F458552

General Info

Members Datasets Scaffolds Average Seq Length
520 230 1040 460

Family's Representative Sequence

Representative Sequence 3300027462|Ga0210000_1001971|Ga0210000_10019711
Length 490
Sequence LRLELQSNALFYLTRDMSTFDTDRPRRKTPVIIVILATVTVGLIAAAYYLGPRFERDGPQIAFTPDSDVLGMAPLEITVGDAGSGLKSVTATLSVAGTDHTLAAEQYAQPVKEKKLTVAAAKLAGIKEGPAVLRVSARDNSLWRFFGGNETVVQKNITIDVTPPTLALIADDRYVTFGGVGAIVYKPSDDTVTSGVRIGDYFFPGHKGPVKGQPEHHIVLFAHAYNVPENAKAMLVATDKAGNRKEMPLVYELRGAKYRKSTITISDGFIQNTVTPLVSDVAARQGAAKDIFIAVNKRVRKQNEDKITAITRKSTPSVLWDGAFIQLSNSKVEANFADERTYVYNNENIDTAYHLGYDLSVTKRYPVEAANSGTVTFAGDLGIYGNTVILDHGLGLSTLYGHLSSIDVKEGDSIKKAQILGRTGETGLAAGDHLHYGVYLNGVAVLPVEWWDQKWINDNIQPKLEGRSGEEIAESQQPKVSRKAGKKRRR

Samples

Sample ID Description Type Environment
1 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.96
Rhizosphere 98.65
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0210000_1001971 3300027462 Bacteria 2897
2 Ga0065712_10095294 3300005290 Bacteria 2222
3 Ga0065715_10004842 3300005293 Unclassified 4721
4 Ga0070658_10054467 3300005327 Bacteria 3248
5 Ga0070676_10010072 3300005328 Bacteria 5120
6 Ga0070690_100000172 3300005330 Bacteria 33180
7 Ga0070690_100025331 3300005330 Bacteria 3653
8 Ga0070690_100052082 3300005330 Bacteria 2615
9 Ga0070690_100117590 3300005330 Bacteria 1781
10 Ga0070670_100013217 3300005331 Bacteria 7072
11 Ga0070670_100018721 3300005331 Bacteria 5936
12 Ga0070670_100022372 3300005331 Bacteria 5442
13 Ga0070670_100034663 3300005331 Bacteria 4343
14 Ga0070670_100058649 3300005331 Bacteria 3304
15 Ga0068869_100002130 3300005334 Bacteria 11893
16 Ga0070666_10015073 3300005335 Bacteria 4926
17 Ga0070680_100000230 3300005336 Bacteria 36894
18 Ga0070680_100027611 3300005336 Bacteria 4546
19 Ga0070680_100029956 3300005336 Bacteria 4370
20 Ga0070682_100002544 3300005337 Bacteria 10065
21 Ga0070682_100025098 3300005337 Bacteria 3555
22 Ga0068868_100001582 3300005338 Bacteria 15529
23 Ga0070689_100002159 3300005340 Bacteria 12754
24 Ga0070689_100006462 3300005340 Bacteria 8114
25 Ga0070689_100053588 3300005340 Bacteria 3122
26 Ga0070691_10000139 3300005341 Bacteria 22737
27 Ga0070687_100000141 3300005343 Bacteria 25042
28 Ga0070687_100051952 3300005343 Bacteria 2125
29 Ga0070692_10001959 3300005345 Bacteria 7798
30 Ga0070668_100010886 3300005347 Bacteria 6769
31 Ga0070669_100010574 3300005353 Bacteria 6552
32 Ga0070669_100041931 3300005353 Bacteria 3330
33 Ga0070669_100055496 3300005353 Bacteria 2903
34 Ga0070675_100024547 3300005354 Bacteria 4828
35 Ga0070675_100099461 3300005354 Unclassified 2448
36 Ga0070675_100218425 3300005354 Unclassified 1659
37 Ga0070675_100244017 3300005354 Bacteria 1570
38 Ga0070674_100069291 3300005356 Bacteria 2488
39 Ga0070673_100005891 3300005364 Bacteria 7909
40 Ga0070673_100018885 3300005364 Bacteria 4941
41 Ga0070673_100183251 3300005364 Bacteria 1793
42 Ga0070688_100001402 3300005365 Bacteria 12008
43 Ga0070667_100134085 3300005367 Bacteria 2164
44 Ga0070713_100000414 3300005436 Bacteria 27276
45 Ga0070713_100060099 3300005436 Bacteria 3176
46 Ga0070701_10006418 3300005438 Bacteria 4947
47 Ga0070711_100018761 3300005439 Bacteria 4424
48 Ga0070705_100004549 3300005440 Bacteria 6749
49 Ga0070700_100000280 3300005441 Bacteria 27286
50 Ga0070700_100003153 3300005441 Bacteria 8469
51 Ga0070694_100004235 3300005444 Bacteria 8628
52 Ga0070694_100033694 3300005444 Bacteria 3373
53 Ga0070678_100020462 3300005456 Bacteria 4342
54 Ga0070678_100045037 3300005456 Unclassified 3154
55 Ga0070678_100045917 3300005456 Bacteria 3129
56 Ga0070662_100034751 3300005457 Bacteria 3556
57 Ga0070662_100107796 3300005457 Bacteria 2118
58 Ga0070681_10001610 3300005458 Bacteria 20098
59 Ga0070681_10005711 3300005458 Bacteria 12026
60 Ga0070681_10010545 3300005458 Bacteria 9125
61 Ga0070681_10037976 3300005458 Bacteria 4829
62 Ga0070681_10053053 3300005458 Bacteria 4041
63 Ga0068867_100009041 3300005459 Bacteria 7029
64 Ga0068867_100039437 3300005459 Bacteria 3444
65 Ga0068867_100053000 3300005459 Bacteria 2995
66 Ga0068867_100203942 3300005459 Bacteria 1584
67 Ga0070679_100002377 3300005530 Bacteria 17058
68 Ga0070679_100018649 3300005530 Bacteria 6735
69 Ga0070679_100097366 3300005530 Bacteria 2930
70 Ga0070684_100055541 3300005535 Bacteria 3453
71 Ga0070697_100032234 3300005536 Bacteria 4216
72 Ga0070697_100053499 3300005536 Bacteria 3281
73 Ga0070697_100100126 3300005536 Unclassified 2407
74 Ga0070672_100018045 3300005543 Bacteria 5092
75 Ga0070686_100000437 3300005544 Bacteria 25891
76 Ga0070686_100048383 3300005544 Bacteria 2693
77 Ga0070695_100000408 3300005545 Bacteria 22184
78 Ga0070695_100019176 3300005545 Bacteria 4161
79 Ga0070695_100022283 3300005545 Bacteria 3885
80 Ga0070695_100026390 3300005545 Bacteria 3593
81 Ga0070695_100028826 3300005545 Bacteria 3447
82 Ga0070695_100035808 3300005545 Bacteria 3119
83 Ga0070696_100000061 3300005546 Bacteria 52371
84 Ga0070696_100002436 3300005546 Bacteria 12335
85 Ga0070696_100023301 3300005546 Bacteria 4208
86 Ga0070696_100031183 3300005546 Bacteria 3652
87 Ga0070696_100044542 3300005546 Bacteria 3072
88 Ga0070693_100000016 3300005547 Bacteria 63019
89 Ga0070693_100001791 3300005547 Bacteria 9791
90 Ga0070693_100010162 3300005547 Bacteria 4705
91 Ga0070704_100000246 3300005549 Bacteria 23326
92 Ga0070704_100000425 3300005549 Bacteria 19637
93 Ga0070704_100021036 3300005549 Bacteria 4222
94 Ga0070704_100053162 3300005549 Unclassified 2862
95 Ga0068855_100000975 3300005563 Bacteria 35626
96 Ga0068855_100021641 3300005563 Bacteria 7713
97 Ga0068855_100042021 3300005563 Bacteria 5417
98 Ga0068855_100042987 3300005563 Bacteria 5354
99 Ga0068855_100093242 3300005563 Bacteria 3472
100 Ga0070664_100011561 3300005564 Bacteria 7163
101 Ga0070664_100249884 3300005564 Bacteria 1594
102 Ga0068854_100000366 3300005578 Bacteria 28906
103 Ga0068854_100065459 3300005578 Bacteria 2642
104 Ga0068856_100045552 3300005614 Bacteria 4319
105 Ga0070702_100000017 3300005615 Bacteria 47208
106 Ga0068852_100058201 3300005616 Bacteria 3346
107 Ga0068852_100060468 3300005616 Bacteria 3288
108 Ga0068852_100083776 3300005616 Bacteria 2836
109 Ga0068852_100124047 3300005616 Bacteria 2369
110 Ga0068852_100131572 3300005616 Unclassified 2305
111 Ga0068859_100000738 3300005617 Bacteria 32951
112 Ga0068864_100001883 3300005618 Bacteria 17231
113 Ga0068864_100019058 3300005618 Bacteria 5735
114 Ga0068864_100021417 3300005618 Bacteria 5416
115 Ga0068864_100081922 3300005618 Bacteria 2830
116 Ga0068864_100280219 3300005618 Bacteria 1556
117 Ga0068866_10017201 3300005718 Bacteria 3247
118 Ga0068861_100000309 3300005719 Bacteria 27335
119 Ga0068861_100004551 3300005719 Bacteria 9309
120 Ga0068861_100098488 3300005719 Bacteria 2321
121 Ga0068851_10000569 3300005834 Bacteria 16057
122 Ga0068870_10018383 3300005840 Bacteria 3374
123 Ga0068863_100004424 3300005841 Bacteria 13860
124 Ga0068863_100006353 3300005841 Bacteria 11588
125 Ga0068863_100041980 3300005841 Unclassified 4347
126 Ga0068863_100047241 3300005841 Bacteria 4084
127 Ga0068858_100000619 3300005842 Bacteria 37094
128 Ga0068858_100024138 3300005842 Bacteria 5666
129 Ga0068858_100160102 3300005842 Bacteria 2119
130 Ga0068860_100006625 3300005843 Bacteria 11629
131 Ga0068860_100123661 3300005843 Bacteria 2479
132 Ga0068860_100136149 3300005843 Bacteria 2359
133 Ga0068862_100001981 3300005844 Bacteria 18578
134 Ga0068862_100018588 3300005844 Bacteria 5789
135 Ga0068862_100020391 3300005844 Bacteria 5538
136 Ga0081455_10000670 3300005937 Bacteria 44305
137 Ga0081538_10003591 3300005981 Bacteria 14585
138 Ga0081539_10003204 3300005985 Bacteria 20680
139 Ga0070715_10025161 3300006163 Bacteria 2354
140 Ga0070712_100051577 3300006175 Bacteria 2866
141 Ga0097621_100007009 3300006237 Bacteria 8026
142 Ga0097621_100011734 3300006237 Bacteria 6470
143 Ga0068871_100003554 3300006358 Bacteria 10726
144 Ga0068871_100012981 3300006358 Bacteria 6169
145 Ga0068871_100027408 3300006358 Bacteria 4455
146 Ga0068871_100044986 3300006358 Bacteria 3551
147 Ga0068871_100070067 3300006358 Bacteria 2881
148 Ga0075428_100000280 3300006844 Bacteria 50009
149 Ga0075428_100000532 3300006844 Bacteria 38828
150 Ga0075428_100094025 3300006844 Bacteria 3268
151 Ga0075428_100163943 3300006844 Bacteria 2411
152 Ga0075430_100020045 3300006846 Bacteria 5693
153 Ga0075431_100044285 3300006847 Bacteria 4590
154 Ga0075431_100074696 3300006847 Bacteria 3497
155 Ga0075433_10001487 3300006852 Bacteria 17307
156 Ga0075433_10014897 3300006852 Bacteria 6363
157 Ga0075433_10173271 3300006852 Unclassified 1920
158 Ga0075433_10254795 3300006852 Bacteria 1557
159 Ga0075434_100002617 3300006871 Bacteria 15870
160 Ga0075434_100010888 3300006871 Bacteria 8551
161 Ga0075434_100068297 3300006871 Unclassified 3540
162 Ga0075434_100113695 3300006871 Unclassified 2719
163 Ga0075429_100000326 3300006880 Bacteria 34334
164 Ga0075429_100001707 3300006880 Bacteria 18162
165 Ga0068865_100000262 3300006881 Bacteria 28966
166 Ga0068865_100080223 3300006881 Bacteria 2340
167 Ga0075436_100001708 3300006914 Bacteria 15033
168 Ga0075436_100016285 3300006914 Bacteria 5089
169 Ga0075436_100020836 3300006914 Bacteria 4497
170 Ga0097620_100000738 3300006931 Bacteria 32951
171 Ga0075435_100001144 3300007076 Bacteria 16936
172 Ga0075435_100020998 3300007076 Bacteria 5016
173 Ga0075435_100027198 3300007076 Bacteria 4471
174 Ga0105240_10022093 3300009093 Bacteria 8443
175 Ga0105240_10072648 3300009093 Bacteria 4251
176 Ga0105240_10111214 3300009093 Bacteria 3314
177 Ga0111539_10010191 3300009094 Bacteria 11844
178 Ga0111539_10023514 3300009094 Bacteria 7572
179 Ga0111539_10034022 3300009094 Bacteria 6183
180 Ga0111539_10068239 3300009094 Bacteria 4198
181 Ga0111539_10087128 3300009094 Bacteria 3669
182 Ga0111539_10102007 3300009094 Bacteria 3368
183 Ga0111539_10114467 3300009094 Bacteria 3163
184 Ga0105245_10000178 3300009098 Bacteria 60846
185 Ga0105245_10018648 3300009098 Bacteria 6069
186 Ga0105245_10155210 3300009098 Bacteria 2168
187 Ga0105245_10163439 3300009098 Bacteria 2114
188 Ga0114129_10010193 3300009147 Bacteria 13398
189 Ga0114129_10025781 3300009147 Bacteria 8326
190 Ga0114129_10118850 3300009147 Bacteria 3641
191 Ga0114129_10137185 3300009147 Bacteria 3356
192 Ga0105243_10000270 3300009148 Bacteria 58296
193 Ga0105243_10017530 3300009148 Bacteria 5414
194 Ga0105241_10006403 3300009174 Bacteria 8678
195 Ga0105241_10037314 3300009174 Unclassified 3660
196 Ga0105242_10000409 3300009176 Bacteria 34163
197 Ga0105242_10010155 3300009176 Bacteria 7212
198 Ga0105242_10014718 3300009176 Bacteria 6058
199 Ga0105242_10029616 3300009176 Bacteria 4366
200 Ga0105242_10036016 3300009176 Unclassified 3968
201 Ga0105248_10018495 3300009177 Bacteria 7701
202 Ga0105248_10031604 3300009177 Bacteria 5915
203 Ga0105248_10047614 3300009177 Bacteria 4808
204 Ga0105248_10067920 3300009177 Bacteria 4003
205 Ga0105248_10089957 3300009177 Bacteria 3456
206 Ga0105248_10129933 3300009177 Bacteria 2842
207 Ga0105237_10139117 3300009545 Unclassified 2422
208 Ga0105238_10006200 3300009551 Bacteria 11873
209 Ga0105238_10023368 3300009551 Bacteria 6301
210 Ga0105238_10082267 3300009551 Bacteria 3209
211 Ga0105249_10004034 3300009553 Bacteria 12667
212 Ga0105249_10051426 3300009553 Bacteria 3758
213 Ga0105249_10053607 3300009553 Bacteria 3686
214 Ga0105249_10098039 3300009553 Bacteria 2752
215 Ga0105249_10110045 3300009553 Bacteria 2603
216 Ga0105239_10021323 3300010375 Bacteria 7144
217 Ga0157370_10043676 3300013104 Bacteria 4312
218 Ga0157369_10002605 3300013105 Bacteria 21576
219 Ga0157374_10091394 3300013296 Bacteria 2903
220 Ga0157378_10000340 3300013297 Bacteria 46001
221 Ga0157378_10017431 3300013297 Bacteria 6304
222 Ga0157378_10024893 3300013297 Bacteria 5272
223 Ga0157378_10048546 3300013297 Bacteria 3775
224 Ga0157378_10060200 3300013297 Bacteria 3388
225 Ga0157378_10066091 3300013297 Bacteria 3238
226 Ga0157378_10070467 3300013297 Bacteria 3139
227 Ga0157378_10104302 3300013297 Bacteria 2591
228 Ga0163162_10023992 3300013306 Bacteria 6019
229 Ga0163162_10154509 3300013306 Unclassified 2414
230 Ga0163162_10218578 3300013306 Bacteria 2035
231 Ga0157372_10001919 3300013307 Bacteria 22569
232 Ga0157372_10040301 3300013307 Bacteria 5158
233 Ga0157372_10141803 3300013307 Bacteria 2769
234 Ga0157372_10165049 3300013307 Bacteria 2561
235 Ga0157375_10025747 3300013308 Bacteria 5473
236 Ga0157375_10038608 3300013308 Bacteria 4585
237 Ga0157375_10052275 3300013308 Bacteria 4015
238 Ga0157375_10053275 3300013308 Bacteria 3980
239 Ga0157375_10057182 3300013308 Bacteria 3854
240 Ga0157380_10008930 3300014326 Bacteria 7163
241 Ga0157380_10039555 3300014326 Bacteria 3668
242 Ga0157380_10133494 3300014326 Bacteria 2121
243 Ga0157377_10022982 3300014745 Bacteria 3299
244 Ga0157379_10021786 3300014968 Bacteria 5677
245 Ga0157379_10088385 3300014968 Bacteria 2779
246 Ga0157376_10014689 3300014969 Bacteria 5888
247 Ga0157376_10017556 3300014969 Bacteria 5463
248 Ga0157376_10047893 3300014969 Unclassified 3531
249 Ga0213876_10026419 3300021384 Bacteria 3062
250 Ga0207656_10054399 3300025321 Bacteria 1740
251 Ga0207682_10026575 3300025893 Bacteria 2302
252 Ga0207680_10060108 3300025903 Bacteria 2312
253 Ga0207699_10021508 3300025906 Bacteria 3478
254 Ga0207645_10009759 3300025907 Bacteria 6625
255 Ga0207645_10037571 3300025907 Bacteria 3107
256 Ga0207643_10037326 3300025908 Bacteria 2726
257 Ga0207643_10068542 3300025908 Unclassified 2038
258 Ga0207707_10039254 3300025912 Bacteria 4139
259 Ga0207707_10068423 3300025912 Bacteria 3094
260 Ga0207707_10174551 3300025912 Bacteria 1877
261 Ga0207707_10224163 3300025912 Bacteria 1636
262 Ga0207695_10084222 3300025913 Bacteria 3210
263 Ga0207695_10092380 3300025913 Bacteria 3037
264 Ga0207663_10019376 3300025916 Bacteria 3832
265 Ga0207660_10001584 3300025917 Bacteria 15265
266 Ga0207660_10014583 3300025917 Bacteria 5171
267 Ga0207662_10000047 3300025918 Bacteria 52763
268 Ga0207657_10009476 3300025919 Bacteria 9783
269 Ga0207649_10016766 3300025920 Bacteria 4141
270 Ga0207652_10015794 3300025921 Bacteria 6151
271 Ga0207681_10029349 3300025923 Bacteria 3571
272 Ga0207681_10043339 3300025923 Bacteria 3011
273 Ga0207681_10057863 3300025923 Bacteria 2652
274 Ga0207681_10061184 3300025923 Bacteria 2587
275 Ga0207694_10024573 3300025924 Bacteria 4576
276 Ga0207694_10056122 3300025924 Bacteria 3059
277 Ga0207694_10132603 3300025924 Bacteria 1998
278 Ga0207650_10001271 3300025925 Bacteria 18310
279 Ga0207650_10003005 3300025925 Bacteria 11622
280 Ga0207650_10009500 3300025925 Bacteria 6646
281 Ga0207650_10128244 3300025925 Bacteria 1982
282 Ga0207659_10027899 3300025926 Bacteria 3830
283 Ga0207659_10032507 3300025926 Bacteria 3582
284 Ga0207659_10092686 3300025926 Bacteria 2259
285 Ga0207659_10187086 3300025926 Bacteria 1645
286 Ga0207659_10218058 3300025926 Bacteria 1532
287 Ga0207687_10030140 3300025927 Bacteria 3655
288 Ga0207700_10001649 3300025928 Bacteria 12686
289 Ga0207700_10057904 3300025928 Bacteria 2924
290 Ga0207664_10059630 3300025929 Bacteria 3040
291 Ga0207644_10090791 3300025931 Bacteria 2276
292 Ga0207706_10025617 3300025933 Bacteria 5284
293 Ga0207706_10049250 3300025933 Bacteria 3724
294 Ga0207706_10126298 3300025933 Bacteria 2250
295 Ga0207686_10032348 3300025934 Bacteria 3112
296 Ga0207709_10002410 3300025935 Bacteria 11759
297 Ga0207670_10000462 3300025936 Bacteria 22646
298 Ga0207704_10001562 3300025938 Bacteria 10262
299 Ga0207691_10000648 3300025940 Bacteria 34431
300 Ga0207691_10004740 3300025940 Bacteria 13153
301 Ga0207691_10072020 3300025940 Bacteria 3117
302 Ga0207691_10184232 3300025940 Unclassified 1823
303 Ga0207711_10052698 3300025941 Bacteria 3488
304 Ga0207689_10000148 3300025942 Bacteria 60276
305 Ga0207689_10059011 3300025942 Bacteria 3156
306 Ga0207689_10069232 3300025942 Bacteria 2899
307 Ga0207661_10018942 3300025944 Bacteria 5122
308 Ga0207667_10017487 3300025949 Bacteria 8068
309 Ga0207667_10064871 3300025949 Bacteria 3811
310 Ga0207667_10167274 3300025949 Bacteria 2260
311 Ga0207651_10093297 3300025960 Bacteria 2210
312 Ga0207651_10103217 3300025960 Bacteria 2121
313 Ga0207712_10026293 3300025961 Bacteria 3875
314 Ga0207668_10010400 3300025972 Bacteria 5621
315 Ga0207668_10070990 3300025972 Bacteria 2486
316 Ga0207658_10110930 3300025986 Bacteria 2168
317 Ga0207658_10207729 3300025986 Bacteria 1639
318 Ga0207677_10002010 3300026023 Bacteria 10724
319 Ga0207677_10047969 3300026023 Bacteria 2872
320 Ga0207703_10043274 3300026035 Bacteria 3614
321 Ga0207708_10000347 3300026075 Bacteria 36295
322 Ga0207708_10003778 3300026075 Bacteria 11163
323 Ga0207708_10046363 3300026075 Bacteria 3310
324 Ga0207702_10020237 3300026078 Bacteria 5512
325 Ga0207641_10063541 3300026088 Bacteria 3154
326 Ga0207641_10074858 3300026088 Bacteria 2922
327 Ga0207641_10080695 3300026088 Bacteria 2823
328 Ga0207641_10131684 3300026088 Bacteria 2246
329 Ga0207648_10000018 3300026089 Bacteria 148157
330 Ga0207648_10005195 3300026089 Bacteria 13186
331 Ga0207648_10033629 3300026089 Bacteria 4522
332 Ga0207648_10041145 3300026089 Bacteria 4059
333 Ga0207648_10070296 3300026089 Bacteria 3052
334 Ga0207648_10076328 3300026089 Bacteria 2921
335 Ga0207676_10008391 3300026095 Bacteria 7344
336 Ga0207676_10069006 3300026095 Bacteria 2829
337 Ga0207676_10069389 3300026095 Bacteria 2822
338 Ga0207675_100000170 3300026118 Bacteria 58303
339 Ga0207675_100002615 3300026118 Bacteria 17813
340 Ga0207675_100038817 3300026118 Bacteria 4443
341 Ga0207675_100055554 3300026118 Bacteria 3694
342 Ga0207675_100113911 3300026118 Bacteria 2553
343 Ga0207683_10002790 3300026121 Bacteria 15247
344 Ga0207683_10029032 3300026121 Bacteria 4787
345 Ga0207683_10068652 3300026121 Unclassified 3130
346 Ga0207683_10148388 3300026121 Bacteria 2116
347 Ga0207698_10102972 3300026142 Bacteria 2371
348 Ga0207698_10105416 3300026142 Unclassified 2349
349 Ga0207698_10130435 3300026142 Bacteria 2147
350 Ga0207698_10201745 3300026142 Bacteria 1781
351 Ga0209967_1004097 3300027364 Bacteria 1928
352 Ga0209995_1001036 3300027471 Bacteria 4270
353 Ga0209983_1004803 3300027665 Bacteria 2821
354 Ga0209971_1005004 3300027682 Bacteria 3150
355 Ga0209974_10000514 3300027876 Bacteria 12921
356 Ga0209974_10003679 3300027876 Bacteria 5506
357 Ga0207428_10006536 3300027907 Bacteria 10752
358 Ga0207428_10008668 3300027907 Bacteria 9183
359 Ga0207428_10039142 3300027907 Bacteria 3849
360 Ga0207428_10040151 3300027907 Bacteria 3798
361 Ga0268265_10086877 3300028380 Bacteria 2486
362 Ga0268265_10108130 3300028380 Bacteria 2263
363 Ga0268264_10001414 3300028381 Bacteria 22435
364 Ga0268264_10103440 3300028381 Bacteria 2480
365 Ga0268264_10233125 3300028381 Bacteria 1701
366 Ga0265328_10002120 3300031239 Bacteria 8950
367 Ga0265320_10047207 3300031240 Bacteria 2107
368 Ga0265331_10003434 3300031250 Bacteria 10243
369 Ga0307408_100082531 3300031548 Bacteria 2406
370 Ga0265314_10003302 3300031711 Bacteria 15753
371 Ga0307416_100125750 3300032002 Bacteria 2296
372 Ga0307416_100130964 3300032002 Bacteria 2258
373 Ga0373926_0017322 3300035083 Bacteria 2471
374 Ga0373926_0034534 3300035083 Unclassified 1791
375 Ga0373932_0001089 3300035112 Bacteria 7833
376 Ga0373931_0001064 3300035691 Bacteria 11608
377 Ga0373931_0019066 3300035691 Bacteria 3419
378 Ga0373935_0014535 3300035692 Bacteria 4749
379 Ga0373935_0049193 3300035692 Bacteria 2671
380 Ga0373927_0041442 3300035695 Bacteria 2986
381 Ga0373947_0013325 3300035725 Bacteria 4710
382 Ga0373947_0022187 3300035725 Bacteria 3678
383 Ga0373937_0025315 3300036401 Bacteria 5357
384 Ga0373925_0025536 3300037068 Bacteria 4317
385 Ga0373925_0028972 3300037068 Bacteria 4059
386 Ga0395905_0058879 3300037471 Bacteria 3592
387 Ga0395901_0026971 3300038443 Bacteria 5899
388 Ga0436365_1183730 3300039437 Bacteria 3321
389 Ga0451807_2547817 3300041486 Bacteria 3338
390 Ga0439446_0008109 3300042156 Bacteria 2779
391 Ga0439446_0015864 3300042156 Bacteria 2094
392 Ga0439434_0001216 3300042435 Bacteria 7408
393 Ga0439435_0000818 3300042436 Bacteria 5297
394 Ga0439435_0002782 3300042436 Unclassified 3533
395 Ga0451577_0001529 3300042876 Bacteria 30377
396 Ga0451577_0012973 3300042876 Bacteria 7817
397 Ga0451577_0082783 3300042876 Bacteria 2862
398 Ga0451577_0107329 3300042876 Bacteria 2496
399 Ga0451577_0117508 3300042876 Bacteria 2382
400 Ga0466966_0062056 3300044684 Bacteria 2357
401 Ga0451576_0005143 3300045051 Bacteria 16568
402 Ga0451576_0007515 3300045051 Bacteria 13000
403 Ga0451576_0010394 3300045051 Bacteria 10685
404 Ga0451576_0027067 3300045051 Bacteria 6162
405 Ga0451576_0028795 3300045051 Bacteria 5948
406 Ga0451576_0133588 3300045051 Bacteria 2587
407 Ga0495653_0132247 3300046463 Bacteria 1765
408 Ga0495580_0007617 3300046472 Bacteria 8688
409 Ga0495642_0013865 3300046528 Bacteria 3121
410 Ga0495621_0013717 3300046539 Bacteria 2551
411 Ga0495635_0022905 3300046663 Bacteria 4354
412 Ga0495599_0002648 3300046678 Bacteria 10443
413 Ga0495623_0025114 3300046679 Bacteria 3839
414 Ga0495658_0017144 3300046683 Bacteria 3737
415 Ga0495658_0032260 3300046683 Bacteria 2859
416 Ga0495675_0050674 3300047444 Bacteria 2639
417 Ga0495684_0097966 3300047471 Bacteria 2218
418 Ga0496110_0121782 3300048913 Bacteria 2351
419 Ga0496111_0148261 3300048914 Unclassified 1740
420 Ga0496112_0044925 3300048915 Bacteria 4329
421 Ga0496112_0046028 3300048915 Bacteria 4278
422 Ga0501033_0008319 3300049570 Bacteria 8035
423 Ga0501033_0014932 3300049570 Bacteria 5896
424 Ga0501036_0009472 3300049572 Bacteria 8010
425 Ga0501036_0012560 3300049572 Bacteria 7024
426 Ga0501036_0022316 3300049572 Bacteria 5325
427 Ga0501037_0010890 3300049573 Bacteria 6682
428 Ga0501038_0012222 3300049574 Bacteria 7839
429 Ga0501038_0022087 3300049574 Bacteria 5704
430 Ga0501040_0004146 3300049576 Bacteria 9433
431 Ga0501040_0010956 3300049576 Bacteria 5929
432 Ga0501040_0196345 3300049576 Bacteria 1432
433 Ga0501041_0000798 3300049577 Bacteria 16832
434 Ga0501041_0001554 3300049577 Bacteria 12778
435 Ga0501042_0005694 3300049578 Bacteria 8044
436 Ga0501042_0005983 3300049578 Bacteria 7872
437 Ga0501042_0011010 3300049578 Bacteria 6089
438 Ga0501043_0018257 3300049579 Bacteria 5499
439 Ga0501043_0148840 3300049579 Bacteria 1832
440 Ga0501046_0003495 3300049580 Bacteria 14398
441 Ga0501046_0015418 3300049580 Bacteria 6420
442 Ga0501047_0014881 3300049581 Bacteria 7405
443 Ga0501047_0184741 3300049581 Bacteria 1950
444 Ga0501048_0008265 3300049582 Bacteria 7872
445 Ga0501048_0012175 3300049582 Bacteria 6408
446 Ga0501048_0019409 3300049582 Bacteria 4989
447 Ga0501048_0033852 3300049582 Bacteria 3690
448 Ga0501048_0052802 3300049582 Bacteria 2893
449 Ga0501068_0017960 3300049584 Bacteria 4094
450 Ga0501068_0089127 3300049584 Bacteria 1901
451 Ga0501069_0004035 3300049585 Bacteria 7577
452 Ga0501070_0010992 3300049586 Bacteria 7642
453 Ga0501070_0014646 3300049586 Bacteria 6599
454 Ga0501070_0022467 3300049586 Bacteria 5283
455 Ga0501071_0004738 3300049587 Bacteria 8655
456 Ga0501071_0039776 3300049587 Bacteria 3364
457 Ga0501072_0005927 3300049588 Bacteria 9310
458 Ga0501072_0008711 3300049588 Bacteria 7702
459 Ga0501072_0058370 3300049588 Bacteria 3042
460 Ga0501073_0002085 3300049589 Bacteria 14964
461 Ga0501073_0013408 3300049589 Bacteria 5962
462 Ga0501074_0003021 3300049590 Bacteria 11849
463 Ga0501074_0006092 3300049590 Bacteria 8707
464 Ga0501074_0016618 3300049590 Bacteria 5341
465 Ga0501075_0001389 3300049591 Bacteria 15748
466 Ga0501075_0119586 3300049591 Bacteria 2004
467 Ga0501076_0039273 3300049592 Bacteria 3716
468 Ga0501076_0091884 3300049592 Bacteria 2441
469 Ga0501077_0003126 3300049593 Bacteria 9948
470 Ga0501079_0002590 3300049741 Bacteria 13144
471 Ga0501079_0005329 3300049741 Bacteria 9572
472 Ga0501080_0003094 3300049742 Bacteria 14696
473 Ga0501080_0015604 3300049742 Bacteria 7005
474 Ga0501080_0271488 3300049742 Bacteria 1543
475 Ga0501081_0000769 3300049743 Bacteria 18795
476 Ga0501081_0004853 3300049743 Bacteria 8643
477 Ga0501083_0024871 3300049744 Bacteria 4147
478 Ga0501083_0081921 3300049744 Bacteria 2139
479 Ga0501035_0028899 3300049822 Bacteria 5059
480 Ga0501035_0052420 3300049822 Bacteria 3650
481 Ga0501044_0026021 3300049823 Bacteria 6198
482 Ga0501045_0002680 3300049824 Bacteria 12145
483 nmdc:mga05p37_1126_c1 3300050507 Bacteria 30703
484 nmdc:mga05p37_120_c1 3300050507 Bacteria 70765
485 nmdc:mga05p37_209466_c1 3300050507 Bacteria 2357
486 nmdc:mga05p37_384870_c1 3300050507 Bacteria 1642
487 nmdc:mga05p37_73498_c1 3300050507 Unclassified 4208
488 nmdc:mga09592_1925_c1 3300050508 Bacteria 16694
489 nmdc:mga09592_40849_c1 3300050508 Bacteria 3898
490 nmdc:mga09592_4340_c1 3300050508 Bacteria 11465
491 nmdc:mga0qj67_80398_c1 3300050509 Bacteria 2611
492 nmdc:mga06r32_58462_c1 3300050510 Bacteria 3706
493 nmdc:mga06r32_8746_c1 3300050510 Bacteria 9121
494 nmdc:mga08y16_127018_c1 3300050511 Bacteria 2652
495 nmdc:mga08y16_139523_c1 3300050511 Bacteria 2520
496 nmdc:mga08y16_17240_c1 3300050511 Bacteria 7603
497 nmdc:mga08y16_192358_c1 3300050511 Bacteria 2116
498 nmdc:mga08y16_31583_c1 3300050511 Bacteria 5569
499 nmdc:mga08y16_33396_c1 3300050511 Bacteria 5404
500 nmdc:mga08y16_9171_c1 3300050511 Bacteria 10386
501 nmdc:mga0n895_934_c1 3300050512 Bacteria 21112
502 nmdc:mga0rr50_120452_c1 3300050513 Bacteria 2088
503 nmdc:mga0rr50_3727_c1 3300050513 Bacteria 8829
504 nmdc:mga0rr50_75814_c1 3300050513 Bacteria 2579
505 nmdc:mga0rr50_84864_c1 3300050513 Bacteria 2453
506 nmdc:mga08x19_130233_c1 3300050514 Bacteria 1692
507 nmdc:mga08x19_13513_c1 3300050514 Bacteria 4938
508 nmdc:mga08x19_1453_c1 3300050514 Bacteria 14665
509 nmdc:mga08x19_3837_c1 3300050514 Bacteria 8942
510 nmdc:mga08x19_465_c1 3300050514 Bacteria 27361
511 nmdc:mga08x19_66536_c1 3300050514 Bacteria 2342
512 nmdc:mga0a205_19994_c1 3300050515 Bacteria 6317
513 nmdc:mga0a205_215054_c1 3300050515 Unclassified 1809
514 nmdc:mga0a205_3757_c1 3300050515 Bacteria 13594
515 Ga0501084_0060997 3300054114 Bacteria 3157
516 Ga0501084_0092145 3300054114 Bacteria 2544
517 Ga0501084_0116696 3300054114 Bacteria 2244
518 Ga0501082_0002425 3300060353 Bacteria 16371
519 Ga0530510_0005770 3300061734 Bacteria 8578
520 Ga0530510_0009316 3300061734 Bacteria 6888
521 Ga0210000_1001971
522 Ga0065712_10095294
523 Ga0065715_10004842
524 Ga0070658_10054467
525 Ga0070676_10010072
526 Ga0070690_100000172
527 Ga0070690_100025331
528 Ga0070690_100052082
529 Ga0070690_100117590
530 Ga0070670_100013217
531 Ga0070670_100018721
532 Ga0070670_100022372
533 Ga0070670_100034663
534 Ga0070670_100058649
535 Ga0068869_100002130
536 Ga0070666_10015073
537 Ga0070680_100000230
538 Ga0070680_100027611
539 Ga0070680_100029956
540 Ga0070682_100002544
541 Ga0070682_100025098
542 Ga0068868_100001582
543 Ga0070689_100002159
544 Ga0070689_100006462
545 Ga0070689_100053588
546 Ga0070691_10000139
547 Ga0070687_100000141
548 Ga0070687_100051952
549 Ga0070692_10001959
550 Ga0070668_100010886
551 Ga0070669_100010574
552 Ga0070669_100041931
553 Ga0070669_100055496
554 Ga0070675_100024547
555 Ga0070675_100099461
556 Ga0070675_100218425
557 Ga0070675_100244017
558 Ga0070674_100069291
559 Ga0070673_100005891
560 Ga0070673_100018885
561 Ga0070673_100183251
562 Ga0070688_100001402
563 Ga0070667_100134085
564 Ga0070713_100000414
565 Ga0070713_100060099
566 Ga0070701_10006418
567 Ga0070711_100018761
568 Ga0070705_100004549
569 Ga0070700_100000280
570 Ga0070700_100003153
571 Ga0070694_100004235
572 Ga0070694_100033694
573 Ga0070678_100020462
574 Ga0070678_100045037
575 Ga0070678_100045917
576 Ga0070662_100034751
577 Ga0070662_100107796
578 Ga0070681_10001610
579 Ga0070681_10005711
580 Ga0070681_10010545
581 Ga0070681_10037976
582 Ga0070681_10053053
583 Ga0068867_100009041
584 Ga0068867_100039437
585 Ga0068867_100053000
586 Ga0068867_100203942
587 Ga0070679_100002377
588 Ga0070679_100018649
589 Ga0070679_100097366
590 Ga0070684_100055541
591 Ga0070697_100032234
592 Ga0070697_100053499
593 Ga0070697_100100126
594 Ga0070672_100018045
595 Ga0070686_100000437
596 Ga0070686_100048383
597 Ga0070695_100000408
598 Ga0070695_100019176
599 Ga0070695_100022283
600 Ga0070695_100026390
601 Ga0070695_100028826
602 Ga0070695_100035808
603 Ga0070696_100000061
604 Ga0070696_100002436
605 Ga0070696_100023301
606 Ga0070696_100031183
607 Ga0070696_100044542
608 Ga0070693_100000016
609 Ga0070693_100001791
610 Ga0070693_100010162
611 Ga0070704_100000246
612 Ga0070704_100000425
613 Ga0070704_100021036
614 Ga0070704_100053162
615 Ga0068855_100000975
616 Ga0068855_100021641
617 Ga0068855_100042021
618 Ga0068855_100042987
619 Ga0068855_100093242
620 Ga0070664_100011561
621 Ga0070664_100249884
622 Ga0068854_100000366
623 Ga0068854_100065459
624 Ga0068856_100045552
625 Ga0070702_100000017
626 Ga0068852_100058201
627 Ga0068852_100060468
628 Ga0068852_100083776
629 Ga0068852_100124047
630 Ga0068852_100131572
631 Ga0068859_100000738
632 Ga0068864_100001883
633 Ga0068864_100019058
634 Ga0068864_100021417
635 Ga0068864_100081922
636 Ga0068864_100280219
637 Ga0068866_10017201
638 Ga0068861_100000309
639 Ga0068861_100004551
640 Ga0068861_100098488
641 Ga0068851_10000569
642 Ga0068870_10018383
643 Ga0068863_100004424
644 Ga0068863_100006353
645 Ga0068863_100041980
646 Ga0068863_100047241
647 Ga0068858_100000619
648 Ga0068858_100024138
649 Ga0068858_100160102
650 Ga0068860_100006625
651 Ga0068860_100123661
652 Ga0068860_100136149
653 Ga0068862_100001981
654 Ga0068862_100018588
655 Ga0068862_100020391
656 Ga0081455_10000670
657 Ga0081538_10003591
658 Ga0081539_10003204
659 Ga0070715_10025161
660 Ga0070712_100051577
661 Ga0097621_100007009
662 Ga0097621_100011734
663 Ga0068871_100003554
664 Ga0068871_100012981
665 Ga0068871_100027408
666 Ga0068871_100044986
667 Ga0068871_100070067
668 Ga0075428_100000280
669 Ga0075428_100000532
670 Ga0075428_100094025
671 Ga0075428_100163943
672 Ga0075430_100020045
673 Ga0075431_100044285
674 Ga0075431_100074696
675 Ga0075433_10001487
676 Ga0075433_10014897
677 Ga0075433_10173271
678 Ga0075433_10254795
679 Ga0075434_100002617
680 Ga0075434_100010888
681 Ga0075434_100068297
682 Ga0075434_100113695
683 Ga0075429_100000326
684 Ga0075429_100001707
685 Ga0068865_100000262
686 Ga0068865_100080223
687 Ga0075436_100001708
688 Ga0075436_100016285
689 Ga0075436_100020836
690 Ga0097620_100000738
691 Ga0075435_100001144
692 Ga0075435_100020998
693 Ga0075435_100027198
694 Ga0105240_10022093
695 Ga0105240_10072648
696 Ga0105240_10111214
697 Ga0111539_10010191
698 Ga0111539_10023514
699 Ga0111539_10034022
700 Ga0111539_10068239
701 Ga0111539_10087128
702 Ga0111539_10102007
703 Ga0111539_10114467
704 Ga0105245_10000178
705 Ga0105245_10018648
706 Ga0105245_10155210
707 Ga0105245_10163439
708 Ga0114129_10010193
709 Ga0114129_10025781
710 Ga0114129_10118850
711 Ga0114129_10137185
712 Ga0105243_10000270
713 Ga0105243_10017530
714 Ga0105241_10006403
715 Ga0105241_10037314
716 Ga0105242_10000409
717 Ga0105242_10010155
718 Ga0105242_10014718
719 Ga0105242_10029616
720 Ga0105242_10036016
721 Ga0105248_10018495
722 Ga0105248_10031604
723 Ga0105248_10047614
724 Ga0105248_10067920
725 Ga0105248_10089957
726 Ga0105248_10129933
727 Ga0105237_10139117
728 Ga0105238_10006200
729 Ga0105238_10023368
730 Ga0105238_10082267
731 Ga0105249_10004034
732 Ga0105249_10051426
733 Ga0105249_10053607
734 Ga0105249_10098039
735 Ga0105249_10110045
736 Ga0105239_10021323
737 Ga0157370_10043676
738 Ga0157369_10002605
739 Ga0157374_10091394
740 Ga0157378_10000340
741 Ga0157378_10017431
742 Ga0157378_10024893
743 Ga0157378_10048546
744 Ga0157378_10060200
745 Ga0157378_10066091
746 Ga0157378_10070467
747 Ga0157378_10104302
748 Ga0163162_10023992
749 Ga0163162_10154509
750 Ga0163162_10218578
751 Ga0157372_10001919
752 Ga0157372_10040301
753 Ga0157372_10141803
754 Ga0157372_10165049
755 Ga0157375_10025747
756 Ga0157375_10038608
757 Ga0157375_10052275
758 Ga0157375_10053275
759 Ga0157375_10057182
760 Ga0157380_10008930
761 Ga0157380_10039555
762 Ga0157380_10133494
763 Ga0157377_10022982
764 Ga0157379_10021786
765 Ga0157379_10088385
766 Ga0157376_10014689
767 Ga0157376_10017556
768 Ga0157376_10047893
769 Ga0213876_10026419
770 Ga0207656_10054399
771 Ga0207682_10026575
772 Ga0207680_10060108
773 Ga0207699_10021508
774 Ga0207645_10009759
775 Ga0207645_10037571
776 Ga0207643_10037326
777 Ga0207643_10068542
778 Ga0207707_10039254
779 Ga0207707_10068423
780 Ga0207707_10174551
781 Ga0207707_10224163
782 Ga0207695_10084222
783 Ga0207695_10092380
784 Ga0207663_10019376
785 Ga0207660_10001584
786 Ga0207660_10014583
787 Ga0207662_10000047
788 Ga0207657_10009476
789 Ga0207649_10016766
790 Ga0207652_10015794
791 Ga0207681_10029349
792 Ga0207681_10043339
793 Ga0207681_10057863
794 Ga0207681_10061184
795 Ga0207694_10024573
796 Ga0207694_10056122
797 Ga0207694_10132603
798 Ga0207650_10001271
799 Ga0207650_10003005
800 Ga0207650_10009500
801 Ga0207650_10128244
802 Ga0207659_10027899
803 Ga0207659_10032507
804 Ga0207659_10092686
805 Ga0207659_10187086
806 Ga0207659_10218058
807 Ga0207687_10030140
808 Ga0207700_10001649
809 Ga0207700_10057904
810 Ga0207664_10059630
811 Ga0207644_10090791
812 Ga0207706_10025617
813 Ga0207706_10049250
814 Ga0207706_10126298
815 Ga0207686_10032348
816 Ga0207709_10002410
817 Ga0207670_10000462
818 Ga0207704_10001562
819 Ga0207691_10000648
820 Ga0207691_10004740
821 Ga0207691_10072020
822 Ga0207691_10184232
823 Ga0207711_10052698
824 Ga0207689_10000148
825 Ga0207689_10059011
826 Ga0207689_10069232
827 Ga0207661_10018942
828 Ga0207667_10017487
829 Ga0207667_10064871
830 Ga0207667_10167274
831 Ga0207651_10093297
832 Ga0207651_10103217
833 Ga0207712_10026293
834 Ga0207668_10010400
835 Ga0207668_10070990
836 Ga0207658_10110930
837 Ga0207658_10207729
838 Ga0207677_10002010
839 Ga0207677_10047969
840 Ga0207703_10043274
841 Ga0207708_10000347
842 Ga0207708_10003778
843 Ga0207708_10046363
844 Ga0207702_10020237
845 Ga0207641_10063541
846 Ga0207641_10074858
847 Ga0207641_10080695
848 Ga0207641_10131684
849 Ga0207648_10000018
850 Ga0207648_10005195
851 Ga0207648_10033629
852 Ga0207648_10041145
853 Ga0207648_10070296
854 Ga0207648_10076328
855 Ga0207676_10008391
856 Ga0207676_10069006
857 Ga0207676_10069389
858 Ga0207675_100000170
859 Ga0207675_100002615
860 Ga0207675_100038817
861 Ga0207675_100055554
862 Ga0207675_100113911
863 Ga0207683_10002790
864 Ga0207683_10029032
865 Ga0207683_10068652
866 Ga0207683_10148388
867 Ga0207698_10102972
868 Ga0207698_10105416
869 Ga0207698_10130435
870 Ga0207698_10201745
871 Ga0209967_1004097
872 Ga0209995_1001036
873 Ga0209983_1004803
874 Ga0209971_1005004
875 Ga0209974_10000514
876 Ga0209974_10003679
877 Ga0207428_10006536
878 Ga0207428_10008668
879 Ga0207428_10039142
880 Ga0207428_10040151
881 Ga0268265_10086877
882 Ga0268265_10108130
883 Ga0268264_10001414
884 Ga0268264_10103440
885 Ga0268264_10233125
886 Ga0265328_10002120
887 Ga0265320_10047207
888 Ga0265331_10003434
889 Ga0307408_100082531
890 Ga0265314_10003302
891 Ga0307416_100125750
892 Ga0307416_100130964
893 Ga0373926_0017322
894 Ga0373926_0034534
895 Ga0373932_0001089
896 Ga0373931_0001064
897 Ga0373931_0019066
898 Ga0373935_0014535
899 Ga0373935_0049193
900 Ga0373927_0041442
901 Ga0373947_0013325
902 Ga0373947_0022187
903 Ga0373937_0025315
904 Ga0373925_0025536
905 Ga0373925_0028972
906 Ga0395905_0058879
907 Ga0395901_0026971
908 Ga0436365_1183730
909 Ga0451807_2547817
910 Ga0439446_0008109
911 Ga0439446_0015864
912 Ga0439434_0001216
913 Ga0439435_0000818
914 Ga0439435_0002782
915 Ga0451577_0001529
916 Ga0451577_0012973
917 Ga0451577_0082783
918 Ga0451577_0107329
919 Ga0451577_0117508
920 Ga0466966_0062056
921 Ga0451576_0005143
922 Ga0451576_0007515
923 Ga0451576_0010394
924 Ga0451576_0027067
925 Ga0451576_0028795
926 Ga0451576_0133588
927 Ga0495653_0132247
928 Ga0495580_0007617
929 Ga0495642_0013865
930 Ga0495621_0013717
931 Ga0495635_0022905
932 Ga0495599_0002648
933 Ga0495623_0025114
934 Ga0495658_0017144
935 Ga0495658_0032260
936 Ga0495675_0050674
937 Ga0495684_0097966
938 Ga0496110_0121782
939 Ga0496111_0148261
940 Ga0496112_0044925
941 Ga0496112_0046028
942 Ga0501033_0008319
943 Ga0501033_0014932
944 Ga0501036_0009472
945 Ga0501036_0012560
946 Ga0501036_0022316
947 Ga0501037_0010890
948 Ga0501038_0012222
949 Ga0501038_0022087
950 Ga0501040_0004146
951 Ga0501040_0010956
952 Ga0501040_0196345
953 Ga0501041_0000798
954 Ga0501041_0001554
955 Ga0501042_0005694
956 Ga0501042_0005983
957 Ga0501042_0011010
958 Ga0501043_0018257
959 Ga0501043_0148840
960 Ga0501046_0003495
961 Ga0501046_0015418
962 Ga0501047_0014881
963 Ga0501047_0184741
964 Ga0501048_0008265
965 Ga0501048_0012175
966 Ga0501048_0019409
967 Ga0501048_0033852
968 Ga0501048_0052802
969 Ga0501068_0017960
970 Ga0501068_0089127
971 Ga0501069_0004035
972 Ga0501070_0010992
973 Ga0501070_0014646
974 Ga0501070_0022467
975 Ga0501071_0004738
976 Ga0501071_0039776
977 Ga0501072_0005927
978 Ga0501072_0008711
979 Ga0501072_0058370
980 Ga0501073_0002085
981 Ga0501073_0013408
982 Ga0501074_0003021
983 Ga0501074_0006092
984 Ga0501074_0016618
985 Ga0501075_0001389
986 Ga0501075_0119586
987 Ga0501076_0039273
988 Ga0501076_0091884
989 Ga0501077_0003126
990 Ga0501079_0002590
991 Ga0501079_0005329
992 Ga0501080_0003094
993 Ga0501080_0015604
994 Ga0501080_0271488
995 Ga0501081_0000769
996 Ga0501081_0004853
997 Ga0501083_0024871
998 Ga0501083_0081921
999 Ga0501035_0028899
1000 Ga0501035_0052420
1001 Ga0501044_0026021
1002 Ga0501045_0002680
1003 nmdc:mga05p37_1126_c1
1004 nmdc:mga05p37_120_c1
1005 nmdc:mga05p37_209466_c1
1006 nmdc:mga05p37_384870_c1
1007 nmdc:mga05p37_73498_c1
1008 nmdc:mga09592_1925_c1
1009 nmdc:mga09592_40849_c1
1010 nmdc:mga09592_4340_c1
1011 nmdc:mga0qj67_80398_c1
1012 nmdc:mga06r32_58462_c1
1013 nmdc:mga06r32_8746_c1
1014 nmdc:mga08y16_127018_c1
1015 nmdc:mga08y16_139523_c1
1016 nmdc:mga08y16_17240_c1
1017 nmdc:mga08y16_192358_c1
1018 nmdc:mga08y16_31583_c1
1019 nmdc:mga08y16_33396_c1
1020 nmdc:mga08y16_9171_c1
1021 nmdc:mga0n895_934_c1
1022 nmdc:mga0rr50_120452_c1
1023 nmdc:mga0rr50_3727_c1
1024 nmdc:mga0rr50_75814_c1
1025 nmdc:mga0rr50_84864_c1
1026 nmdc:mga08x19_130233_c1
1027 nmdc:mga08x19_13513_c1
1028 nmdc:mga08x19_1453_c1
1029 nmdc:mga08x19_3837_c1
1030 nmdc:mga08x19_465_c1
1031 nmdc:mga08x19_66536_c1
1032 nmdc:mga0a205_19994_c1
1033 nmdc:mga0a205_215054_c1
1034 nmdc:mga0a205_3757_c1
1035 Ga0501084_0060997
1036 Ga0501084_0092145
1037 Ga0501084_0116696
1038 Ga0501082_0002425
1039 Ga0530510_0005770
1040 Ga0530510_0009316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01551

Peptidase_M23

Peptidase family M23

352

447

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qpb-assembly1.cif.gz_A catalytic domain of the antimicrobial peptidase lysostaphin from staphylococcus simulans crystallized in the absence of phosphate 0.9062 326 424
4zyb-assembly3.cif.gz_C high resolution structure of m23 peptidase lytm with substrate analogue 0.861 324 424
5nmy-assembly1.cif.gz_A nmr solution structure of lysostaphin 0.8491 325 424
5j1m-assembly1.cif.gz_A crystal structure of csd1-csd2 dimer ii 0.8353 327 435
5j1l-assembly1.cif.gz_A crystal structure of csd1-csd2 dimer i 0.8342 327 434
ID Description Score Start End Superfamily
4qpbA00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9062 326 424 2.70.70.10
2hsiA02 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8674 270 424 2.70.70.10
af_Q2FW53_122_280_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8667 336 411 2.70.70.10
4zybC00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8609 324 424 2.70.70.10
3sluA03 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.84 297 426 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A538HIL5-F1-model_v4 M23 family metallopeptidase 0.96 329 423 GO:0004222
AF-A0A3D5MPQ8-F1-model_v4 Peptidase M23 0.9592 325 421 GO:0004222
AF-A0A645FZF1-F1-model_v4 Murein DD-endopeptidase MepM (EC 3.4.24.-) 0.9466 329 422 GO:0004222
AF-A0A1V2ZHL6-F1-model_v4 Peptidase M23 domain-containing protein 0.9463 327 423 GO:0004222
AF-I2PZN5-F1-model_v4 Membrane-bound metallopeptidase 0.9442 329 423 GO:0004222

Map