66468
430 Ga0495683_0012259 3300047323 Bacteria 4503
431 Ga0495687_000019 3300047443 Bacteria 341756
432 Ga0495687_000332 3300047443 Bacteria 60524
433 Ga0495677_0000020 3300047445 Bacteria 107093
434 Ga0495677_0000913 3300047445 Bacteria 11888
435 Ga0495677_0003477 3300047445 Bacteria 6115
436 Ga0495677_0006329 3300047445 Bacteria 4473
437 Ga0495677_0144093 3300047445 Bacteria 915
438 Ga0495679_002729 3300047446 Bacteria 8786
439 Ga0495679_016234 3300047446 Bacteria 2698
440 Ga0495681_0000205 3300047470 Bacteria 49281
441 Ga0495681_0001703 3300047470 Bacteria 16279
442 Ga0495681_0050598 3300047470 Bacteria 1957
443 Ga0495681_0071942 3300047470 Bacteria 1565
444 Ga0495686_0016413 3300047472 Bacteria 5021
445 Ga0495686_0125192 3300047472 Bacteria 1528
446 Ga0495593_0079935 3300047673 Bacteria 1692
447 Ga0495602_0164534 3300048088 Bacteria 1728
448 Ga0495614_0010192 3300048089 Bacteria 4144
449 Ga0495626_0000015 3300048091 Bacteria 232238
450 Ga0495626_0002031 3300048091 Bacteria 14853
451 Ga0495626_0003001 3300048091 Bacteria 11170
452 Ga0495626_0007762 3300048091 Bacteria 5945
453 Ga0495626_0036239 3300048091 Bacteria 2351
454 Ga0495626_0043469 3300048091 Bacteria 2107
455 Ga0496100_0870330 3300048903 Bacteria 707
456 Ga0496101_0025194 3300048904 Bacteria 4124
457 Ga0496101_0098939 3300048904 Bacteria 2180
458 Ga0496101_1545937 3300048904 Bacteria 516
459 Ga0496102_0000285 3300048905 Bacteria 64637
460 Ga0496102_0070751 3300048905 Bacteria 3203
461 Ga0496102_0109692 3300048905 Bacteria 2572
462 Ga0496102_0495066 3300048905 Bacteria 1144
463 Ga0496102_1280228 3300048905 Bacteria 652
464 Ga0496103_0346335 3300048906 Bacteria 955
465 Ga0496103_0400663 3300048906 Bacteria 881
466 Ga0496103_0622521 3300048906 Bacteria 687
467 Ga0496104_0116539 3300048907 Bacteria 2564
468 Ga0496104_0898622 3300048907 Bacteria 791
469 Ga0496105_0211017 3300048908 Bacteria 1583
470 Ga0496106_0027936 3300048909 Bacteria 4200
471 Ga0496106_0041328 3300048909 Bacteria 3455
472 Ga0496107_0242112 3300048910 Bacteria 1342
473 Ga0496107_0687637 3300048910 Bacteria 753
474 Ga0496108_0828281 3300048911 Bacteria 797
475 Ga0496109_0027581 3300048912 Bacteria 5072
476 Ga0496109_0748275 3300048912 Bacteria 915
477 Ga0496110_0876708 3300048913 Bacteria 803
478 Ga0496111_0062981 3300048914 Bacteria 2690
479 Ga0496112_0477801 3300048915 Bacteria 1183
480 Ga0496113_0018454 3300048916 Bacteria 4859
481 Ga0496115_0071544 3300048918 Bacteria 2813
482 Ga0496121_0214276 3300048924 Bacteria 1362
483 Ga0496122_0000326 3300048925 Bacteria 103567
484 Ga0496122_0002263 3300048925 Bacteria 27868
485 Ga0496122_0007636 3300048925 Bacteria 11941
486 Ga0496123_0000293 3300048926 Bacteria 97880
487 Ga0496123_0002292 3300048926 Bacteria 24029
488 Ga0496123_0017277 3300048926 Bacteria 5814
489 Ga0496124_0041323 3300048927 Bacteria 3980
490 Ga0496124_0178753 3300048927 Bacteria 1635
491 Ga0496124_0606668 3300048927 Bacteria 711
492 Ga0496125_0000696 3300048928 Bacteria 55487
493 Ga0496125_0082266 3300048928 Bacteria 2455
494 Ga0496126_0184731 3300048929 Bacteria 1769
495 Ga0496126_0339075 3300048929 Bacteria 1232
496 Ga0495678_000144 3300049459 Bacteria 86580
497 Ga0501034_0204345 3300049571 Bacteria 1932
498 Ga0501034_0323380 3300049571 Bacteria 1475
499 Ga0501038_0231168 3300049574 Bacteria 1472
500 Ga0501038_0235587 3300049574 Bacteria 1455
501 Ga0501047_0714270 3300049581 Bacteria 819
502 Ga0501075_0619912 3300049591 Bacteria 825
503 Ga0501080_0386335 3300049742 Bacteria 1261
504 Ga0501035_0003131 3300049822 Bacteria 15890
505 Ga0501044_0434590 3300049823 Bacteria 1221
506 nmdc:mga0n895_40870_c1 3300050512 Bacteria 4506
507 nmdc:mga0rr50_141176_c1 3300050513 Bacteria 1938
508 nmdc:mga0rr50_396365_c1 3300050513 Unclassified 1165
509 nmdc:mga08x19_566250_c1 3300050514 Unclassified 804
510 Ga0495619_0283911 3300053085 Unclassified 1147
511 Ga0466962_0053864 3300061719 Bacteria 1922
512 Ga0466962_0220089 3300061719 Bacteria 930
513 2508728231 2508501050 Bacteria 9633614
514 2509078000 2508501114 Bacteria 7082538
515 2643798678 2643221556 Bacteria 7251154
516 2644472536 2643221684 Bacteria 7145183
517 2774873290 2773857925 Bacteria 6472445
518 2776260685 2775506901 Bacteria 9631051
519 2835312846 2835312727 Bacteria 7413381
520 2882462086 2882456835 Bacteria 6863978
521 Ga0436365_1724049
522 rootL2_10000245
523 rootL2_10015708
524 rootL2_10046078
525 rootH1_10095993
526 Ga0055529_1000505
527 Ga0070658_10075699
528 Ga0070658_10249863
529 Ga0070658_10266778
530 Ga0070683_101501408
531 Ga0070690_100542835
532 Ga0070680_100136145
533 Ga0070680_100245769
534 Ga0070680_100298166
535 Ga0070680_100653028
536 Ga0068868_101218764
537 Ga0070660_100029401
538 Ga0070660_100077587
539 Ga0070660_100130374
540 Ga0070660_100300125
541 Ga0070661_100274393
542 Ga0070692_10109610
543 Ga0070659_100026211
544 Ga0070659_100347711
545 Ga0070659_100432419
546 Ga0070709_10025103
547 Ga0070709_10114897
548 Ga0070709_10477708
549 Ga0070709_10590962
550 Ga0070714_100004498
551 Ga0070713_100000907
552 Ga0070710_10286167
553 Ga0070711_100154054
554 Ga0070711_100308594
555 Ga0070708_100015242
556 Ga0070708_100020241
557 Ga0070708_100391564
558 Ga0070678_100339216
559 Ga0070662_100450071
560 Ga0070685_10316535
561 Ga0070706_100297787
562 Ga0070706_100310777
563 Ga0070707_100031056
564 Ga0070707_100249107
565 Ga0070707_100457164
566 Ga0070698_100013007
567 Ga0070698_100175461
568 Ga0070699_100308358
569 Ga0070699_100654742
570 Ga0070679_100540727
571 Ga0070679_100915315
572 Ga0070684_100132339
573 Ga0070697_100001253
574 Ga0070697_100267886
575 Ga0070697_100503214
576 Ga0068853_101512905
577 Ga0068853_101514989
578 Ga0070665_100001198
579 Ga0068855_100267327
580 Ga0068855_100303858
581 Ga0068855_100450528
582 Ga0068855_100996240
583 Ga0070664_101254839
584 Ga0068856_100333674
585 Ga0068856_100963304
586 Ga0068852_100848903
587 Ga0068859_100140010
588 Ga0068859_100274302
589 Ga0068870_10440900
590 Ga0068858_100300426
591 Ga0068860_100059794
592 Ga0068860_100578548
593 Ga0081455_10267711
594 Ga0075365_10188583
595 Ga0070715_10034651
596 Ga0070716_100169712
597 Ga0070712_100219375
598 Ga0070712_101144363
599 Ga0068871_100937861
600 Ga0075433_10344756
601 Ga0075434_100047072
602 Ga0068865_100383695
603 Ga0075436_100375946
604 Ga0097620_100140009
605 Ga0097620_100274297
606 Ga0075435_100017280
607 Ga0075435_100334545
608 Ga0075435_100423113
609 Ga0099795_10025064
610 Ga0099795_10223110
611 Ga0105240_10013703
612 Ga0105240_10166761
613 Ga0105240_10409304
614 Ga0111539_10167078
615 Ga0105245_10266110
616 Ga0105247_10041166
617 Ga0105243_10097835
618 Ga0105242_10191376
619 Ga0105237_10411148
620 Ga0105237_10636667
621 Ga0105237_10653325
622 Ga0105249_10935264
623 Ga0099796_10010558
624 Ga0105246_10078742
625 Ga0157373_10675345
626 Ga0157371_10316431
627 Ga0157370_10028486
628 Ga0157369_10007889
629 Ga0157372_10083761
630 Ga0157372_10274594
631 Ga0157372_11712116
632 Ga0157375_10254696
633 Ga0157380_10113026
634 Ga0182008_10022682
635 Ga0157379_10260767
636 Ga0182007_10055111
637 Ga0206356_10057858
638 Ga0206353_11087803
639 Ga0206353_11585650
640 Ga0224712_10017526
641 Ga0209563_100003
642 Ga0209437_105349
643 Ga0209677_105887
644 Ga0209148_1003663
645 Ga0209455_1000073
646 Ga0207656_10154075
647 Ga0207642_10073105
648 Ga0207685_10034835
649 Ga0207685_10106997
650 Ga0207699_10024539
651 Ga0207699_10360787
652 Ga0207643_10503931
653 Ga0207705_10051542
654 Ga0207684_10255154
655 Ga0207707_10222030
656 Ga0207695_10809466
657 Ga0207671_10146750
658 Ga0207671_10232584
659 Ga0207693_10261509
660 Ga0207663_10376380
661 Ga0207660_10148530
662 Ga0207660_10239845
663 Ga0207660_10588747
664 Ga0207657_10008320
665 Ga0207657_10021638
666 Ga0207657_10042308
667 Ga0207649_10253703
668 Ga0207652_10400886
669 Ga0207646_10002708
670 Ga0207646_10138926
671 Ga0207646_10141975
672 Ga0207687_10299827
673 Ga0207700_10248110
674 Ga0207690_10214189
675 Ga0207690_10492352
676 Ga0207706_10048175
677 Ga0207686_10015672
678 Ga0207709_10496881
679 Ga0207704_10593274
680 Ga0207665_10214401
681 Ga0207665_10415355
682 Ga0207689_10342247
683 Ga0207661_11372744
684 Ga0207679_10105148
685 Ga0207679_10403313
686 Ga0207667_10005389
687 Ga0207667_10141169
688 Ga0207667_10280756
689 Ga0207667_10485611
690 Ga0207703_10077317
691 Ga0207639_11113294
692 Ga0207702_10089144
693 Ga0207641_10003714
694 Ga0207648_10330038
695 Ga0207683_10523264
696 Ga0207698_10421572
697 Ga0268266_10000661
698 Ga0268264_10155626
699 Ga0265338_10008077
700 Ga0265338_10299747
701 Ga0307408_100064959
702 Ga0307410_10017931
703 Ga0307409_100003616
704 Ga0307409_100898830
705 Ga0307416_100089722
706 Ga0307415_100091349
707 Ga0307510_10108975
708 Ga0373946_0199485
709 Ga0373947_0104426
710 Ga0373937_0094756
711 Ga0373937_0825184
712 Ga0395899_0001316
713 Ga0395899_0003330
714 Ga0395899_0013342
715 Ga0395899_0074109
716 Ga0395899_0209203
717 Ga0395899_0225930
718 Ga0395899_0232708
719 Ga0395900_0000171
720 Ga0395900_0001430
721 Ga0395900_0002814
722 Ga0395900_0011942
723 Ga0395900_0076795
724 Ga0395900_0115372
725 Ga0395900_0158028
726 Ga0395900_0206694
727 Ga0395900_0592086
728 Ga0395900_0632269
729 Ga0395900_1091611
730 Ga0395900_1155054
731 Ga0395898_0047954
732 Ga0395898_0112856
733 Ga0395898_0131527
734 Ga0395898_0195674
735 Ga0395898_0593174
736 Ga0395898_0855172
737 Ga0395898_0857368
738 Ga0395898_1104412
739 Ga0395905_0023708
740 Ga0395905_0028961
741 Ga0395905_0189680
742 Ga0395905_0503366
743 Ga0395905_0574640
744 Ga0395901_0000083
745 Ga0395901_0000414
746 Ga0395901_0048957
747 Ga0395901_0207919
748 Ga0395901_0209013
749 Ga0395901_0329901
750 Ga0395901_0427562
751 Ga0395901_0441968
752 Ga0395901_0514125
753 Ga0395901_1076707
754 Ga0395901_1293931
755 Ga0395901_1537556
756 Ga0436365_0155025
757 Ga0436360_0551817
758 Ga0439448_0022268
759 Ga0439448_0067921
760 Ga0439450_013641
761 Ga0439455_0005831
762 Ga0439458_0038567
763 Ga0451577_0662164
764 Ga0466969_0055109
765 Ga0466969_0096345
766 Ga0466969_0133668
767 Ga0466969_0134292
768 Ga0466972_0154816
769 Ga0466965_0001272
770 Ga0466965_0036256
771 Ga0466965_0451049
772 Ga0466966_0008001
773 Ga0466966_0018869
774 Ga0466966_0062975
775 Ga0466966_0094999
776 Ga0466966_0139573
777 Ga0466966_0172136
778 Ga0466961_0018955
779 Ga0466963_0028594
780 Ga0466964_0000179
781 Ga0453684_0055469
782 Ga0453684_1878130
783 Ga0466971_0165338
784 Ga0466968_0006230
785 Ga0466970_0505574
786 Ga0466957_0001627
787 Ga0466957_0014540
788 Ga0466957_0247275
789 Ga0466957_0445792
790 Ga0466960_0130696
791 Ga0466959_0009968
792 Ga0466959_0066137
793 Ga0466959_0120666
794 Ga0466959_0781820
795 Ga0451576_0394570
796 Ga0466958_0040722
797 Ga0466958_0104373
798 Ga0466967_0048540
799 Ga0466967_0175745
800 Ga0466967_0179881
801 Ga0466967_0286106
802 Ga0495617_000009
803 Ga0495617_042353
804 Ga0495627_000226
805 Ga0495603_0016700
806 Ga0495603_0100530
807 Ga0495603_0171425
808 Ga0495590_0000193
809 Ga0495590_0001371
810 Ga0495591_000413
811 Ga0495638_0207667
812 Ga0495653_0012001
813 Ga0495653_0034254
814 Ga0495650_0006301
815 Ga0495650_0144819
816 Ga0495580_0012396
817 Ga0495580_0085848
818 Ga0495605_0000226
819 Ga0495605_0005738
820 Ga0495605_0005990
821 Ga0495605_0012061
822 Ga0495605_0012963
823 Ga0495584_0000069
824 Ga0495584_0000335
825 Ga0495584_0007371
826 Ga0495585_0016904
827 Ga0495585_0031338
828 Ga0495585_0058785
829 Ga0495585_0060287
830 Ga0495585_0103049
831 Ga0495585_0131077
832 Ga0495594_0008540
833 Ga0495594_0154389
834 Ga0495594_0184684
835 Ga0495594_0378414
836 Ga0495596_0000468
837 Ga0495596_0003795
838 Ga0495596_0007325
839 Ga0495607_0000855
840 Ga0495607_0000864
841 Ga0495607_0001992
842 Ga0495607_0004549
843 Ga0495607_0028277
844 Ga0495607_0118947
845 Ga0495583_0000325
846 Ga0495583_0000482
847 Ga0495583_0000942
848 Ga0495583_0043713
849 Ga0495583_0096780
850 Ga0495606_0006428
851 Ga0495606_0007988
852 Ga0495610_0000183
853 Ga0495616_0000398
854 Ga0495616_0001144
855 Ga0495616_0001747
856 Ga0495616_0004144
857 Ga0495616_0023854
858 Ga0495616_0057068
859 Ga0495630_0133400
860 Ga0495631_0000406
861 Ga0495631_0013609
862 Ga0495631_0070553
863 Ga0495632_0000244
864 Ga0495632_0001124
865 Ga0495632_0013402
866 Ga0495632_0134564
867 Ga0495637_0000012
868 Ga0495643_0011107
869 Ga0495643_0019369
870 Ga0495643_0037928
871 Ga0495643_0102489
872 Ga0495644_0019603
873 Ga0495644_0036730
874 Ga0495644_0084517
875 Ga0495648_0001175
876 Ga0495648_0087409
877 Ga0495648_0093213
878 Ga0495648_0163013
879 Ga0495666_0027646
880 Ga0495642_0000669
881 Ga0495642_0002186
882 Ga0495642_0197958
883 Ga0495652_0055730
884 Ga0495652_0942081
885 Ga0495654_0012614
886 Ga0495654_0057059
887 Ga0495586_0018257
888 Ga0495587_0106088
889 Ga0495587_0129869
890 Ga0495609_0000001
891 Ga0495609_0015707
892 Ga0495609_0019545
893 Ga0495609_0027084
894 Ga0495609_0030745
895 Ga0495597_0000557
896 Ga0495645_0030245
897 Ga0495645_0595447
898 Ga0495633_0006678
899 Ga0495656_0072299
900 Ga0495656_0152964
901 Ga0495656_0360621
902 Ga0495668_0001940
903 Ga0495668_0002252
904 Ga0495668_0016074
905 Ga0495668_0043384
906 Ga0495611_0000290
907 Ga0495611_0006489
908 Ga0495611_0097723
909 Ga0495611_0222735
910 Ga0495625_0131369
911 Ga0495635_0025677
912 Ga0495661_0000625
913 Ga0495661_0001098
914 Ga0495661_0004845
915 Ga0495661_0030255
916 Ga0495661_0045652
917 Ga0495661_0069361
918 Ga0495661_0075699
919 Ga0495661_0115407
920 Ga0495661_0399945
921 Ga0495588_0000089
922 Ga0495588_0035392
923 Ga0495588_0387782
924 Ga0495646_0262749
925 Ga0495647_0005391
926 Ga0495669_0044269
927 Ga0495669_0062071
928 Ga0495669_0099405
929 Ga0495613_0090708
930 Ga0495624_0186508
931 Ga0495670_0000163
932 Ga0495671_0000391
933 Ga0495671_0004510
934 Ga0495649_0000115
935 Ga0495649_0000653
936 Ga0495649_0039859
937 Ga0495589_0000119
938 Ga0495589_0009748
939 Ga0495589_0118216
940 Ga0495589_0471952
941 Ga0495660_0007602
942 Ga0495660_0009576
943 Ga0495660_0026185
944 Ga0495581_0067865
945 Ga0495674_0035319
946 Ga0495672_0000124
947 Ga0495676_0077259
948 Ga0495680_0154403
949 Ga0495683_0000158
950 Ga0495683_0012259
951 Ga0495687_000019
952 Ga0495687_000332
953 Ga0495677_0000020
954 Ga0495677_0000913
955 Ga0495677_0003477
956 Ga0495677_0006329
957 Ga0495677_0144093
958 Ga0495679_002729
959 Ga0495679_016234
960 Ga0495681_0000205
961 Ga0495681_0001703
962 Ga0495681_0050598
963 Ga0495681_0071942
964 Ga0495686_0016413
965 Ga0495686_0125192
966 Ga0495593_0079935
967 Ga0495602_0164534
968 Ga0495614_0010192
969 Ga0495626_0000015
970 Ga0495626_0002031
971 Ga0495626_0003001
972 Ga0495626_0007762
973 Ga0495626_0036239
974 Ga0495626_0043469
975 Ga0496100_0870330
976 Ga0496101_0025194
977 Ga0496101_0098939
978 Ga0496101_1545937
979 Ga0496102_0000285
980 Ga0496102_0070751
981 Ga0496102_0109692
982 Ga0496102_0495066
983 Ga0496102_1280228
984 Ga0496103_0346335
985 Ga0496103_0400663
986 Ga0496103_0622521
987 Ga0496104_0116539
988 Ga0496104_0898622
989 Ga0496105_0211017
990 Ga0496106_0027936
991 Ga0496106_0041328
992 Ga0496107_0242112
993 Ga0496107_0687637
994 Ga0496108_0828281
995 Ga0496109_0027581
996 Ga0496109_0748275
997 Ga0496110_0876708
998 Ga0496111_0062981
999 Ga0496112_0477801
1000 Ga0496113_0018454
1001 Ga0496115_0071544
1002 Ga0496121_0214276
1003 Ga0496122_0000326
1004 Ga0496122_0002263
1005 Ga0496122_0007636
1006 Ga0496123_0000293
1007 Ga0496123_0002292
1008 Ga0496123_0017277
1009 Ga0496124_0041323
1010 Ga0496124_0178753
1011 Ga0496124_0606668
1012 Ga0496125_0000696
1013 Ga0496125_0082266
1014 Ga0496126_0184731
1015 Ga0496126_0339075
1016 Ga0495678_000144
1017 Ga0501034_0204345
1018 Ga0501034_0323380
1019 Ga0501038_0231168
1020 Ga0501038_0235587
1021 Ga0501047_0714270
1022 Ga0501075_0619912
1023 Ga0501080_0386335
1024 Ga0501035_0003131
1025 Ga0501044_0434590
1026 nmdc:mga0n895_40870_c1
1027 nmdc:mga0rr50_141176_c1
1028 nmdc:mga0rr50_396365_c1
1029 nmdc:mga08x19_566250_c1
1030 Ga0495619_0283911
1031 Ga0466962_0053864
1032 Ga0466962_0220089
1033 2508728231
1034 2509078000
1035 2643798678
1036 2644472536
1037 2774873290
1038 2776260685
1039 2835312846
1040 2882462086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

21

189

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8421 6 178
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8336 6 178
6f0k-assembly1.cif.gz_D alternative complex iii 0.7656 6 176
6f0k-assembly1.cif.gz_D alternative complex iii 0.7619 6 176
6btm-assembly1.cif.gz_D structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.6954 9 178
ID Description Score Start End Superfamily
af_Q4DXJ1_29_270_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.662 40 125 1.50.40.10
af_A4HU35_25_141_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5527 57 126 1.10.10.1740
2pc6D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5517 9 42 3.30.70.260
af_Q6DGQ9_4_151_1.20.940.10 Mainly Alpha;Up-down Bundle;RNA Binding Protein, Prp18; Chain A;Functional domain of the splicing factor Prp18 0.5372 54 119 1.20.940.10
af_C6TFJ4_25_136_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5362 59 126 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A4Q3J3X9-F1-model_v4 deleted 0.8724 6 178
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8718 1 178 GO:0016020
AF-A0A3D3RA05-F1-model_v4 Uncharacterized protein 0.8653 6 175 GO:0009055
GO:0020037
AF-A0A2E3Z3T6-F1-model_v4 Cytochrome c domain-containing protein 0.8652 6 178 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A5C5Z1B8-F1-model_v4 Cytochrome c domain-containing protein 0.8641 2 178 GO:0009055
GO:0016020
GO:0020037
GO:0046872

Map