F458546

General Info

Members Datasets Scaffolds Average Seq Length
520 382 1040 456

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10145427|Ga0207691_101454272
Length 550
Sequence MLYGYRRQAKRLLVITRDISGMAVIASEAIGAEIPQRYPRRAAVISWIFFDWAAQPYFTLITTFVFAPYFASFVAPNPATGQALWGFATAAAGLTIALLSPVLGAIADASGRRKPWIAGFGALLVIGSSLMWIGKPGDPSIIPPLLLAYAIASVGVEFATVFNNAMMPTLVPPDKIGRLSGTGWATGYIGGIFSLILVLGFLAANPETGRTLFGFAPLFGLDPVTHQGDRITGPLTGIWFIIFALPMFLLTPDYPAKHPVRAALREGLTELKQTLGELPKQKSMATFLLANMIYTDGLVSLFAFGGIYAAGTFGWHTIQFIEQHERRGDAGRRDRGVGXXXVLALHLERADVDDAGEFADAVEEQREVVIRPFELQRDRPLGVQLFGDRRRRLEALDGHVRLRGHRLHAVQQVGGVLLFGQDRLEVGKAPFEVGHLRAELRQFLRRAQALVDVVAQRHELRLPRDHVGLHRHLVVVVENSAASDRQADKGPDLGVPRQLGERQFHVRFAIRAYRDDARRPLNTVDIGVSSPLSLREPPALPFRRAPETRP

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
109 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
110 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
130 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
269 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
270 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
271 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
276 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
277 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
278 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
279 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
280 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
281 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
282 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
283 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
284 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
285 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
286 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
287 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
288 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
289 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
290 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
291 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
292 2791355199
293 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
294 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
295 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
296 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
297 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
298 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
299 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
300 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
301 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
302 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
303 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
304 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
305 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
306 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
307 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
308 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
309 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
310 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
311 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
312 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
313 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
314 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
315 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
316 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
317 2904699407
318 2906610324
319 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
320 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
321 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
322 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
323 2922368715
324 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
325 2922425934
326 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
327 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
328 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
329 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
330 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
331 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
332 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
333 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
334 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
335 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
336 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
337 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
338 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
339 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
340 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
341 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
342 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
343 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
344 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
345 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
346 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
347 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
348 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
349 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
350 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
351 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
352 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
353 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
354 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
355 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
356 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
357 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
358 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
359 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
360 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
361 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
362 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
363 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
364 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
365 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
366 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
367 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
368 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
369 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
370 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
371 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
372 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
373 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
374 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
375 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
376 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
377 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
378 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
379 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
380 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
381 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
382 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 0
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.5
Nodule 16.92
Rhizoplane 6.92
Rhizosphere 60.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10145427 3300025940 Bacteria 2087
2 JGI24740J21852_10000570 3300001979 Bacteria 15869
3 JGI24739J22299_10030723 3300001989 Bacteria 1861
4 JGI25406J46586_10000463 3300003203 Bacteria 18957
5 JGI25160J50197_1001638 3300003354 Bacteria 10988
6 JGI25160J50197_1002980 3300003354 Bacteria 7727
7 JGI25160J50197_1011101 3300003354 Bacteria 3213
8 Ga0055543_1004294 3300004625 Bacteria 3921
9 Ga0065165_1002933 3300005262 Bacteria 13012
10 Ga0065165_1022823 3300005262 Bacteria 2135
11 Ga0070676_10071214 3300005328 Bacteria 2088
12 Ga0070682_100111510 3300005337 Bacteria 1824
13 Ga0070668_100047884 3300005347 Bacteria 3287
14 Ga0070669_100141110 3300005353 Bacteria 1858
15 Ga0070659_100094014 3300005366 Bacteria 2407
16 Ga0070709_10113366 3300005434 Bacteria 1826
17 Ga0070714_100014255 3300005435 Bacteria 6383
18 Ga0070714_100065114 3300005435 Bacteria 3138
19 Ga0070714_100073645 3300005435 Bacteria 2959
20 Ga0070713_100002398 3300005436 Bacteria 12220
21 Ga0070713_100226423 3300005436 Bacteria 1698
22 Ga0070710_10000880 3300005437 Bacteria 14380
23 Ga0070711_100007845 3300005439 Bacteria 6506
24 Ga0070711_100011167 3300005439 Bacteria 5570
25 Ga0070711_100110667 3300005439 Bacteria 2016
26 Ga0070700_100029325 3300005441 Bacteria 3279
27 Ga0070663_100023849 3300005455 Bacteria 4107
28 Ga0070663_100035190 3300005455 Bacteria 3473
29 Ga0070663_100061577 3300005455 Bacteria 2703
30 Ga0070663_100071998 3300005455 Bacteria 2517
31 Ga0070678_100186806 3300005456 Bacteria 1701
32 Ga0070662_100041752 3300005457 Bacteria 3274
33 Ga0068853_100021754 3300005539 Bacteria 5350
34 Ga0068853_100028465 3300005539 Bacteria 4700
35 Ga0068853_100105212 3300005539 Bacteria 2500
36 Ga0070665_100039229 3300005548 Bacteria 4763
37 Ga0070665_100109966 3300005548 Bacteria 2758
38 Ga0070665_100171531 3300005548 Bacteria 2170
39 Ga0070704_100105694 3300005549 Bacteria 2132
40 Ga0068855_100009982 3300005563 Bacteria 11442
41 Ga0068855_100101281 3300005563 Bacteria 3316
42 Ga0070664_100070956 3300005564 Bacteria 2984
43 Ga0068857_100008515 3300005577 Bacteria 8868
44 Ga0068854_100003786 3300005578 Bacteria 9459
45 Ga0068854_100139813 3300005578 Bacteria 1857
46 Ga0068854_100161047 3300005578 Bacteria 1738
47 Ga0068856_100002838 3300005614 Bacteria 17741
48 Ga0068856_100026353 3300005614 Bacteria 5669
49 Ga0068856_100038677 3300005614 Bacteria 4683
50 Ga0068856_100134990 3300005614 Bacteria 2473
51 Ga0070702_100145263 3300005615 Bacteria 1516
52 Ga0068859_100087949 3300005617 Bacteria 3155
53 Ga0068861_100011567 3300005719 Bacteria 6141
54 Ga0068861_100095412 3300005719 Bacteria 2355
55 Ga0068851_10000402 3300005834 Bacteria 19592
56 Ga0068858_100059862 3300005842 Bacteria 3520
57 Ga0068858_100189859 3300005842 Bacteria 1941
58 Ga0068860_100000433 3300005843 Bacteria 53218
59 Ga0068860_100125812 3300005843 Bacteria 2457
60 Ga0068862_100075845 3300005844 Bacteria 2909
61 Ga0068862_100161814 3300005844 Bacteria 1998
62 Ga0081455_10005195 3300005937 Bacteria 14318
63 Ga0081455_10160677 3300005937 Bacteria 1722
64 Ga0081540_1002478 3300005983 Bacteria 15036
65 Ga0081540_1005988 3300005983 Bacteria 8956
66 Ga0081540_1014897 3300005983 Bacteria 4946
67 Ga0081539_10003530 3300005985 Bacteria 19031
68 Ga0070717_10005195 3300006028 Bacteria 9483
69 Ga0070717_10072932 3300006028 Bacteria 2868
70 Ga0075365_10026794 3300006038 Bacteria 3663
71 Ga0075368_10035512 3300006042 Bacteria 1945
72 Ga0075363_100003251 3300006048 Bacteria 6874
73 Ga0070712_100003780 3300006175 Bacteria 9321
74 Ga0075367_10016644 3300006178 Bacteria 4018
75 Ga0068871_100142224 3300006358 Bacteria 2041
76 Ga0075428_100053195 3300006844 Bacteria 4436
77 Ga0075434_100332896 3300006871 Bacteria 1539
78 Ga0075436_100060692 3300006914 Bacteria 2612
79 Ga0097620_100087951 3300006931 Bacteria 3155
80 Ga0099794_10011134 3300007265 Bacteria 3844
81 Ga0105240_10004430 3300009093 Bacteria 21410
82 Ga0105240_10037459 3300009093 Bacteria 6233
83 Ga0105240_10130297 3300009093 Bacteria 3018
84 Ga0111539_10043992 3300009094 Bacteria 5352
85 Ga0105245_10192146 3300009098 Bacteria 1956
86 Ga0105247_10101419 3300009101 Bacteria 1840
87 Ga0114129_10023896 3300009147 Bacteria 8662
88 Ga0105243_10167515 3300009148 Bacteria 1900
89 Ga0105241_10043573 3300009174 Bacteria 3399
90 Ga0105237_10045715 3300009545 Bacteria 4405
91 Ga0105237_10202540 3300009545 Bacteria 1985
92 Ga0105238_10007309 3300009551 Bacteria 11059
93 Ga0105238_10083597 3300009551 Bacteria 3181
94 Ga0105238_10087810 3300009551 Bacteria 3096
95 Ga0105239_10007523 3300010375 Bacteria 12489
96 Ga0105239_10047342 3300010375 Bacteria 4713
97 Ga0105239_10049388 3300010375 Bacteria 4614
98 Ga0105239_10080394 3300010375 Bacteria 3586
99 Ga0105239_10100673 3300010375 Bacteria 3196
100 Ga0105239_10221994 3300010375 Bacteria 2119
101 Ga0105246_10036214 3300011119 Bacteria 3304
102 Ga0157374_10078526 3300013296 Bacteria 3126
103 Ga0157378_10075530 3300013297 Bacteria 3034
104 Ga0157378_10194580 3300013297 Bacteria 1915
105 Ga0163162_10102070 3300013306 Bacteria 2961
106 Ga0163162_10314283 3300013306 Bacteria 1699
107 Ga0157372_10080044 3300013307 Bacteria 3696
108 Ga0157380_10101275 3300014326 Bacteria 2400
109 Ga0157379_10093325 3300014968 Bacteria 2700
110 Ga0157376_10002020 3300014969 Bacteria 13604
111 Ga0209677_101634 3300025253 Bacteria 9449
112 Ga0209677_102008 3300025253 Bacteria 8092
113 Ga0209233_1002848 3300025261 Bacteria 6200
114 Ga0209233_1008434 3300025261 Bacteria 3193
115 Ga0209455_1004485 3300025272 Bacteria 4550
116 Ga0209758_1003514 3300025297 Bacteria 14143
117 Ga0209758_1004217 3300025297 Bacteria 12175
118 Ga0207426_1000420 3300025302 Bacteria 69895
119 Ga0207426_1020116 3300025302 Bacteria 2324
120 Ga0207692_10003479 3300025898 Bacteria 6154
121 Ga0207688_10045394 3300025901 Bacteria 2451
122 Ga0207647_10004518 3300025904 Bacteria 10306
123 Ga0207699_10013790 3300025906 Bacteria 4147
124 Ga0207645_10020873 3300025907 Bacteria 4279
125 Ga0207654_10000058 3300025911 Bacteria 75628
126 Ga0207695_10000453 3300025913 Bacteria 89314
127 Ga0207695_10030300 3300025913 Bacteria 5958
128 Ga0207671_10034794 3300025914 Bacteria 3742
129 Ga0207671_10041863 3300025914 Bacteria 3391
130 Ga0207693_10001606 3300025915 Bacteria 20003
131 Ga0207693_10003386 3300025915 Bacteria 13620
132 Ga0207693_10053413 3300025915 Bacteria 3170
133 Ga0207663_10000390 3300025916 Bacteria 19024
134 Ga0207663_10005653 3300025916 Bacteria 6319
135 Ga0207657_10169132 3300025919 Bacteria 1772
136 Ga0207694_10000564 3300025924 Bacteria 33580
137 Ga0207694_10079452 3300025924 Bacteria 2572
138 Ga0207664_10025264 3300025929 Bacteria 4472
139 Ga0207664_10056988 3300025929 Bacteria 3105
140 Ga0207706_10062207 3300025933 Bacteria 3287
141 Ga0207709_10019916 3300025935 Bacteria 3779
142 Ga0207665_10000444 3300025939 Bacteria 28370
143 Ga0207691_10033936 3300025940 Bacteria 4750
144 Ga0207691_10139354 3300025940 Bacteria 2138
145 Ga0207689_10035377 3300025942 Bacteria 4150
146 Ga0207689_10111356 3300025942 Bacteria 2250
147 Ga0207679_10062491 3300025945 Bacteria 2775
148 Ga0207667_10009339 3300025949 Bacteria 11566
149 Ga0207667_10144053 3300025949 Bacteria 2453
150 Ga0207668_10088648 3300025972 Bacteria 2266
151 Ga0207640_10035826 3300025981 Bacteria 3109
152 Ga0207658_10085560 3300025986 Bacteria 2429
153 Ga0207677_10020870 3300026023 Bacteria 3991
154 Ga0207703_10123765 3300026035 Bacteria 2223
155 Ga0207639_10001424 3300026041 Bacteria 16178
156 Ga0207639_10064311 3300026041 Bacteria 2844
157 Ga0207678_10015000 3300026067 Bacteria 6817
158 Ga0207678_10027531 3300026067 Bacteria 4960
159 Ga0207678_10043553 3300026067 Bacteria 3884
160 Ga0207678_10053426 3300026067 Bacteria 3481
161 Ga0207678_10131745 3300026067 Bacteria 2133
162 Ga0207708_10120651 3300026075 Bacteria 2042
163 Ga0207702_10000004 3300026078 Bacteria 422182
164 Ga0207702_10028205 3300026078 Bacteria 4665
165 Ga0207702_10067275 3300026078 Bacteria 3074
166 Ga0207648_10036345 3300026089 Bacteria 4339
167 Ga0207676_10157760 3300026095 Bacteria 1962
168 Ga0207674_10005590 3300026116 Bacteria 14903
169 Ga0207683_10145147 3300026121 Bacteria 2140
170 Ga0207698_10062289 3300026142 Bacteria 2912
171 Ga0207698_10070609 3300026142 Bacteria 2768
172 Ga0207698_10164287 3300026142 Bacteria 1946
173 Ga0207698_10186115 3300026142 Bacteria 1845
174 Ga0209589_1000021 3300027357 Bacteria 186431
175 Ga0209489_100028 3300027361 Bacteria 186431
176 Ga0209700_100037 3300027363 Bacteria 186431
177 Ga0207428_10054066 3300027907 Bacteria 3199
178 Ga0268266_10000680 3300028379 Bacteria 45937
179 Ga0268266_10012906 3300028379 Bacteria 7208
180 Ga0268266_10057719 3300028379 Bacteria 3341
181 Ga0268264_10000062 3300028381 Bacteria 302110
182 Ga0265318_10007399 3300028577 Bacteria 4968
183 Ga0265323_10008033 3300028653 Bacteria 4363
184 Ga0265336_10011786 3300028666 Bacteria 2959
185 Ga0307517_10000942 3300028786 Bacteria 49547
186 Ga0307515_10068562 3300028794 Bacteria 4870
187 Ga0265338_10009376 3300028800 Bacteria 11688
188 Ga0265324_10015196 3300029957 Bacteria 2834
189 Ga0265330_10013047 3300031235 Bacteria 3877
190 Ga0265332_10011856 3300031238 Bacteria 3872
191 Ga0265340_10002209 3300031247 Bacteria 11138
192 Ga0307508_10000108 3300031616 Bacteria 97443
193 Ga0265314_10002048 3300031711 Bacteria 21322
194 Ga0265314_10038049 3300031711 Bacteria 3480
195 Ga0265342_10015551 3300031712 Bacteria 5002
196 Ga0307516_10061413 3300031730 Bacteria 3646
197 Ga0307510_10003483 3300033180 Bacteria 18332
198 Ga0315911_1000008 3300033442 Bacteria 381285
199 Ga0316214_1003581 3300033545 Bacteria 1965
200 Ga0373936_0012325 3300035113 Bacteria 3251
201 Ga0373945_0013871 3300035116 Bacteria 2695
202 Ga0373954_0000242 3300035118 Bacteria 20003
203 Ga0373954_0013828 3300035118 Bacteria 3597
204 Ga0373957_0000417 3300035120 Bacteria 10760
205 Ga0373943_0002237 3300035170 Bacteria 8797
206 Ga0373946_0018418 3300035171 Bacteria 2682
207 Ga0373955_0001044 3300035172 Bacteria 11768
208 Ga0373935_0000500 3300035692 Bacteria 20245
209 Ga0373927_0000337 3300035695 Bacteria 36861
210 Ga0373927_0047665 3300035695 Bacteria 2772
211 Ga0373933_0007539 3300035724 Bacteria 5945
212 Ga0373947_0002043 3300035725 Bacteria 12316
213 Ga0373947_0028453 3300035725 Bacteria 3277
214 Ga0373937_0067455 3300036401 Bacteria 3296
215 Ga0373925_0003157 3300037068 Bacteria 12909
216 Ga0373925_0076785 3300037068 Bacteria 2534
217 Ga0395898_0010389 3300037466 Bacteria 9734
218 Ga0436365_1721875 3300039437 Bacteria 3982
219 Ga0436360_0974944 3300039438 Bacteria 2922
220 Ga0436361_0053567 3300039447 Bacteria 1845
221 Ga0466969_0006896 3300044656 Bacteria 6046
222 Ga0466966_0000359 3300044684 Bacteria 29538
223 Ga0466961_0000074 3300044693 Bacteria 61968
224 Ga0466959_0008397 3300045049 Bacteria 7300
225 Ga0466967_0069108 3300045976 Bacteria 3156
226 Ga0495603_0002436 3300046455 Bacteria 10943
227 Ga0495603_0011272 3300046455 Bacteria 5417
228 Ga0495629_0000727 3300046459 Bacteria 26728
229 Ga0495638_0089919 3300046460 Bacteria 1851
230 Ga0495641_0007117 3300046461 Bacteria 7073
231 Ga0495651_0032462 3300046462 Bacteria 4072
232 Ga0495651_0035673 3300046462 Bacteria 3872
233 Ga0495653_0000465 3300046463 Bacteria 31535
234 Ga0495580_0002297 3300046472 Bacteria 16691
235 Ga0495582_0000494 3300046473 Bacteria 21572
236 Ga0495605_0050823 3300046474 Bacteria 2021
237 Ga0495639_0000119 3300046475 Bacteria 39930
238 Ga0495662_0001142 3300046476 Bacteria 13095
239 Ga0495664_0030058 3300046477 Bacteria 3181
240 Ga0495594_0008592 3300046499 Bacteria 5264
241 Ga0495594_0058680 3300046499 Bacteria 2127
242 Ga0495606_0076918 3300046507 Bacteria 2085
243 Ga0495608_0001489 3300046511 Bacteria 16666
244 Ga0495608_0098998 3300046511 Bacteria 1881
245 Ga0495608_0123468 3300046511 Bacteria 1659
246 Ga0495628_0136539 3300046516 Bacteria 1874
247 Ga0495630_0003675 3300046517 Bacteria 10698
248 Ga0495648_0099499 3300046524 Bacteria 1608
249 Ga0495663_0008257 3300046525 Bacteria 2883
250 Ga0495666_0006549 3300046526 Bacteria 5859
251 Ga0495666_0046855 3300046526 Bacteria 2083
252 Ga0495652_0022017 3300046529 Bacteria 5662
253 Ga0495665_0000251 3300046531 Bacteria 26959
254 Ga0495640_0002679 3300046533 Bacteria 14309
255 Ga0495587_0004444 3300046536 Bacteria 9241
256 Ga0495587_0008499 3300046536 Bacteria 6599
257 Ga0495645_0017210 3300046543 Bacteria 5177
258 Ga0495622_0004931 3300046557 Bacteria 6179
259 Ga0495667_0001146 3300046559 Bacteria 17281
260 Ga0495667_0013097 3300046559 Bacteria 5617
261 Ga0495656_0021325 3300046615 Bacteria 2521
262 Ga0495656_0044683 3300046615 Bacteria 1867
263 Ga0495634_0000886 3300046642 Bacteria 28754
264 Ga0495634_0004544 3300046642 Bacteria 10857
265 Ga0495634_0018287 3300046642 Bacteria 4991
266 Ga0495635_0001208 3300046663 Bacteria 17261
267 Ga0495635_0005740 3300046663 Bacteria 8646
268 Ga0495635_0010109 3300046663 Bacteria 6599
269 Ga0495659_0013259 3300046664 Bacteria 2682
270 Ga0495588_0041941 3300046674 Bacteria 2338
271 Ga0495657_0001030 3300046675 Bacteria 24459
272 Ga0495657_0001337 3300046675 Bacteria 21445
273 Ga0495657_0040622 3300046675 Bacteria 3189
274 Ga0495599_0000873 3300046678 Bacteria 16867
275 Ga0495599_0017403 3300046678 Bacteria 4469
276 Ga0495623_0004412 3300046679 Bacteria 9246
277 Ga0495646_0001852 3300046680 Bacteria 12711
278 Ga0495646_0023800 3300046680 Bacteria 3856
279 Ga0495647_0000085 3300046681 Bacteria 22908
280 Ga0495658_0000135 3300046683 Bacteria 40991
281 Ga0495669_0000707 3300046684 Bacteria 14557
282 Ga0495613_0001617 3300046689 Bacteria 17148
283 Ga0495624_0000144 3300046690 Bacteria 51509
284 Ga0495624_0016618 3300046690 Bacteria 4952
285 Ga0495649_0013892 3300046694 Bacteria 4631
286 Ga0495600_0000768 3300046809 Bacteria 16897
287 Ga0495600_0002466 3300046809 Bacteria 10617
288 Ga0495581_0000421 3300047315 Bacteria 21445
289 Ga0495604_0003032 3300047317 Bacteria 13430
290 Ga0495604_0009371 3300047317 Bacteria 7744
291 Ga0495604_0130453 3300047317 Bacteria 1807
292 Ga0495674_0001274 3300047319 Bacteria 24483
293 Ga0495674_0026496 3300047319 Bacteria 5304
294 Ga0495676_0006058 3300047321 Bacteria 11115
295 Ga0495676_0007487 3300047321 Bacteria 10015
296 Ga0495680_0000791 3300047322 Bacteria 35389
297 Ga0495683_0043674 3300047323 Bacteria 2256
298 Ga0495675_0003063 3300047444 Bacteria 10046
299 Ga0495675_0003289 3300047444 Bacteria 9716
300 Ga0495684_0000169 3300047471 Bacteria 49164
301 Ga0495593_0000007 3300047673 Bacteria 87657
302 Ga0495602_0051410 3300048088 Bacteria 3670
303 Ga0496100_0027040 3300048903 Bacteria 3523
304 Ga0496101_0016754 3300048904 Bacteria 4960
305 Ga0496101_0154224 3300048904 Bacteria 1758
306 Ga0496102_0003496 3300048905 Bacteria 13323
307 Ga0496102_0009172 3300048905 Bacteria 8488
308 Ga0496104_0070977 3300048907 Bacteria 3311
309 Ga0496105_0033599 3300048908 Bacteria 4214
310 Ga0496106_0020145 3300048909 Bacteria 4948
311 Ga0496106_0021442 3300048909 Bacteria 4797
312 Ga0496107_0005303 3300048910 Bacteria 8810
313 Ga0496107_0036264 3300048910 Bacteria 3537
314 Ga0496107_0064227 3300048910 Bacteria 2661
315 Ga0496108_0007489 3300048911 Bacteria 8847
316 Ga0496108_0013286 3300048911 Bacteria 6713
317 Ga0496109_0003252 3300048912 Bacteria 13541
318 Ga0496109_0035144 3300048912 Bacteria 4519
319 Ga0496109_0051350 3300048912 Bacteria 3756
320 Ga0496110_0012904 3300048913 Bacteria 6888
321 Ga0496110_0016515 3300048913 Bacteria 6164
322 Ga0496110_0050682 3300048913 Bacteria 3646
323 Ga0496111_0024507 3300048914 Bacteria 4250
324 Ga0496112_0000035 3300048915 Bacteria 106983
325 Ga0496112_0003481 3300048915 Bacteria 13031
326 Ga0496112_0142116 3300048915 Bacteria 2369
327 Ga0496113_0048497 3300048916 Bacteria 3160
328 Ga0496113_0061661 3300048916 Bacteria 2830
329 Ga0496113_0083612 3300048916 Bacteria 2449
330 Ga0496113_0114707 3300048916 Bacteria 2101
331 Ga0496114_0031719 3300048917 Bacteria 4347
332 Ga0496115_0002653 3300048918 Bacteria 12842
333 Ga0496115_0012788 3300048918 Bacteria 6328
334 Ga0496115_0014031 3300048918 Bacteria 6065
335 Ga0496115_0031184 3300048918 Bacteria 4198
336 Ga0496115_0065946 3300048918 Bacteria 2925
337 Ga0496115_0141090 3300048918 Bacteria 1988
338 Ga0496117_0010324 3300048920 Bacteria 8535
339 Ga0496117_0062325 3300048920 Bacteria 2556
340 Ga0496118_0010548 3300048921 Bacteria 9136
341 Ga0496118_0020937 3300048921 Bacteria 5782
342 Ga0496121_0000203 3300048924 Bacteria 130984
343 Ga0496121_0000893 3300048924 Bacteria 53847
344 Ga0496121_0082204 3300048924 Bacteria 2547
345 Ga0496124_0022134 3300048927 Bacteria 5834
346 Ga0496125_0050627 3300048928 Bacteria 3437
347 Ga0496126_0017429 3300048929 Bacteria 7156
348 Ga0496126_0022033 3300048929 Bacteria 6208
349 Ga0496126_0027307 3300048929 Bacteria 5454
350 Ga0496126_0060915 3300048929 Bacteria 3392
351 Ga0496126_0073482 3300048929 Bacteria 3040
352 Ga0495682_0008725 3300049460 Bacteria 3989
353 Ga0501032_0000303 3300049569 Bacteria 41504
354 Ga0501033_0000881 3300049570 Bacteria 27428
355 Ga0501034_0000250 3300049571 Bacteria 99407
356 Ga0501036_0000047 3300049572 Bacteria 75675
357 Ga0501036_0172453 3300049572 Bacteria 1822
358 Ga0501037_0000092 3300049573 Bacteria 83924
359 Ga0501037_0053739 3300049573 Bacteria 2946
360 Ga0501037_0078631 3300049573 Bacteria 2393
361 Ga0501038_0004865 3300049574 Bacteria 12475
362 Ga0501039_0000085 3300049575 Bacteria 70306
363 Ga0501042_0016184 3300049578 Bacteria 5116
364 Ga0501043_0005729 3300049579 Bacteria 10008
365 Ga0501043_0020072 3300049579 Bacteria 5244
366 Ga0501046_0000624 3300049580 Bacteria 34712
367 Ga0501047_0000022 3300049581 Bacteria 249062
368 Ga0501048_0007360 3300049582 Bacteria 8340
369 Ga0501067_0002068 3300049583 Bacteria 11051
370 Ga0501068_0001544 3300049584 Bacteria 12237
371 Ga0501069_0000513 3300049585 Bacteria 17707
372 Ga0501071_0030454 3300049587 Bacteria 3817
373 Ga0501072_0002213 3300049588 Bacteria 14529
374 Ga0501073_0000109 3300049589 Bacteria 53094
375 Ga0501074_0000250 3300049590 Bacteria 30239
376 Ga0501076_0044203 3300049592 Bacteria 3513
377 Ga0501079_0005328 3300049741 Bacteria 9573
378 Ga0501079_0122200 3300049741 Bacteria 2025
379 Ga0501083_0001496 3300049744 Bacteria 15948
380 Ga0501035_0006867 3300049822 Bacteria 10631
381 Ga0501035_0191630 3300049822 Bacteria 1757
382 Ga0501044_0000072 3300049823 Bacteria 124143
383 Ga0501044_0016861 3300049823 Bacteria 7837
384 Ga0501044_0196885 3300049823 Bacteria 1974
385 nmdc:mga03n38_100_c1 3300050490 Bacteria 19063
386 nmdc:mga0yw44_15340_c1 3300050492 Bacteria 4100
387 nmdc:mga0k408_67651_c1 3300050493 Bacteria 2082
388 nmdc:mga07m45_45723_c1 3300050496 Bacteria 2458
389 nmdc:mga05p37_82927_c1 3300050507 Bacteria 3950
390 nmdc:mga0sz30_14357_c1 3300050516 Bacteria 3116
391 nmdc:mga0sz30_49283_c1 3300050516 Bacteria 1784
392 Ga0495601_0011752 3300053077 Bacteria 5249
393 Ga0495595_0000668 3300053084 Bacteria 13098
394 Ga0495595_0018362 3300053084 Bacteria 3022
395 Ga0495619_0000719 3300053085 Bacteria 21645
396 Ga0495619_0081978 3300053085 Bacteria 2173
397 Ga0500566_0000150 3300053094 Bacteria 35703
398 Ga0500641_0007715 3300053096 Bacteria 3835
399 Ga0500572_000234 3300053111 Bacteria 19736
400 Ga0500595_000258 3300053119 Bacteria 35116
401 Ga0500595_002380 3300053119 Bacteria 9400
402 Ga0500642_0046354 3300053130 Bacteria 1901
403 Ga0500559_0000244 3300053136 Bacteria 42994
404 Ga0500568_0012485 3300053139 Bacteria 3905
405 Ga0500639_057596 3300053163 Bacteria 2009
406 Ga0500637_0000147 3300053178 Bacteria 25930
407 Ga0500637_0023478 3300053178 Bacteria 3373
408 Ga0500576_055274 3300053725 Bacteria 1750
409 Ga0500645_016945 3300053730 Bacteria 2289
410 Ga0501084_0006091 3300054114 Bacteria 9917
411 Ga0500661_000057 3300055283 Bacteria 17586
412 Ga0501082_0002413 3300060353 Bacteria 16404
413 2513644635 2513237094 Bacteria 8789602
414 2513658870 2513237096 Bacteria 8722461
415 2513695150 2513237101 Bacteria 7952346
416 2513860876 2513237137 Bacteria 9558895
417 2513873486 2513237139 Bacteria 8737671
418 2513888815 2513237141 Bacteria 8496279
419 2513921134 2513237145 Bacteria 8979722
420 2514012529 2513237161 Bacteria 8871253
421 2517107154 2517093001 Bacteria 9002274
422 2517888898 2517572143 Bacteria 9484767
423 2528854061 2528768022 Bacteria 10457665
424 2617352441 2617270735 Bacteria 9163226
425 2671122504 2667528175 Bacteria 7532676
426 2723841680 2721755755 Bacteria 8322773
427 2728755044 2728368998 Bacteria 8720350
428 2745081736 2744054633 Bacteria 8678936
429 2793072988 2791355197 Bacteria 8420563
430 2793083617
431 2805915570 2802429603 Bacteria 8777136
432 2824670263 2824661429 Bacteria 9877870
433 2824691105 2824687955 Bacteria 8360029
434 2824703942 2824696289 Bacteria 8335049
435 2824781221 2824773399 Bacteria 8360218
436 2838124559 2838122688 Bacteria 8803140
437 2841945246 2841941048 Bacteria 8688029
438 2841952027 2841949485 Bacteria 8680857
439 2841965576 2841957949 Bacteria 8652217
440 2841970579 2841966195 Bacteria 8673214
441 2841981828 2841974524 Bacteria 8931498
442 2841985106 2841983080 Bacteria 8395090
443 2847942198 2847939898 Bacteria 8606328
444 2849083078 2849076700 Bacteria 7039503
445 2874608025 2874604998 Bacteria 7834745
446 2876770948 2876761206 Bacteria 10111113
447 2876809852 2876808645 Bacteria 8824342
448 2879112215 2879110137 Bacteria 8907982
449 2881365275 2881364244 Bacteria 7710352
450 2885377502 2885374607 Bacteria 8927485
451 2885411617 2885409591 Bacteria 9235467
452 2888390635 2888388044 Bacteria 7304136
453 2889035446 2889033259 Bacteria 9099371
454 2903752082 2903748898 Bacteria 9972761
455 2904708624
456 2906613926
457 2906628487 2906626472 Bacteria 8826946
458 2906642274 2906635258 Bacteria 8601019
459 2906667302 2906660503 Bacteria 8595048
460 2908747501 2908739725 Bacteria 8628932
461 2922369529
462 2922392604 2922386360 Bacteria 7017218
463 2922434166
464 2929618649 2929615660 Bacteria 9193770
465 2929628666 2929624759 Bacteria 9339455
466 2932790828 2932784394 Bacteria 9704911
467 2932794267 2932794094 Bacteria 7915132
468 2932808139 2932801729 Bacteria 7987968
469 2932823109 2932818245 Bacteria 9955613
470 2932833515 2932828146 Bacteria 9745859
471 2933580639 2933577622 Bacteria 9116884
472 2935623071 2935616580 Bacteria 9032984
473 2935637083 2935630451 Bacteria 8169952
474 2935644146 2935638405 Bacteria 10015038
475 2935672272 2935665750 Bacteria 9571747
476 2935679203 2935675223 Bacteria 9928132
477 2935686449 2935684952 Bacteria 9590419
478 2935700229 2935694250 Bacteria 9291695
479 2935710178 2935703347 Bacteria 10242284
480 2935716137 2935713505 Bacteria 9608509
481 2935723739 2935722832 Bacteria 9608746
482 2935735294 2935732158 Bacteria 9706831
483 2935743915 2935741537 Bacteria 9707219
484 2935752415 2935750917 Bacteria 9590372
485 2935808170 2935801545 Bacteria 9301974
486 2935816217 2935810662 Bacteria 9401221
487 2935833610 2935827899 Bacteria 10038562
488 2935844563 2935837841 Bacteria 9454360
489 2935861319 2935855204 Bacteria 9035059
490 2935869438 2935864058 Bacteria 9784707
491 2935879767 2935873716 Bacteria 9632195
492 2935890044 2935883170 Bacteria 7964738
493 2935962685 2935959822 Bacteria 7869783
494 2935998010 2935992306 Bacteria 9802711
495 2936008724 2936002035 Bacteria 9362176
496 2936041222 2936037263 Bacteria 9446081
497 2940558328 2940556831 Bacteria 9590747
498 2941513650 2941507105 Bacteria 8166816
499 2941521613 2941515067 Bacteria 8166720
500 2941529438 2941523033 Bacteria 8169134
501 2941535466 2941531003 Bacteria 7653939
502 2941543252 2941538514 Bacteria 9402094
503 3005475124 3005474847 Bacteria 9259049
504 3005595100 3005594810 Bacteria 8716512
505 3005711043 3005710791 Bacteria 7622528
506 3005718351 3005718088 Bacteria 8283608
507 8006933249 8006926726 Bacteria 6749210
508 8006936167 8006933436 Bacteria 10410654
509 8006967497 8006964411 Bacteria 8966052
510 8006976113 8006973647 Bacteria 10679141
511 8006996470 8006994254 Bacteria 8309700
512 8016518136 8016511872 Bacteria 9921665
513 8016586318 8016583857 Bacteria 10421953
514 8017058510 8017057580 Bacteria 10023680
515 8019562492 8019555841 Bacteria 9642137
516 8019572566 8019565922 Bacteria 9639779
517 8019577183 8019576017 Bacteria 10049540
518 8019606492 8019597564 Bacteria 10041141
519 8055742499 8055742211 Bacteria 9226248
520 8056675776 8056673599 Bacteria 7871253
521 Ga0207691_10145427
522 JGI24740J21852_10000570
523 JGI24739J22299_10030723
524 JGI25406J46586_10000463
525 JGI25160J50197_1001638
526 JGI25160J50197_1002980
527 JGI25160J50197_1011101
528 Ga0055543_1004294
529 Ga0065165_1002933
530 Ga0065165_1022823
531 Ga0070676_10071214
532 Ga0070682_100111510
533 Ga0070668_100047884
534 Ga0070669_100141110
535 Ga0070659_100094014
536 Ga0070709_10113366
537 Ga0070714_100014255
538 Ga0070714_100065114
539 Ga0070714_100073645
540 Ga0070713_100002398
541 Ga0070713_100226423
542 Ga0070710_10000880
543 Ga0070711_100007845
544 Ga0070711_100011167
545 Ga0070711_100110667
546 Ga0070700_100029325
547 Ga0070663_100023849
548 Ga0070663_100035190
549 Ga0070663_100061577
550 Ga0070663_100071998
551 Ga0070678_100186806
552 Ga0070662_100041752
553 Ga0068853_100021754
554 Ga0068853_100028465
555 Ga0068853_100105212
556 Ga0070665_100039229
557 Ga0070665_100109966
558 Ga0070665_100171531
559 Ga0070704_100105694
560 Ga0068855_100009982
561 Ga0068855_100101281
562 Ga0070664_100070956
563 Ga0068857_100008515
564 Ga0068854_100003786
565 Ga0068854_100139813
566 Ga0068854_100161047
567 Ga0068856_100002838
568 Ga0068856_100026353
569 Ga0068856_100038677
570 Ga0068856_100134990
571 Ga0070702_100145263
572 Ga0068859_100087949
573 Ga0068861_100011567
574 Ga0068861_100095412
575 Ga0068851_10000402
576 Ga0068858_100059862
577 Ga0068858_100189859
578 Ga0068860_100000433
579 Ga0068860_100125812
580 Ga0068862_100075845
581 Ga0068862_100161814
582 Ga0081455_10005195
583 Ga0081455_10160677
584 Ga0081540_1002478
585 Ga0081540_1005988
586 Ga0081540_1014897
587 Ga0081539_10003530
588 Ga0070717_10005195
589 Ga0070717_10072932
590 Ga0075365_10026794
591 Ga0075368_10035512
592 Ga0075363_100003251
593 Ga0070712_100003780
594 Ga0075367_10016644
595 Ga0068871_100142224
596 Ga0075428_100053195
597 Ga0075434_100332896
598 Ga0075436_100060692
599 Ga0097620_100087951
600 Ga0099794_10011134
601 Ga0105240_10004430
602 Ga0105240_10037459
603 Ga0105240_10130297
604 Ga0111539_10043992
605 Ga0105245_10192146
606 Ga0105247_10101419
607 Ga0114129_10023896
608 Ga0105243_10167515
609 Ga0105241_10043573
610 Ga0105237_10045715
611 Ga0105237_10202540
612 Ga0105238_10007309
613 Ga0105238_10083597
614 Ga0105238_10087810
615 Ga0105239_10007523
616 Ga0105239_10047342
617 Ga0105239_10049388
618 Ga0105239_10080394
619 Ga0105239_10100673
620 Ga0105239_10221994
621 Ga0105246_10036214
622 Ga0157374_10078526
623 Ga0157378_10075530
624 Ga0157378_10194580
625 Ga0163162_10102070
626 Ga0163162_10314283
627 Ga0157372_10080044
628 Ga0157380_10101275
629 Ga0157379_10093325
630 Ga0157376_10002020
631 Ga0209677_101634
632 Ga0209677_102008
633 Ga0209233_1002848
634 Ga0209233_1008434
635 Ga0209455_1004485
636 Ga0209758_1003514
637 Ga0209758_1004217
638 Ga0207426_1000420
639 Ga0207426_1020116
640 Ga0207692_10003479
641 Ga0207688_10045394
642 Ga0207647_10004518
643 Ga0207699_10013790
644 Ga0207645_10020873
645 Ga0207654_10000058
646 Ga0207695_10000453
647 Ga0207695_10030300
648 Ga0207671_10034794
649 Ga0207671_10041863
650 Ga0207693_10001606
651 Ga0207693_10003386
652 Ga0207693_10053413
653 Ga0207663_10000390
654 Ga0207663_10005653
655 Ga0207657_10169132
656 Ga0207694_10000564
657 Ga0207694_10079452
658 Ga0207664_10025264
659 Ga0207664_10056988
660 Ga0207706_10062207
661 Ga0207709_10019916
662 Ga0207665_10000444
663 Ga0207691_10033936
664 Ga0207691_10139354
665 Ga0207689_10035377
666 Ga0207689_10111356
667 Ga0207679_10062491
668 Ga0207667_10009339
669 Ga0207667_10144053
670 Ga0207668_10088648
671 Ga0207640_10035826
672 Ga0207658_10085560
673 Ga0207677_10020870
674 Ga0207703_10123765
675 Ga0207639_10001424
676 Ga0207639_10064311
677 Ga0207678_10015000
678 Ga0207678_10027531
679 Ga0207678_10043553
680 Ga0207678_10053426
681 Ga0207678_10131745
682 Ga0207708_10120651
683 Ga0207702_10000004
684 Ga0207702_10028205
685 Ga0207702_10067275
686 Ga0207648_10036345
687 Ga0207676_10157760
688 Ga0207674_10005590
689 Ga0207683_10145147
690 Ga0207698_10062289
691 Ga0207698_10070609
692 Ga0207698_10164287
693 Ga0207698_10186115
694 Ga0209589_1000021
695 Ga0209489_100028
696 Ga0209700_100037
697 Ga0207428_10054066
698 Ga0268266_10000680
699 Ga0268266_10012906
700 Ga0268266_10057719
701 Ga0268264_10000062
702 Ga0265318_10007399
703 Ga0265323_10008033
704 Ga0265336_10011786
705 Ga0307517_10000942
706 Ga0307515_10068562
707 Ga0265338_10009376
708 Ga0265324_10015196
709 Ga0265330_10013047
710 Ga0265332_10011856
711 Ga0265340_10002209
712 Ga0307508_10000108
713 Ga0265314_10002048
714 Ga0265314_10038049
715 Ga0265342_10015551
716 Ga0307516_10061413
717 Ga0307510_10003483
718 Ga0315911_1000008
719 Ga0316214_1003581
720 Ga0373936_0012325
721 Ga0373945_0013871
722 Ga0373954_0000242
723 Ga0373954_0013828
724 Ga0373957_0000417
725 Ga0373943_0002237
726 Ga0373946_0018418
727 Ga0373955_0001044
728 Ga0373935_0000500
729 Ga0373927_0000337
730 Ga0373927_0047665
731 Ga0373933_0007539
732 Ga0373947_0002043
733 Ga0373947_0028453
734 Ga0373937_0067455
735 Ga0373925_0003157
736 Ga0373925_0076785
737 Ga0395898_0010389
738 Ga0436365_1721875
739 Ga0436360_0974944
740 Ga0436361_0053567
741 Ga0466969_0006896
742 Ga0466966_0000359
743 Ga0466961_0000074
744 Ga0466959_0008397
745 Ga0466967_0069108
746 Ga0495603_0002436
747 Ga0495603_0011272
748 Ga0495629_0000727
749 Ga0495638_0089919
750 Ga0495641_0007117
751 Ga0495651_0032462
752 Ga0495651_0035673
753 Ga0495653_0000465
754 Ga0495580_0002297
755 Ga0495582_0000494
756 Ga0495605_0050823
757 Ga0495639_0000119
758 Ga0495662_0001142
759 Ga0495664_0030058
760 Ga0495594_0008592
761 Ga0495594_0058680
762 Ga0495606_0076918
763 Ga0495608_0001489
764 Ga0495608_0098998
765 Ga0495608_0123468
766 Ga0495628_0136539
767 Ga0495630_0003675
768 Ga0495648_0099499
769 Ga0495663_0008257
770 Ga0495666_0006549
771 Ga0495666_0046855
772 Ga0495652_0022017
773 Ga0495665_0000251
774 Ga0495640_0002679
775 Ga0495587_0004444
776 Ga0495587_0008499
777 Ga0495645_0017210
778 Ga0495622_0004931
779 Ga0495667_0001146
780 Ga0495667_0013097
781 Ga0495656_0021325
782 Ga0495656_0044683
783 Ga0495634_0000886
784 Ga0495634_0004544
785 Ga0495634_0018287
786 Ga0495635_0001208
787 Ga0495635_0005740
788 Ga0495635_0010109
789 Ga0495659_0013259
790 Ga0495588_0041941
791 Ga0495657_0001030
792 Ga0495657_0001337
793 Ga0495657_0040622
794 Ga0495599_0000873
795 Ga0495599_0017403
796 Ga0495623_0004412
797 Ga0495646_0001852
798 Ga0495646_0023800
799 Ga0495647_0000085
800 Ga0495658_0000135
801 Ga0495669_0000707
802 Ga0495613_0001617
803 Ga0495624_0000144
804 Ga0495624_0016618
805 Ga0495649_0013892
806 Ga0495600_0000768
807 Ga0495600_0002466
808 Ga0495581_0000421
809 Ga0495604_0003032
810 Ga0495604_0009371
811 Ga0495604_0130453
812 Ga0495674_0001274
813 Ga0495674_0026496
814 Ga0495676_0006058
815 Ga0495676_0007487
816 Ga0495680_0000791
817 Ga0495683_0043674
818 Ga0495675_0003063
819 Ga0495675_0003289
820 Ga0495684_0000169
821 Ga0495593_0000007
822 Ga0495602_0051410
823 Ga0496100_0027040
824 Ga0496101_0016754
825 Ga0496101_0154224
826 Ga0496102_0003496
827 Ga0496102_0009172
828 Ga0496104_0070977
829 Ga0496105_0033599
830 Ga0496106_0020145
831 Ga0496106_0021442
832 Ga0496107_0005303
833 Ga0496107_0036264
834 Ga0496107_0064227
835 Ga0496108_0007489
836 Ga0496108_0013286
837 Ga0496109_0003252
838 Ga0496109_0035144
839 Ga0496109_0051350
840 Ga0496110_0012904
841 Ga0496110_0016515
842 Ga0496110_0050682
843 Ga0496111_0024507
844 Ga0496112_0000035
845 Ga0496112_0003481
846 Ga0496112_0142116
847 Ga0496113_0048497
848 Ga0496113_0061661
849 Ga0496113_0083612
850 Ga0496113_0114707
851 Ga0496114_0031719
852 Ga0496115_0002653
853 Ga0496115_0012788
854 Ga0496115_0014031
855 Ga0496115_0031184
856 Ga0496115_0065946
857 Ga0496115_0141090
858 Ga0496117_0010324
859 Ga0496117_0062325
860 Ga0496118_0010548
861 Ga0496118_0020937
862 Ga0496121_0000203
863 Ga0496121_0000893
864 Ga0496121_0082204
865 Ga0496124_0022134
866 Ga0496125_0050627
867 Ga0496126_0017429
868 Ga0496126_0022033
869 Ga0496126_0027307
870 Ga0496126_0060915
871 Ga0496126_0073482
872 Ga0495682_0008725
873 Ga0501032_0000303
874 Ga0501033_0000881
875 Ga0501034_0000250
876 Ga0501036_0000047
877 Ga0501036_0172453
878 Ga0501037_0000092
879 Ga0501037_0053739
880 Ga0501037_0078631
881 Ga0501038_0004865
882 Ga0501039_0000085
883 Ga0501042_0016184
884 Ga0501043_0005729
885 Ga0501043_0020072
886 Ga0501046_0000624
887 Ga0501047_0000022
888 Ga0501048_0007360
889 Ga0501067_0002068
890 Ga0501068_0001544
891 Ga0501069_0000513
892 Ga0501071_0030454
893 Ga0501072_0002213
894 Ga0501073_0000109
895 Ga0501074_0000250
896 Ga0501076_0044203
897 Ga0501079_0005328
898 Ga0501079_0122200
899 Ga0501083_0001496
900 Ga0501035_0006867
901 Ga0501035_0191630
902 Ga0501044_0000072
903 Ga0501044_0016861
904 Ga0501044_0196885
905 nmdc:mga03n38_100_c1
906 nmdc:mga0yw44_15340_c1
907 nmdc:mga0k408_67651_c1
908 nmdc:mga07m45_45723_c1
909 nmdc:mga05p37_82927_c1
910 nmdc:mga0sz30_14357_c1
911 nmdc:mga0sz30_49283_c1
912 Ga0495601_0011752
913 Ga0495595_0000668
914 Ga0495595_0018362
915 Ga0495619_0000719
916 Ga0495619_0081978
917 Ga0500566_0000150
918 Ga0500641_0007715
919 Ga0500572_000234
920 Ga0500595_000258
921 Ga0500595_002380
922 Ga0500642_0046354
923 Ga0500559_0000244
924 Ga0500568_0012485
925 Ga0500639_057596
926 Ga0500637_0000147
927 Ga0500637_0023478
928 Ga0500576_055274
929 Ga0500645_016945
930 Ga0501084_0006091
931 Ga0500661_000057
932 Ga0501082_0002413
933 2513644635
934 2513658870
935 2513695150
936 2513860876
937 2513873486
938 2513888815
939 2513921134
940 2514012529
941 2517107154
942 2517888898
943 2528854061
944 2617352441
945 2671122504
946 2723841680
947 2728755044
948 2745081736
949 2793072988
950 2793083617
951 2805915570
952 2824670263
953 2824691105
954 2824703942
955 2824781221
956 2838124559
957 2841945246
958 2841952027
959 2841965576
960 2841970579
961 2841981828
962 2841985106
963 2847942198
964 2849083078
965 2874608025
966 2876770948
967 2876809852
968 2879112215
969 2881365275
970 2885377502
971 2885411617
972 2888390635
973 2889035446
974 2903752082
975 2904708624
976 2906613926
977 2906628487
978 2906642274
979 2906667302
980 2908747501
981 2922369529
982 2922392604
983 2922434166
984 2929618649
985 2929628666
986 2932790828
987 2932794267
988 2932808139
989 2932823109
990 2932833515
991 2933580639
992 2935623071
993 2935637083
994 2935644146
995 2935672272
996 2935679203
997 2935686449
998 2935700229
999 2935710178
1000 2935716137
1001 2935723739
1002 2935735294
1003 2935743915
1004 2935752415
1005 2935808170
1006 2935816217
1007 2935833610
1008 2935844563
1009 2935861319
1010 2935869438
1011 2935879767
1012 2935890044
1013 2935962685
1014 2935998010
1015 2936008724
1016 2936041222
1017 2940558328
1018 2941513650
1019 2941521613
1020 2941529438
1021 2941535466
1022 2941543252
1023 3005475124
1024 3005595100
1025 3005711043
1026 3005718351
1027 8006933249
1028 8006936167
1029 8006967497
1030 8006976113
1031 8006996470
1032 8016518136
1033 8016586318
1034 8017058510
1035 8019562492
1036 8019572566
1037 8019577183
1038 8019606492
1039 8055742499
1040 8056675776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11700

ATG22

Vacuole effluxer Atg22 like

82

322

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.7027 19 435
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.6975 19 439
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.6878 19 439
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.6868 19 435
8d2s-assembly1.cif.gz_A zebrafish mfsd2a isoform b in inward open ligand bound conformation 0.6811 15 434
ID Description Score Start End Superfamily
af_O06171_14_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8873 21 227 1.20.1250.20
af_O06171_14_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8362 21 227 1.20.1250.20
af_Q54IX9_60_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.787 18 237 1.20.1250.20
af_O23203_10_235_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7784 21 231 1.20.1250.20
af_Q08268_95_284_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7768 20 238 1.20.1250.20
ID Description Score Start End GO Terms
AF-K0VTF6-F1-model_v4 Major facilitator superfamily protein 0.9304 38 319 GO:0012505
GO:0016020
AF-A0A431P721-F1-model_v4 deleted 0.9283 1 274
AF-K0VTF6-F1-model_v4 Major facilitator superfamily protein 0.9242 38 319 GO:0012505
GO:0016020
AF-A0A3D5U8F1-F1-model_v4 MFS transporter 0.9223 18 312 GO:0012505
GO:0016020
AF-A0A7X4EVL7-F1-model_v4 MFS transporter 0.922 3 296 GO:0012505
GO:0016020

Map