F458566

General Info

Members Datasets Scaffolds Average Seq Length
520 253 1040 323

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0050214|Ga0395900_0050214_989_2053
Length 354
Sequence MVAPEPTLRLLIRLRANGTQPPEPTASVERVPADPAVETSRLHKRYGDVHALRGVDLRVETGSVFGLLGPNGAGKTTAVRILTTLLKPDEGSARVSGFDVVRDDARVRQQIGLAGQYAAVDENLTGFENLEMVGKLYHLGGGQSRERARELLSSFDLAEAADRLVRTYSGGMRRRLDLAAALVARPPVLFLDEPTTGLDIRSRIGLWDAIEALVSEGTTVLLTTQYLDEADRLADRIAVIDQGLVIAEGTPEQLKGQVGGERLEIHLCDDRRGEEAVAALASIASDRPFLEDGSVSVPVAQRRGTIADAVRRLDDAGIAIDDISVSTPTLDDVFLKLTGHAAEEETEESEAQTP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
251 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
252 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
253 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.19
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.85
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0050214 3300037418 Bacteria 4297
2 JGI25407J50210_10007329 3300003373 Bacteria 2762
3 Ga0070683_100018599 3300005329 Bacteria 6158
4 Ga0070683_100058113 3300005329 Bacteria 3594
5 Ga0070690_100063116 3300005330 Bacteria 2390
6 Ga0070680_100129362 3300005336 Bacteria 2111
7 Ga0068868_100063851 3300005338 Bacteria 2922
8 Ga0070660_100131131 3300005339 Bacteria 2006
9 Ga0070691_10028367 3300005341 Bacteria 2615
10 Ga0070691_10112815 3300005341 Bacteria 1361
11 Ga0070671_100018616 3300005355 Bacteria 5643
12 Ga0070674_100062159 3300005356 Bacteria 2609
13 Ga0070673_100252377 3300005364 Bacteria 1538
14 Ga0070703_10000026 3300005406 Bacteria 71473
15 Ga0070703_10022311 3300005406 Bacteria 1857
16 Ga0070714_100014098 3300005435 Bacteria 6415
17 Ga0070713_100083215 3300005436 Bacteria 2735
18 Ga0070713_100143570 3300005436 Bacteria 2117
19 Ga0070710_10002642 3300005437 Bacteria 8520
20 Ga0070710_10055769 3300005437 Bacteria 2234
21 Ga0070711_100142021 3300005439 Bacteria 1801
22 Ga0070705_100075143 3300005440 Bacteria 2057
23 Ga0070694_100035206 3300005444 Bacteria 3308
24 Ga0070708_100000120 3300005445 Bacteria 52583
25 Ga0070708_100002865 3300005445 Bacteria 13386
26 Ga0070708_100056015 3300005445 Bacteria 3506
27 Ga0070708_100070427 3300005445 Bacteria 3146
28 Ga0070663_100116225 3300005455 Bacteria 2016
29 Ga0070678_100029753 3300005456 Bacteria 3745
30 Ga0070662_100006485 3300005457 Bacteria 7546
31 Ga0070681_10064086 3300005458 Bacteria 3647
32 Ga0068867_100036127 3300005459 Bacteria 3585
33 Ga0068867_100037468 3300005459 Bacteria 3524
34 Ga0070706_100007277 3300005467 Bacteria 10391
35 Ga0070707_100001736 3300005468 Archaea 21001
36 Ga0070707_100068015 3300005468 Bacteria 3427
37 Ga0070707_100084465 3300005468 Bacteria 3068
38 Ga0070707_100117007 3300005468 Bacteria 2587
39 Ga0070698_100007362 3300005471 Bacteria 11917
40 Ga0070699_100028871 3300005518 Bacteria 4782
41 Ga0070699_100053946 3300005518 Archaea 3479
42 Ga0070699_100072618 3300005518 Bacteria 2993
43 Ga0070679_100002042 3300005530 Bacteria 18128
44 Ga0070684_100048181 3300005535 Bacteria 3696
45 Ga0070684_100239772 3300005535 Bacteria 1657
46 Ga0070684_100286154 3300005535 Bacteria 1511
47 Ga0070684_100363528 3300005535 Bacteria 1332
48 Ga0070697_100019699 3300005536 Bacteria 5329
49 Ga0070697_100200453 3300005536 Bacteria 1696
50 Ga0070686_100006067 3300005544 Bacteria 6704
51 Ga0070686_100126618 3300005544 Bacteria 1761
52 Ga0070695_100077493 3300005545 Bacteria 2190
53 Ga0070696_100003272 3300005546 Bacteria 10807
54 Ga0070696_100016403 3300005546 Bacteria 4988
55 Ga0070696_100082963 3300005546 Bacteria 2273
56 Ga0070693_100119657 3300005547 Bacteria 1631
57 Ga0070704_100084176 3300005549 Bacteria 2350
58 Ga0070704_100119822 3300005549 Bacteria 2019
59 Ga0068857_100029539 3300005577 Bacteria 4838
60 Ga0068854_100123556 3300005578 Bacteria 1968
61 Ga0070702_100025704 3300005615 Bacteria 3157
62 Ga0070702_100047770 3300005615 Bacteria 2433
63 Ga0070702_100082238 3300005615 Bacteria 1932
64 Ga0068852_100012000 3300005616 Bacteria 6554
65 Ga0068866_10026899 3300005718 Bacteria 2722
66 Ga0068866_10032311 3300005718 Bacteria 2530
67 Ga0068866_10121750 3300005718 Bacteria 1471
68 Ga0068861_100000908 3300005719 Bacteria 17963
69 Ga0068861_100047766 3300005719 Bacteria 3233
70 Ga0068861_100192061 3300005719 Bacteria 1708
71 Ga0068851_10136643 3300005834 Bacteria 1330
72 Ga0068870_10063067 3300005840 Bacteria 1998
73 Ga0068863_100025589 3300005841 Bacteria 5627
74 Ga0068858_100102876 3300005842 Bacteria 2664
75 Ga0081455_10039124 3300005937 Bacteria 4194
76 Ga0081538_10009870 3300005981 Bacteria 7895
77 Ga0081538_10035838 3300005981 Bacteria 3252
78 Ga0081538_10065249 3300005981 Bacteria 2052
79 Ga0081540_1007021 3300005983 Bacteria 8100
80 Ga0081540_1028259 3300005983 Bacteria 3154
81 Ga0081539_10008352 3300005985 Bacteria 9047
82 Ga0070717_10073041 3300006028 Bacteria 2866
83 Ga0075432_10011346 3300006058 Bacteria 3027
84 Ga0075432_10068959 3300006058 Bacteria 1268
85 Ga0070715_10006018 3300006163 Bacteria 4092
86 Ga0070712_100013005 3300006175 Bacteria 5308
87 Ga0070712_100177193 3300006175 Bacteria 1658
88 Ga0075428_100003230 3300006844 Bacteria 17837
89 Ga0075428_100013651 3300006844 Bacteria 9044
90 Ga0075428_100142988 3300006844 Bacteria 2601
91 Ga0075428_100156892 3300006844 Bacteria 2471
92 Ga0075430_100190063 3300006846 Bacteria 1707
93 Ga0075431_100087971 3300006847 Bacteria 3206
94 Ga0075433_10004133 3300006852 Bacteria 11259
95 Ga0075433_10007164 3300006852 Bacteria 8833
96 Ga0075433_10186345 3300006852 Bacteria 1846
97 Ga0075434_100000261 3300006871 Bacteria 37401
98 Ga0075434_100003302 3300006871 Bacteria 14420
99 Ga0075434_100006211 3300006871 Bacteria 10945
100 Ga0075429_100119032 3300006880 Bacteria 2308
101 Ga0068865_100016137 3300006881 Bacteria 4772
102 Ga0068865_100098623 3300006881 Bacteria 2135
103 Ga0068865_100138179 3300006881 Bacteria 1834
104 Ga0075436_100057773 3300006914 Bacteria 2679
105 Ga0075436_100059556 3300006914 Bacteria 2638
106 Ga0075436_100099235 3300006914 Bacteria 2027
107 Ga0075435_100002515 3300007076 Bacteria 12203
108 Ga0075435_100021872 3300007076 Bacteria 4928
109 Ga0075435_100059047 3300007076 Bacteria 3109
110 Ga0075435_100118177 3300007076 Bacteria 2210
111 Ga0075435_100162534 3300007076 Bacteria 1881
112 Ga0099794_10111914 3300007265 Archaea 1368
113 Ga0099794_10174337 3300007265 Bacteria 1097
114 Ga0111539_10044111 3300009094 Bacteria 5344
115 Ga0111539_10155604 3300009094 Bacteria 2675
116 Ga0111539_10370619 3300009094 Bacteria 1667
117 Ga0105245_10007654 3300009098 Bacteria 9461
118 Ga0105245_10027881 3300009098 Bacteria 4978
119 Ga0105245_10309268 3300009098 Bacteria 1553
120 Ga0114129_10002974 3300009147 Bacteria 23735
121 Ga0114129_10010332 3300009147 Bacteria 13317
122 Ga0114129_10010727 3300009147 Bacteria 13063
123 Ga0114129_10282041 3300009147 Bacteria 2219
124 Ga0114129_10288752 3300009147 Bacteria 2189
125 Ga0114129_10589543 3300009147 Bacteria 1441
126 Ga0114129_10670613 3300009147 Bacteria 1336
127 Ga0105243_10029533 3300009148 Bacteria 4217
128 Ga0105243_10103695 3300009148 Bacteria 2366
129 Ga0105243_10218095 3300009148 Bacteria 1684
130 Ga0105242_10009575 3300009176 Bacteria 7426
131 Ga0105242_10015420 3300009176 Bacteria 5935
132 Ga0105242_10023281 3300009176 Bacteria 4882
133 Ga0105242_10389475 3300009176 Bacteria 1297
134 Ga0105248_10039506 3300009177 Bacteria 5286
135 Ga0105239_10452932 3300010375 Bacteria 1456
136 Ga0157374_10089864 3300013296 Bacteria 2927
137 Ga0157378_10063262 3300013297 Bacteria 3306
138 Ga0157378_10422622 3300013297 Bacteria 1317
139 Ga0163162_10270615 3300013306 Bacteria 1830
140 Ga0157375_10014937 3300013308 Bacteria 6943
141 Ga0157375_10095198 3300013308 Bacteria 3048
142 Ga0157375_10119813 3300013308 Bacteria 2740
143 Ga0163163_10075199 3300014325 Bacteria 3371
144 Ga0157380_10112521 3300014326 Bacteria 2290
145 Ga0157376_10229330 3300014969 Bacteria 1724
146 Ga0224712_10029589 3300022467 Bacteria 1969
147 Ga0207653_10000009 3300025885 Bacteria 197279
148 Ga0207653_10005636 3300025885 Bacteria 3909
149 Ga0207692_10221287 3300025898 Bacteria 1122
150 Ga0207688_10016553 3300025901 Bacteria 3999
151 Ga0207684_10000058 3300025910 Bacteria 211166
152 Ga0207684_10037162 3300025910 Bacteria 4132
153 Ga0207654_10058695 3300025911 Bacteria 2241
154 Ga0207707_10087977 3300025912 Bacteria 2714
155 Ga0207693_10000186 3300025915 Bacteria 56666
156 Ga0207693_10004357 3300025915 Bacteria 11970
157 Ga0207663_10118493 3300025916 Bacteria 1808
158 Ga0207660_10150150 3300025917 Bacteria 1789
159 Ga0207662_10048326 3300025918 Bacteria 2520
160 Ga0207662_10202614 3300025918 Bacteria 1285
161 Ga0207657_10018315 3300025919 Bacteria 6690
162 Ga0207657_10196121 3300025919 Bacteria 1626
163 Ga0207652_10006174 3300025921 Bacteria 9685
164 Ga0207646_10000098 3300025922 Bacteria 116686
165 Ga0207646_10030962 3300025922 Unclassified 4846
166 Ga0207646_10081537 3300025922 Bacteria 2892
167 Ga0207646_10098010 3300025922 Unclassified 2627
168 Ga0207687_10024653 3300025927 Bacteria 4021
169 Ga0207687_10204692 3300025927 Bacteria 1545
170 Ga0207700_10105411 3300025928 Bacteria 2258
171 Ga0207664_10013605 3300025929 Bacteria 5849
172 Ga0207664_10207741 3300025929 Bacteria 1693
173 Ga0207644_10097491 3300025931 Bacteria 2202
174 Ga0207706_10003481 3300025933 Bacteria 15024
175 Ga0207706_10019105 3300025933 Bacteria 6165
176 Ga0207706_10135271 3300025933 Bacteria 2168
177 Ga0207686_10058322 3300025934 Bacteria 2433
178 Ga0207709_10015573 3300025935 Bacteria 4217
179 Ga0207709_10129999 3300025935 Bacteria 1715
180 Ga0207709_10179737 3300025935 Bacteria 1493
181 Ga0207709_10208882 3300025935 Bacteria 1400
182 Ga0207669_10055663 3300025937 Bacteria 2397
183 Ga0207704_10036625 3300025938 Bacteria 2824
184 Ga0207704_10261319 3300025938 Bacteria 1305
185 Ga0207665_10018687 3300025939 Bacteria 4555
186 Ga0207711_10023247 3300025941 Bacteria 5187
187 Ga0207689_10039944 3300025942 Bacteria 3884
188 Ga0207689_10350851 3300025942 Bacteria 1227
189 Ga0207661_10029170 3300025944 Bacteria 4234
190 Ga0207712_10007673 3300025961 Bacteria 6823
191 Ga0207712_10126793 3300025961 Bacteria 1939
192 Ga0207640_10094803 3300025981 Bacteria 2076
193 Ga0207677_10012069 3300026023 Bacteria 4950
194 Ga0207677_10151452 3300026023 Bacteria 1790
195 Ga0207677_10216913 3300026023 Bacteria 1532
196 Ga0207677_10317476 3300026023 Bacteria 1293
197 Ga0207703_10119509 3300026035 Bacteria 2260
198 Ga0207639_10074656 3300026041 Bacteria 2663
199 Ga0207678_10073884 3300026067 Bacteria 2922
200 Ga0207708_10035966 3300026075 Bacteria 3768
201 Ga0207708_10088825 3300026075 Bacteria 2381
202 Ga0207708_10101727 3300026075 Bacteria 2224
203 Ga0207702_10076604 3300026078 Bacteria 2891
204 Ga0207702_10087631 3300026078 Bacteria 2718
205 Ga0207702_10311182 3300026078 Bacteria 1498
206 Ga0207648_10014165 3300026089 Bacteria 7375
207 Ga0207648_10016461 3300026089 Bacteria 6753
208 Ga0207676_10252069 3300026095 Bacteria 1589
209 Ga0207675_100002310 3300026118 Bacteria 18939
210 Ga0207675_100022510 3300026118 Bacteria 5867
211 Ga0207683_10054581 3300026121 Bacteria 3503
212 Ga0207683_10084427 3300026121 Bacteria 2823
213 Ga0209588_1021563 3300027671 Unclassified 2025
214 Ga0209588_1026335 3300027671 Unclassified 1846
215 Ga0209588_1065452 3300027671 Archaea 1175
216 Ga0209588_1068365 3300027671 Archaea 1148
217 Ga0207428_10132423 3300027907 Bacteria 1907
218 Ga0373926_0000582 3300035083 Bacteria 9836
219 Ga0373944_0000211 3300035089 Bacteria 12536
220 Ga0373944_0004226 3300035089 Bacteria 3734
221 Ga0373949_0002804 3300035090 Bacteria 4337
222 Ga0373951_0004714 3300035091 Bacteria 3222
223 Ga0373923_0000636 3300035111 Bacteria 8823
224 Ga0373936_0002452 3300035113 Bacteria 6937
225 Ga0373941_0002276 3300035115 Bacteria 4199
226 Ga0373945_0001287 3300035116 Bacteria 7617
227 Ga0373960_0000378 3300035121 Bacteria 8629
228 Ga0373943_0004305 3300035170 Bacteria 6462
229 Ga0373946_0012275 3300035171 Bacteria 3204
230 Ga0373942_0002949 3300035207 Bacteria 4035
231 Ga0373935_0038198 3300035692 Bacteria 3005
232 Ga0373927_0132235 3300035695 Bacteria 1630
233 Ga0373925_0017029 3300037068 Bacteria 5261
234 Ga0373925_0093229 3300037068 Bacteria 2304
235 Ga0373925_0241410 3300037068 Bacteria 1447
236 Ga0395899_0004928 3300037312 Bacteria 10385
237 Ga0395899_0013532 3300037312 Bacteria 6238
238 Ga0395899_0246360 3300037312 Bacteria 1228
239 Ga0395900_0007121 3300037418 Bacteria 11589
240 Ga0395900_0022172 3300037418 Bacteria 6496
241 Ga0395900_0026049 3300037418 Bacteria 5987
242 Ga0395900_0032703 3300037418 Bacteria 5349
243 Ga0395900_0033458 3300037418 Bacteria 5290
244 Ga0395900_0053527 3300037418 Bacteria 4154
245 Ga0395898_0002634 3300037466 Bacteria 20880
246 Ga0395898_0005646 3300037466 Bacteria 13489
247 Ga0395898_0030495 3300037466 Bacteria 5396
248 Ga0395898_0057433 3300037466 Bacteria 3792
249 Ga0395898_0070628 3300037466 Bacteria 3375
250 Ga0395898_0171502 3300037466 Bacteria 2074
251 Ga0395898_0176303 3300037466 Bacteria 2043
252 Ga0395905_0004293 3300037471 Bacteria 14862
253 Ga0395905_0017853 3300037471 Bacteria 6740
254 Ga0395905_0029813 3300037471 Bacteria 5142
255 Ga0395905_0052664 3300037471 Bacteria 3810
256 Ga0395905_0101431 3300037471 Bacteria 2702
257 Ga0395901_0003959 3300038443 Bacteria 14900
258 Ga0395901_0017719 3300038443 Bacteria 7271
259 Ga0395901_0021088 3300038443 Bacteria 6675
260 Ga0395901_0061509 3300038443 Bacteria 3907
261 Ga0395901_0071691 3300038443 Bacteria 3610
262 Ga0395901_0166962 3300038443 Bacteria 2310
263 Ga0395901_0204856 3300038443 Bacteria 2067
264 Ga0395901_0278859 3300038443 Bacteria 1737
265 Ga0395901_0425255 3300038443 Bacteria 1361
266 Ga0395901_0440718 3300038443 Bacteria 1333
267 Ga0395901_0601137 3300038443 Bacteria 1109
268 Ga0451853_3218340 3300041512 Bacteria 5100
269 Ga0453683_0109046 3300044673 Bacteria 1741
270 Ga0451576_0007862 3300045051 Bacteria 12639
271 Ga0466967_0013193 3300045976 Bacteria 6371
272 Ga0466967_0254833 3300045976 Bacteria 1677
273 Ga0495603_0003556 3300046455 Bacteria 9280
274 Ga0495603_0179936 3300046455 Bacteria 1223
275 Ga0495629_0000843 3300046459 Bacteria 24754
276 Ga0495641_0001345 3300046461 Bacteria 21020
277 Ga0495641_0002373 3300046461 Bacteria 14938
278 Ga0495651_0054124 3300046462 Bacteria 3088
279 Ga0495582_0000028 3300046473 Bacteria 79694
280 Ga0495582_0002362 3300046473 Bacteria 10557
281 Ga0495582_0006292 3300046473 Bacteria 6613
282 Ga0495582_0035254 3300046473 Bacteria 2751
283 Ga0495639_0002539 3300046475 Bacteria 7963
284 Ga0495662_0003500 3300046476 Bacteria 7944
285 Ga0495584_0057553 3300046491 Bacteria 1956
286 Ga0495585_0067531 3300046492 Bacteria 1955
287 Ga0495594_0003701 3300046499 Bacteria 7847
288 Ga0495607_0095050 3300046501 Bacteria 1607
289 Ga0495616_0023880 3300046513 Bacteria 3286
290 Ga0495644_0003431 3300046523 Bacteria 6274
291 Ga0495663_0018560 3300046525 Bacteria 1981
292 Ga0495666_0011475 3300046526 Bacteria 4417
293 Ga0495666_0012683 3300046526 Bacteria 4200
294 Ga0495665_0000510 3300046531 Bacteria 19612
295 Ga0495665_0000674 3300046531 Bacteria 17494
296 Ga0495640_0009055 3300046533 Bacteria 7767
297 Ga0495640_0036326 3300046533 Bacteria 3481
298 Ga0495586_0001254 3300046535 Bacteria 14235
299 Ga0495586_0054680 3300046535 Bacteria 2164
300 Ga0495609_0016363 3300046538 Bacteria 3455
301 Ga0495633_0055526 3300046558 Bacteria 1862
302 Ga0495667_0018071 3300046559 Bacteria 4764
303 Ga0495656_0000070 3300046615 Bacteria 45889
304 Ga0495656_0000915 3300046615 Bacteria 9536
305 Ga0495656_0066446 3300046615 Bacteria 1589
306 Ga0495635_0000405 3300046663 Bacteria 27426
307 Ga0495635_0205199 3300046663 Bacteria 1336
308 Ga0495659_0000574 3300046664 Bacteria 13527
309 Ga0495588_0000551 3300046674 Bacteria 17985
310 Ga0495588_0000723 3300046674 Bacteria 15113
311 Ga0495647_0000078 3300046681 Bacteria 23693
312 Ga0495658_0000145 3300046683 Bacteria 39297
313 Ga0495613_0006132 3300046689 Bacteria 8997
314 Ga0495613_0039788 3300046689 Bacteria 3484
315 Ga0495613_0041900 3300046689 Bacteria 3389
316 Ga0495624_0178700 3300046690 Bacteria 1294
317 Ga0495670_0014511 3300046691 Bacteria 3872
318 Ga0495671_0035844 3300046692 Bacteria 2517
319 Ga0495581_0011928 3300047315 Bacteria 5028
320 Ga0495581_0014647 3300047315 Bacteria 4546
321 Ga0495581_0135788 3300047315 Bacteria 1434
322 Ga0495674_0013174 3300047319 Bacteria 7774
323 Ga0495674_0095920 3300047319 Bacteria 2528
324 Ga0495674_0113802 3300047319 Bacteria 2291
325 Ga0495676_0012996 3300047321 Bacteria 7492
326 Ga0495676_0096270 3300047321 Bacteria 2201
327 Ga0495680_0001316 3300047322 Bacteria 27084
328 Ga0495684_0028489 3300047471 Bacteria 4288
329 Ga0495593_0006768 3300047673 Bacteria 6709
330 Ga0495602_0147675 3300048088 Bacteria 1852
331 Ga0495614_0026181 3300048089 Bacteria 2514
332 Ga0496100_0016715 3300048903 Bacteria 4315
333 Ga0496100_0024901 3300048903 Bacteria 3655
334 Ga0496100_0191534 3300048903 Bacteria 1485
335 Ga0496100_0255825 3300048903 Bacteria 1297
336 Ga0496101_0019532 3300048904 Bacteria 4626
337 Ga0496101_0029941 3300048904 Bacteria 3811
338 Ga0496101_0040445 3300048904 Bacteria 3320
339 Ga0496101_0146596 3300048904 Bacteria 1803
340 Ga0496101_0298276 3300048904 Bacteria 1262
341 Ga0496102_0061577 3300048905 Bacteria 3434
342 Ga0496102_0073983 3300048905 Bacteria 3131
343 Ga0496102_0215024 3300048905 Bacteria 1812
344 Ga0496103_0039286 3300048906 Bacteria 2908
345 Ga0496103_0062812 3300048906 Bacteria 2312
346 Ga0496103_0099180 3300048906 Bacteria 1843
347 Ga0496104_0007124 3300048907 Bacteria 9858
348 Ga0496104_0101587 3300048907 Bacteria 2753
349 Ga0496105_0005385 3300048908 Bacteria 9705
350 Ga0496106_0014868 3300048909 Bacteria 5757
351 Ga0496106_0016292 3300048909 Bacteria 5500
352 Ga0496106_0026483 3300048909 Bacteria 4318
353 Ga0496106_0034528 3300048909 Bacteria 3778
354 Ga0496107_0019230 3300048910 Bacteria 4819
355 Ga0496107_0023128 3300048910 Bacteria 4393
356 Ga0496107_0023147 3300048910 Bacteria 4391
357 Ga0496108_0025750 3300048911 Bacteria 4850
358 Ga0496108_0284880 3300048911 Bacteria 1438
359 Ga0496109_0048953 3300048912 Bacteria 3846
360 Ga0496109_0066986 3300048912 Bacteria 3288
361 Ga0496109_0120441 3300048912 Bacteria 2445
362 Ga0496109_0171053 3300048912 Bacteria 2038
363 Ga0496110_0001841 3300048913 Bacteria 15643
364 Ga0496110_0179322 3300048913 Bacteria 1923
365 Ga0496111_0010459 3300048914 Bacteria 6227
366 Ga0496111_0030586 3300048914 Bacteria 3829
367 Ga0496111_0034809 3300048914 Bacteria 3597
368 Ga0496112_0103464 3300048915 Bacteria 2817
369 Ga0496112_0199470 3300048915 Bacteria 1961
370 Ga0496112_0209298 3300048915 Bacteria 1908
371 Ga0496113_0021570 3300048916 Bacteria 4545
372 Ga0496113_0413050 3300048916 Bacteria 1084
373 Ga0496114_0014401 3300048917 Bacteria 6348
374 Ga0496114_0015120 3300048917 Bacteria 6205
375 Ga0496114_0191964 3300048917 Bacteria 1787
376 Ga0496115_0000088 3300048918 Bacteria 86213
377 Ga0496115_0034539 3300048918 Bacteria 3996
378 Ga0496118_0002487 3300048921 Bacteria 24735
379 Ga0496120_0012177 3300048923 Bacteria 5867
380 Ga0496124_0001545 3300048927 Bacteria 33358
381 Ga0501031_0000649 3300049568 Bacteria 20612
382 Ga0501031_0024455 3300049568 Bacteria 3937
383 Ga0501031_0028160 3300049568 Bacteria 3663
384 Ga0501032_0000898 3300049569 Bacteria 24108
385 Ga0501033_0003948 3300049570 Bacteria 12025
386 Ga0501033_0237809 3300049570 Bacteria 1292
387 Ga0501034_0000422 3300049571 Bacteria 71009
388 Ga0501034_0299831 3300049571 Bacteria 1544
389 Ga0501036_0000071 3300049572 Bacteria 62451
390 Ga0501036_0028409 3300049572 Bacteria 4727
391 Ga0501036_0029173 3300049572 Bacteria 4663
392 Ga0501036_0051277 3300049572 Bacteria 3493
393 Ga0501036_0412316 3300049572 Bacteria 1126
394 Ga0501037_0000155 3300049573 Bacteria 63983
395 Ga0501038_0047108 3300049574 Bacteria 3735
396 Ga0501038_0047652 3300049574 Bacteria 3711
397 Ga0501038_0227372 3300049574 Bacteria 1486
398 Ga0501039_0003725 3300049575 Bacteria 11449
399 Ga0501039_0011319 3300049575 Bacteria 6795
400 Ga0501039_0059890 3300049575 Bacteria 2948
401 Ga0501039_0086157 3300049575 Bacteria 2446
402 Ga0501039_0152624 3300049575 Bacteria 1814
403 Ga0501040_0015066 3300049576 Bacteria 5109
404 Ga0501041_0017096 3300049577 Bacteria 4315
405 Ga0501041_0030338 3300049577 Bacteria 3263
406 Ga0501041_0118463 3300049577 Bacteria 1644
407 Ga0501042_0004344 3300049578 Bacteria 9039
408 Ga0501042_0012032 3300049578 Bacteria 5852
409 Ga0501042_0155836 3300049578 Bacteria 1647
410 Ga0501042_0251838 3300049578 Bacteria 1274
411 Ga0501043_0009790 3300049579 Bacteria 7512
412 Ga0501043_0126240 3300049579 Bacteria 2006
413 Ga0501043_0234800 3300049579 Bacteria 1415
414 Ga0501046_0000064 3300049580 Bacteria 116609
415 Ga0501046_0034641 3300049580 Bacteria 4072
416 Ga0501047_0000091 3300049581 Bacteria 114205
417 Ga0501048_0000255 3300049582 Bacteria 35606
418 Ga0501068_0008193 3300049584 Bacteria 5809
419 Ga0501068_0023230 3300049584 Bacteria 3632
420 Ga0501068_0055717 3300049584 Bacteria 2395
421 Ga0501069_0018529 3300049585 Bacteria 3758
422 Ga0501069_0057889 3300049585 Bacteria 2161
423 Ga0501069_0137455 3300049585 Bacteria 1401
424 Ga0501070_0000032 3300049586 Bacteria 131255
425 Ga0501070_0102340 3300049586 Bacteria 2369
426 Ga0501070_0275457 3300049586 Bacteria 1373
427 Ga0501071_0038367 3300049587 Bacteria 3423
428 Ga0501071_0052962 3300049587 Bacteria 2926
429 Ga0501071_0053346 3300049587 Bacteria 2916
430 Ga0501071_0081699 3300049587 Bacteria 2365
431 Ga0501072_0013718 3300049588 Bacteria 6203
432 Ga0501072_0087272 3300049588 Bacteria 2475
433 Ga0501072_0232810 3300049588 Bacteria 1467
434 Ga0501073_0010314 3300049589 Bacteria 6858
435 Ga0501074_0004230 3300049590 Bacteria 10244
436 Ga0501074_0048579 3300049590 Bacteria 3065
437 Ga0501074_0057666 3300049590 Bacteria 2797
438 Ga0501075_0011847 3300049591 Bacteria 6185
439 Ga0501075_0101540 3300049591 Bacteria 2184
440 Ga0501075_0176361 3300049591 Bacteria 1631
441 Ga0501075_0277204 3300049591 Bacteria 1278
442 Ga0501075_0288001 3300049591 Bacteria 1251
443 Ga0501076_0017318 3300049592 Bacteria 5474
444 Ga0501076_0037871 3300049592 Bacteria 3784
445 Ga0501076_0039547 3300049592 Bacteria 3702
446 Ga0501076_0072534 3300049592 Bacteria 2755
447 Ga0501076_0141674 3300049592 Bacteria 1953
448 Ga0501077_0027539 3300049593 Bacteria 3608
449 Ga0501077_0051615 3300049593 Bacteria 2613
450 Ga0501077_0073142 3300049593 Bacteria 2171
451 Ga0501077_0144231 3300049593 Bacteria 1510
452 Ga0501079_0020924 3300049741 Bacteria 5002
453 Ga0501079_0096918 3300049741 Bacteria 2286
454 Ga0501079_0208190 3300049741 Bacteria 1527
455 Ga0501080_0008013 3300049742 Bacteria 9574
456 Ga0501080_0011219 3300049742 Bacteria 8202
457 Ga0501080_0064039 3300049742 Bacteria 3421
458 Ga0501080_0076587 3300049742 Bacteria 3111
459 Ga0501081_0023417 3300049743 Bacteria 4138
460 Ga0501081_0103108 3300049743 Bacteria 2018
461 Ga0501081_0260326 3300049743 Bacteria 1267
462 Ga0501083_0000130 3300049744 Bacteria 51492
463 Ga0501035_0000044 3300049822 Bacteria 150521
464 Ga0501035_0062414 3300049822 Bacteria 3316
465 Ga0501035_0133305 3300049822 Bacteria 2164
466 Ga0501044_0000056 3300049823 Bacteria 139804
467 Ga0501044_0015027 3300049823 Bacteria 8346
468 Ga0501045_0006817 3300049824 Bacteria 7912
469 Ga0501045_0040796 3300049824 Bacteria 3376
470 Ga0501045_0045591 3300049824 Bacteria 3192
471 Ga0501045_0080635 3300049824 Bacteria 2399
472 Ga0501045_0086037 3300049824 Bacteria 2320
473 Ga0501045_0250966 3300049824 Bacteria 1317
474 nmdc:mga05p37_11265_c1 3300050507 Bacteria 10635
475 nmdc:mga05p37_11673_c1 3300050507 Bacteria 10468
476 nmdc:mga05p37_20470_c1 3300050507 Bacteria 8003
477 nmdc:mga05p37_283456_c1 3300050507 Bacteria 1975
478 nmdc:mga05p37_439885_c1 3300050507 Bacteria 1512
479 nmdc:mga09592_74710_c1 3300050508 Bacteria 2880
480 nmdc:mga09592_86440_c1 3300050508 Bacteria 2676
481 nmdc:mga0qj67_164754_c1 3300050509 Bacteria 1799
482 nmdc:mga0qj67_240562_c1 3300050509 Bacteria 1468
483 nmdc:mga06r32_155065_c1 3300050510 Bacteria 2271
484 nmdc:mga08y16_148741_c1 3300050511 Bacteria 2434
485 nmdc:mga08y16_235228_c1 3300050511 Bacteria 1895
486 nmdc:mga0n895_21907_c1 3300050512 Bacteria 5985
487 nmdc:mga0n895_308976_c1 3300050512 Bacteria 1603
488 nmdc:mga0n895_32021_c1 3300050512 Bacteria 5042
489 nmdc:mga0n895_371491_c1 3300050512 Bacteria 1448
490 nmdc:mga0n895_7728_c1 3300050512 Bacteria 9255
491 nmdc:mga0rr50_1450_c1 3300050513 Bacteria 13058
492 nmdc:mga0rr50_20987_c1 3300050513 Bacteria 4451
493 nmdc:mga0rr50_33690_c1 3300050513 Bacteria 3661
494 nmdc:mga0rr50_67052_c1 3300050513 Bacteria 2725
495 nmdc:mga08x19_14043_c1 3300050514 Bacteria 4852
496 nmdc:mga0a205_197063_c1 3300050515 Bacteria 1905
497 nmdc:mga0a205_2557_c1 3300050515 Bacteria 16034
498 nmdc:mga0a205_264388_c1 3300050515 Bacteria 1598
499 nmdc:mga0a205_299164_c1 3300050515 Bacteria 1482
500 nmdc:mga0a205_90228_c1 3300050515 Bacteria 2962
501 Ga0495595_0036425 3300053084 Bacteria 2233
502 Ga0495619_0002589 3300053085 Bacteria 11818
503 Ga0501084_0026549 3300054114 Bacteria 4833
504 Ga0501084_0059861 3300054114 Bacteria 3188
505 Ga0501084_0102780 3300054114 Bacteria 2400
506 Ga0501084_0238326 3300054114 Bacteria 1535
507 Ga0501084_0346216 3300054114 Bacteria 1255
508 Ga0590074_009301 3300059423 Archaea 1637
509 Ga0590075_002077 3300059424 Archaea 4828
510 Ga0590075_005114 3300059424 Archaea 3100
511 Ga0590075_005567 3300059424 Bacteria 2973
512 Ga0590077_018257 3300059426 Archaea 1480
513 Ga0501082_0001019 3300060353 Bacteria 24785
514 Ga0501082_0128036 3300060353 Bacteria 2202
515 Ga0501082_0249249 3300060353 Bacteria 1545
516 Ga0530510_0072935 3300061734 Bacteria 2491
517 2644197690 2643221635 Bacteria 2632343
518 2884694189 2884693830 Bacteria 11273186
519 2895444647 2895442618 Bacteria 11027144
520 2919714906 2919713450 Bacteria 7431245
521 Ga0395900_0050214
522 JGI25407J50210_10007329
523 Ga0070683_100018599
524 Ga0070683_100058113
525 Ga0070690_100063116
526 Ga0070680_100129362
527 Ga0068868_100063851
528 Ga0070660_100131131
529 Ga0070691_10028367
530 Ga0070691_10112815
531 Ga0070671_100018616
532 Ga0070674_100062159
533 Ga0070673_100252377
534 Ga0070703_10000026
535 Ga0070703_10022311
536 Ga0070714_100014098
537 Ga0070713_100083215
538 Ga0070713_100143570
539 Ga0070710_10002642
540 Ga0070710_10055769
541 Ga0070711_100142021
542 Ga0070705_100075143
543 Ga0070694_100035206
544 Ga0070708_100000120
545 Ga0070708_100002865
546 Ga0070708_100056015
547 Ga0070708_100070427
548 Ga0070663_100116225
549 Ga0070678_100029753
550 Ga0070662_100006485
551 Ga0070681_10064086
552 Ga0068867_100036127
553 Ga0068867_100037468
554 Ga0070706_100007277
555 Ga0070707_100001736
556 Ga0070707_100068015
557 Ga0070707_100084465
558 Ga0070707_100117007
559 Ga0070698_100007362
560 Ga0070699_100028871
561 Ga0070699_100053946
562 Ga0070699_100072618
563 Ga0070679_100002042
564 Ga0070684_100048181
565 Ga0070684_100239772
566 Ga0070684_100286154
567 Ga0070684_100363528
568 Ga0070697_100019699
569 Ga0070697_100200453
570 Ga0070686_100006067
571 Ga0070686_100126618
572 Ga0070695_100077493
573 Ga0070696_100003272
574 Ga0070696_100016403
575 Ga0070696_100082963
576 Ga0070693_100119657
577 Ga0070704_100084176
578 Ga0070704_100119822
579 Ga0068857_100029539
580 Ga0068854_100123556
581 Ga0070702_100025704
582 Ga0070702_100047770
583 Ga0070702_100082238
584 Ga0068852_100012000
585 Ga0068866_10026899
586 Ga0068866_10032311
587 Ga0068866_10121750
588 Ga0068861_100000908
589 Ga0068861_100047766
590 Ga0068861_100192061
591 Ga0068851_10136643
592 Ga0068870_10063067
593 Ga0068863_100025589
594 Ga0068858_100102876
595 Ga0081455_10039124
596 Ga0081538_10009870
597 Ga0081538_10035838
598 Ga0081538_10065249
599 Ga0081540_1007021
600 Ga0081540_1028259
601 Ga0081539_10008352
602 Ga0070717_10073041
603 Ga0075432_10011346
604 Ga0075432_10068959
605 Ga0070715_10006018
606 Ga0070712_100013005
607 Ga0070712_100177193
608 Ga0075428_100003230
609 Ga0075428_100013651
610 Ga0075428_100142988
611 Ga0075428_100156892
612 Ga0075430_100190063
613 Ga0075431_100087971
614 Ga0075433_10004133
615 Ga0075433_10007164
616 Ga0075433_10186345
617 Ga0075434_100000261
618 Ga0075434_100003302
619 Ga0075434_100006211
620 Ga0075429_100119032
621 Ga0068865_100016137
622 Ga0068865_100098623
623 Ga0068865_100138179
624 Ga0075436_100057773
625 Ga0075436_100059556
626 Ga0075436_100099235
627 Ga0075435_100002515
628 Ga0075435_100021872
629 Ga0075435_100059047
630 Ga0075435_100118177
631 Ga0075435_100162534
632 Ga0099794_10111914
633 Ga0099794_10174337
634 Ga0111539_10044111
635 Ga0111539_10155604
636 Ga0111539_10370619
637 Ga0105245_10007654
638 Ga0105245_10027881
639 Ga0105245_10309268
640 Ga0114129_10002974
641 Ga0114129_10010332
642 Ga0114129_10010727
643 Ga0114129_10282041
644 Ga0114129_10288752
645 Ga0114129_10589543
646 Ga0114129_10670613
647 Ga0105243_10029533
648 Ga0105243_10103695
649 Ga0105243_10218095
650 Ga0105242_10009575
651 Ga0105242_10015420
652 Ga0105242_10023281
653 Ga0105242_10389475
654 Ga0105248_10039506
655 Ga0105239_10452932
656 Ga0157374_10089864
657 Ga0157378_10063262
658 Ga0157378_10422622
659 Ga0163162_10270615
660 Ga0157375_10014937
661 Ga0157375_10095198
662 Ga0157375_10119813
663 Ga0163163_10075199
664 Ga0157380_10112521
665 Ga0157376_10229330
666 Ga0224712_10029589
667 Ga0207653_10000009
668 Ga0207653_10005636
669 Ga0207692_10221287
670 Ga0207688_10016553
671 Ga0207684_10000058
672 Ga0207684_10037162
673 Ga0207654_10058695
674 Ga0207707_10087977
675 Ga0207693_10000186
676 Ga0207693_10004357
677 Ga0207663_10118493
678 Ga0207660_10150150
679 Ga0207662_10048326
680 Ga0207662_10202614
681 Ga0207657_10018315
682 Ga0207657_10196121
683 Ga0207652_10006174
684 Ga0207646_10000098
685 Ga0207646_10030962
686 Ga0207646_10081537
687 Ga0207646_10098010
688 Ga0207687_10024653
689 Ga0207687_10204692
690 Ga0207700_10105411
691 Ga0207664_10013605
692 Ga0207664_10207741
693 Ga0207644_10097491
694 Ga0207706_10003481
695 Ga0207706_10019105
696 Ga0207706_10135271
697 Ga0207686_10058322
698 Ga0207709_10015573
699 Ga0207709_10129999
700 Ga0207709_10179737
701 Ga0207709_10208882
702 Ga0207669_10055663
703 Ga0207704_10036625
704 Ga0207704_10261319
705 Ga0207665_10018687
706 Ga0207711_10023247
707 Ga0207689_10039944
708 Ga0207689_10350851
709 Ga0207661_10029170
710 Ga0207712_10007673
711 Ga0207712_10126793
712 Ga0207640_10094803
713 Ga0207677_10012069
714 Ga0207677_10151452
715 Ga0207677_10216913
716 Ga0207677_10317476
717 Ga0207703_10119509
718 Ga0207639_10074656
719 Ga0207678_10073884
720 Ga0207708_10035966
721 Ga0207708_10088825
722 Ga0207708_10101727
723 Ga0207702_10076604
724 Ga0207702_10087631
725 Ga0207702_10311182
726 Ga0207648_10014165
727 Ga0207648_10016461
728 Ga0207676_10252069
729 Ga0207675_100002310
730 Ga0207675_100022510
731 Ga0207683_10054581
732 Ga0207683_10084427
733 Ga0209588_1021563
734 Ga0209588_1026335
735 Ga0209588_1065452
736 Ga0209588_1068365
737 Ga0207428_10132423
738 Ga0373926_0000582
739 Ga0373944_0000211
740 Ga0373944_0004226
741 Ga0373949_0002804
742 Ga0373951_0004714
743 Ga0373923_0000636
744 Ga0373936_0002452
745 Ga0373941_0002276
746 Ga0373945_0001287
747 Ga0373960_0000378
748 Ga0373943_0004305
749 Ga0373946_0012275
750 Ga0373942_0002949
751 Ga0373935_0038198
752 Ga0373927_0132235
753 Ga0373925_0017029
754 Ga0373925_0093229
755 Ga0373925_0241410
756 Ga0395899_0004928
757 Ga0395899_0013532
758 Ga0395899_0246360
759 Ga0395900_0007121
760 Ga0395900_0022172
761 Ga0395900_0026049
762 Ga0395900_0032703
763 Ga0395900_0033458
764 Ga0395900_0053527
765 Ga0395898_0002634
766 Ga0395898_0005646
767 Ga0395898_0030495
768 Ga0395898_0057433
769 Ga0395898_0070628
770 Ga0395898_0171502
771 Ga0395898_0176303
772 Ga0395905_0004293
773 Ga0395905_0017853
774 Ga0395905_0029813
775 Ga0395905_0052664
776 Ga0395905_0101431
777 Ga0395901_0003959
778 Ga0395901_0017719
779 Ga0395901_0021088
780 Ga0395901_0061509
781 Ga0395901_0071691
782 Ga0395901_0166962
783 Ga0395901_0204856
784 Ga0395901_0278859
785 Ga0395901_0425255
786 Ga0395901_0440718
787 Ga0395901_0601137
788 Ga0451853_3218340
789 Ga0453683_0109046
790 Ga0451576_0007862
791 Ga0466967_0013193
792 Ga0466967_0254833
793 Ga0495603_0003556
794 Ga0495603_0179936
795 Ga0495629_0000843
796 Ga0495641_0001345
797 Ga0495641_0002373
798 Ga0495651_0054124
799 Ga0495582_0000028
800 Ga0495582_0002362
801 Ga0495582_0006292
802 Ga0495582_0035254
803 Ga0495639_0002539
804 Ga0495662_0003500
805 Ga0495584_0057553
806 Ga0495585_0067531
807 Ga0495594_0003701
808 Ga0495607_0095050
809 Ga0495616_0023880
810 Ga0495644_0003431
811 Ga0495663_0018560
812 Ga0495666_0011475
813 Ga0495666_0012683
814 Ga0495665_0000510
815 Ga0495665_0000674
816 Ga0495640_0009055
817 Ga0495640_0036326
818 Ga0495586_0001254
819 Ga0495586_0054680
820 Ga0495609_0016363
821 Ga0495633_0055526
822 Ga0495667_0018071
823 Ga0495656_0000070
824 Ga0495656_0000915
825 Ga0495656_0066446
826 Ga0495635_0000405
827 Ga0495635_0205199
828 Ga0495659_0000574
829 Ga0495588_0000551
830 Ga0495588_0000723
831 Ga0495647_0000078
832 Ga0495658_0000145
833 Ga0495613_0006132
834 Ga0495613_0039788
835 Ga0495613_0041900
836 Ga0495624_0178700
837 Ga0495670_0014511
838 Ga0495671_0035844
839 Ga0495581_0011928
840 Ga0495581_0014647
841 Ga0495581_0135788
842 Ga0495674_0013174
843 Ga0495674_0095920
844 Ga0495674_0113802
845 Ga0495676_0012996
846 Ga0495676_0096270
847 Ga0495680_0001316
848 Ga0495684_0028489
849 Ga0495593_0006768
850 Ga0495602_0147675
851 Ga0495614_0026181
852 Ga0496100_0016715
853 Ga0496100_0024901
854 Ga0496100_0191534
855 Ga0496100_0255825
856 Ga0496101_0019532
857 Ga0496101_0029941
858 Ga0496101_0040445
859 Ga0496101_0146596
860 Ga0496101_0298276
861 Ga0496102_0061577
862 Ga0496102_0073983
863 Ga0496102_0215024
864 Ga0496103_0039286
865 Ga0496103_0062812
866 Ga0496103_0099180
867 Ga0496104_0007124
868 Ga0496104_0101587
869 Ga0496105_0005385
870 Ga0496106_0014868
871 Ga0496106_0016292
872 Ga0496106_0026483
873 Ga0496106_0034528
874 Ga0496107_0019230
875 Ga0496107_0023128
876 Ga0496107_0023147
877 Ga0496108_0025750
878 Ga0496108_0284880
879 Ga0496109_0048953
880 Ga0496109_0066986
881 Ga0496109_0120441
882 Ga0496109_0171053
883 Ga0496110_0001841
884 Ga0496110_0179322
885 Ga0496111_0010459
886 Ga0496111_0030586
887 Ga0496111_0034809
888 Ga0496112_0103464
889 Ga0496112_0199470
890 Ga0496112_0209298
891 Ga0496113_0021570
892 Ga0496113_0413050
893 Ga0496114_0014401
894 Ga0496114_0015120
895 Ga0496114_0191964
896 Ga0496115_0000088
897 Ga0496115_0034539
898 Ga0496118_0002487
899 Ga0496120_0012177
900 Ga0496124_0001545
901 Ga0501031_0000649
902 Ga0501031_0024455
903 Ga0501031_0028160
904 Ga0501032_0000898
905 Ga0501033_0003948
906 Ga0501033_0237809
907 Ga0501034_0000422
908 Ga0501034_0299831
909 Ga0501036_0000071
910 Ga0501036_0028409
911 Ga0501036_0029173
912 Ga0501036_0051277
913 Ga0501036_0412316
914 Ga0501037_0000155
915 Ga0501038_0047108
916 Ga0501038_0047652
917 Ga0501038_0227372
918 Ga0501039_0003725
919 Ga0501039_0011319
920 Ga0501039_0059890
921 Ga0501039_0086157
922 Ga0501039_0152624
923 Ga0501040_0015066
924 Ga0501041_0017096
925 Ga0501041_0030338
926 Ga0501041_0118463
927 Ga0501042_0004344
928 Ga0501042_0012032
929 Ga0501042_0155836
930 Ga0501042_0251838
931 Ga0501043_0009790
932 Ga0501043_0126240
933 Ga0501043_0234800
934 Ga0501046_0000064
935 Ga0501046_0034641
936 Ga0501047_0000091
937 Ga0501048_0000255
938 Ga0501068_0008193
939 Ga0501068_0023230
940 Ga0501068_0055717
941 Ga0501069_0018529
942 Ga0501069_0057889
943 Ga0501069_0137455
944 Ga0501070_0000032
945 Ga0501070_0102340
946 Ga0501070_0275457
947 Ga0501071_0038367
948 Ga0501071_0052962
949 Ga0501071_0053346
950 Ga0501071_0081699
951 Ga0501072_0013718
952 Ga0501072_0087272
953 Ga0501072_0232810
954 Ga0501073_0010314
955 Ga0501074_0004230
956 Ga0501074_0048579
957 Ga0501074_0057666
958 Ga0501075_0011847
959 Ga0501075_0101540
960 Ga0501075_0176361
961 Ga0501075_0277204
962 Ga0501075_0288001
963 Ga0501076_0017318
964 Ga0501076_0037871
965 Ga0501076_0039547
966 Ga0501076_0072534
967 Ga0501076_0141674
968 Ga0501077_0027539
969 Ga0501077_0051615
970 Ga0501077_0073142
971 Ga0501077_0144231
972 Ga0501079_0020924
973 Ga0501079_0096918
974 Ga0501079_0208190
975 Ga0501080_0008013
976 Ga0501080_0011219
977 Ga0501080_0064039
978 Ga0501080_0076587
979 Ga0501081_0023417
980 Ga0501081_0103108
981 Ga0501081_0260326
982 Ga0501083_0000130
983 Ga0501035_0000044
984 Ga0501035_0062414
985 Ga0501035_0133305
986 Ga0501044_0000056
987 Ga0501044_0015027
988 Ga0501045_0006817
989 Ga0501045_0040796
990 Ga0501045_0045591
991 Ga0501045_0080635
992 Ga0501045_0086037
993 Ga0501045_0250966
994 nmdc:mga05p37_11265_c1
995 nmdc:mga05p37_11673_c1
996 nmdc:mga05p37_20470_c1
997 nmdc:mga05p37_283456_c1
998 nmdc:mga05p37_439885_c1
999 nmdc:mga09592_74710_c1
1000 nmdc:mga09592_86440_c1
1001 nmdc:mga0qj67_164754_c1
1002 nmdc:mga0qj67_240562_c1
1003 nmdc:mga06r32_155065_c1
1004 nmdc:mga08y16_148741_c1
1005 nmdc:mga08y16_235228_c1
1006 nmdc:mga0n895_21907_c1
1007 nmdc:mga0n895_308976_c1
1008 nmdc:mga0n895_32021_c1
1009 nmdc:mga0n895_371491_c1
1010 nmdc:mga0n895_7728_c1
1011 nmdc:mga0rr50_1450_c1
1012 nmdc:mga0rr50_20987_c1
1013 nmdc:mga0rr50_33690_c1
1014 nmdc:mga0rr50_67052_c1
1015 nmdc:mga08x19_14043_c1
1016 nmdc:mga0a205_197063_c1
1017 nmdc:mga0a205_2557_c1
1018 nmdc:mga0a205_264388_c1
1019 nmdc:mga0a205_299164_c1
1020 nmdc:mga0a205_90228_c1
1021 Ga0495595_0036425
1022 Ga0495619_0002589
1023 Ga0501084_0026549
1024 Ga0501084_0059861
1025 Ga0501084_0102780
1026 Ga0501084_0238326
1027 Ga0501084_0346216
1028 Ga0590074_009301
1029 Ga0590075_002077
1030 Ga0590075_005114
1031 Ga0590075_005567
1032 Ga0590077_018257
1033 Ga0501082_0001019
1034 Ga0501082_0128036
1035 Ga0501082_0249249
1036 Ga0530510_0072935
1037 2644197690
1038 2884694189
1039 2895444647
1040 2919714906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

196

0.98

PF13732

DUF4162

Domain of unknown function (DUF4162)

249

338

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9488 4 222
5lj7-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9449 3 218
5lil-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9448 3 218
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9373 2 225
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.935 5 222
ID Description Score Start End Superfamily
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9724 2 226 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9694 2 227 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9694 1 221 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9663 1 228 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9628 2 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2R9UI31-F1-model_v4 ABC transporter 0.973 2 223 GO:0005524
GO:0016887
GO:0046677
AF-A0A7X0FRN7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9727 2 223 GO:0005524
GO:0016887
GO:0046677
AF-A0A7W7BQI4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9721 2 223 GO:0005524
GO:0016887
GO:0046677
AF-A0A0S9DLE0-F1-model_v4 ABC transporter domain-containing protein 0.9719 1 223 GO:0005524
GO:0016887
GO:0046677
AF-A0A4Q3AX05-F1-model_v4 ATP-binding cassette domain-containing protein 0.9694 1 211 GO:0005524
GO:0016887

Map