F458536

General Info

Members Datasets Scaffolds Average Seq Length
520 296 1040 215

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10028854|Ga0105246_100288542
Length 239
Sequence MGSVTAGVAWGNDRIPGRTMSETATASAKTPVDFWFDPLCPWAWMTSRWVLEVEKVRDIEIRWHIMSLAVLNEDRIDELPEEYREMLATKAWKPVRVVTAAWQKHGEDVVGPLYTALGTRIHNQGEGPTVEAIVGALADVGLPADLIDYADQEDFEFDAELRASHKEGIEKVGQEVGTPVIAVPGADGEQIAFFGPVVTPAPKGEDAAKLWDGTLAVASVPGFYEIKRTRTAGPDFSNL

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
42 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
51 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
57 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
58 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
59 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
60 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
63 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
67 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
70 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
71 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
72 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
73 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
74 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
75 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
76 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
215 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
216 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
217 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
221 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
222 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
223 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
231 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
232 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
233 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
234 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
235 2643221647 Streptomyces sp. Root369 Isolate Unclassified
236 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
237 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
238 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
239 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
240 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
241 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
242 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
243 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
244 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
245 2808606448 Streptomyces sp. 193411 Isolate Unclassified
246 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
247 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
248 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
249 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
250 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
251 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
252 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
253 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
254 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
255 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
256 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
257 2867369537 Streptomyces sp. Z26 Isolate Unclassified
258 2867428634 Streptomyces sp. RP5T Isolate Unclassified
259 2867475112 Streptomyces sp. TM32 Isolate Unclassified
260 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
261 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
262 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
263 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
264 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
265 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
266 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
267 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
268 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
269 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
270 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
271 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
272 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
273 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
274 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
275 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
276 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
277 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
278 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
279 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
280 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
281 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
282 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
283 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
284 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
285 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
286 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
287 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
288 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
289 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
290 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
291 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
292 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
293 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
294 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
295 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
296 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.73
Metatranscriptomes 0.19
Isolates 13.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0.58
Rhizoplane 1.54
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10028854 3300011119 Bacteria 3648
2 JGI24739J22299_10027281 3300001989 Bacteria 1998
3 JGI24735J21928_10058719 3300002067 Bacteria 1107
4 JGI24738J21930_10015711 3300002075 Bacteria 1606
5 JGI25153J46596_10038137 3300003215 Bacteria 1519
6 rootH1_10010056 3300003316 Bacteria 4571
7 rootH2_10023803 3300003320 Bacteria 3717
8 rootL2_10032446 3300003322 Bacteria 2771
9 rootL2_10052067 3300003322 Bacteria 1869
10 rootH1_10013028 3300003323 Bacteria 8264
11 rootH1_10079868 3300003323 Bacteria 2021
12 rootH1_10101839 3300003323 Bacteria 2016
13 Ga0006562J51391_1119786 3300003578 Bacteria 9260
14 Ga0070713_100186321 3300005436 Bacteria 1868
15 Ga0070681_10484931 3300005458 Bacteria 1149
16 Ga0070698_100708255 3300005471 Bacteria 949
17 Ga0070665_101504122 3300005548 Bacteria 682
18 Ga0081455_10063190 3300005937 Bacteria 3107
19 Ga0075363_100070343 3300006048 Bacteria 1900
20 Ga0075367_10054245 3300006178 Bacteria 2377
21 Ga0099826_10097765 3300006948 Bacteria 1778
22 Ga0105244_10229406 3300009036 Bacteria 869
23 Ga0105243_10406191 3300009148 Bacteria 1266
24 Ga0105248_11099352 3300009177 Bacteria 899
25 Ga0105238_10163236 3300009551 Bacteria 2204
26 Ga0157342_1007370 3300012507 Bacteria 1065
27 Ga0157372_10479677 3300013307 Bacteria 1450
28 Ga0182008_10004161 3300014497 Bacteria 8513
29 Ga0157376_10149117 3300014969 Bacteria 2107
30 Ga0182006_1031128 3300015261 Bacteria 2152
31 Ga0182007_10000752 3300015262 Bacteria 18218
32 Ga0183367_1006 3300015688 Bacteria 648044
33 Ga0209758_1003326 3300025297 Bacteria 14795
34 Ga0207426_1002953 3300025302 Bacteria 9974
35 Ga0207426_1021841 3300025302 Bacteria 2206
36 Ga0207426_1030614 3300025302 Bacteria 1763
37 Ga0207426_1042372 3300025302 Bacteria 1405
38 Ga0207647_10009427 3300025904 Bacteria 6937
39 Ga0207694_10700744 3300025924 Bacteria 854
40 Ga0207709_10308377 3300025935 Bacteria 1180
41 Ga0207639_10040202 3300026041 Bacteria 3489
42 Ga0207641_10641050 3300026088 Bacteria 1043
43 Ga0268266_10028709 3300028379 Bacteria 4729
44 Ga0307517_10006681 3300028786 Bacteria 16989
45 Ga0307517_10018307 3300028786 Bacteria 9067
46 Ga0307515_10002026 3300028794 Bacteria 44830
47 Ga0307515_10040763 3300028794 Bacteria 7330
48 Ga0307515_10079981 3300028794 Bacteria 4271
49 Ga0307511_10000836 3300030521 Bacteria 32726
50 Ga0307511_10118121 3300030521 Bacteria 1653
51 Ga0307512_10024336 3300030522 Bacteria 5389
52 Ga0307512_10276056 3300030522 Bacteria 808
53 Ga0316180_1168537 3300030736 Bacteria 1275
54 Ga0307513_10104255 3300031456 Bacteria 2850
55 Ga0307513_10242980 3300031456 Bacteria 1603
56 Ga0307509_10010382 3300031507 Bacteria 11427
57 Ga0307509_10254792 3300031507 Bacteria 1535
58 Ga0307508_10015837 3300031616 Bacteria 6869
59 Ga0307508_10079499 3300031616 Bacteria 2860
60 Ga0307514_10002400 3300031649 Bacteria 19566
61 Ga0307514_10023332 3300031649 Bacteria 5020
62 Ga0307514_10190393 3300031649 Bacteria 1307
63 Ga0307516_10002619 3300031730 Bacteria 23844
64 Ga0307516_10098731 3300031730 Bacteria 2738
65 Ga0307518_10018485 3300031838 Bacteria 4998
66 Ga0307518_10048537 3300031838 Bacteria 3086
67 Ga0307518_10091539 3300031838 Bacteria 2187
68 Ga0307518_10198722 3300031838 Bacteria 1334
69 Ga0307410_10560218 3300031852 Bacteria 948
70 Ga0307507_10084847 3300033179 Bacteria 2758
71 Ga0307507_10302217 3300033179 Bacteria 980
72 Ga0307510_10003848 3300033180 Bacteria 17596
73 Ga0307510_10049806 3300033180 Bacteria 4451
74 Ga0307510_10057607 3300033180 Bacteria 4030
75 Ga0307510_10178169 3300033180 Bacteria 1693
76 Ga0373937_1404668 3300036401 Bacteria 646
77 Ga0395898_0003192 3300037466 Bacteria 18461
78 Ga0395898_0147187 3300037466 Bacteria 2254
79 Ga0395905_0350726 3300037471 Bacteria 1368
80 Ga0395901_0192017 3300038443 Bacteria 2141
81 Ga0395901_0639988 3300038443 Bacteria 1068
82 Ga0439436_0000414 3300041404 Bacteria 10728
83 Ga0439436_0001155 3300041404 Bacteria 7500
84 Ga0439439_0003975 3300041406 Bacteria 3296
85 Ga0439439_0007219 3300041406 Bacteria 2593
86 Ga0451789_0583304 3300041443 Bacteria 1344
87 Ga0451802_0596558 3300041460 Bacteria 1037
88 Ga0451841_0000327 3300041498 Bacteria 1233
89 Ga0451853_1425615 3300041512 Bacteria 4341
90 Ga0439431_0036230 3300041997 Bacteria 1242
91 Ga0439433_0011335 3300041999 Bacteria 1952
92 Ga0439433_0014351 3300041999 Bacteria 1744
93 Ga0439448_0016030 3300042005 Bacteria 2276
94 Ga0439449_0011384 3300042007 Bacteria 3347
95 Ga0439449_0021382 3300042007 Bacteria 2422
96 Ga0439455_0007318 3300042012 Bacteria 2331
97 Ga0439457_003214 3300042014 Bacteria 4489
98 Ga0439462_0012692 3300042015 Bacteria 2153
99 Ga0450894_000405 3300042131 Bacteria 7404
100 Ga0450894_025069 3300042131 Bacteria 815
101 Ga0450896_001042 3300042133 Bacteria 3250
102 Ga0450898_001777 3300042134 Bacteria 2898
103 Ga0450900_013794 3300042136 Bacteria 1071
104 Ga0450900_042062 3300042136 Bacteria 686
105 Ga0450902_012167 3300042137 Bacteria 1375
106 Ga0450903_000527 3300042138 Bacteria 8009
107 Ga0450906_001007 3300042145 Bacteria 6186
108 Ga0439458_0000156 3300042157 Bacteria 15003
109 Ga0466972_0000475 3300044658 Bacteria 20367
110 Ga0466972_0030391 3300044658 Bacteria 2659
111 Ga0466972_0042872 3300044658 Bacteria 2198
112 Ga0466972_0057642 3300044658 Bacteria 1865
113 Ga0466965_0092490 3300044683 Bacteria 1540
114 Ga0466965_0097765 3300044683 Bacteria 1498
115 Ga0466965_0132497 3300044683 Bacteria 1293
116 Ga0466966_0005922 3300044684 Bacteria 8069
117 Ga0466966_0010871 3300044684 Bacteria 6045
118 Ga0466966_0034067 3300044684 Bacteria 3296
119 Ga0466961_0002465 3300044693 Bacteria 11476
120 Ga0466961_0061743 3300044693 Bacteria 2381
121 Ga0466961_0215910 3300044693 Bacteria 1183
122 Ga0466961_0219736 3300044693 Bacteria 1171
123 Ga0466963_0005720 3300044694 Bacteria 7308
124 Ga0466963_0053129 3300044694 Bacteria 2690
125 Ga0466963_0073646 3300044694 Bacteria 2303
126 Ga0466971_0041859 3300044719 Bacteria 2058
127 Ga0466971_0077248 3300044719 Bacteria 1515
128 Ga0466970_0002579 3300044765 Bacteria 8736
129 Ga0466970_0007775 3300044765 Bacteria 5376
130 Ga0466970_0338046 3300044765 Bacteria 853
131 Ga0466957_0058403 3300044842 Bacteria 2363
132 Ga0466957_0084241 3300044842 Bacteria 1984
133 Ga0466960_0002156 3300044901 Bacteria 7342
134 Ga0466959_0003381 3300045049 Bacteria 10424
135 Ga0466959_0312873 3300045049 Bacteria 1074
136 Ga0466958_0020890 3300045836 Bacteria 3821
137 Ga0466967_0009362 3300045976 Bacteria 7263
138 Ga0466967_0221421 3300045976 Bacteria 1798
139 Ga0495617_005104 3300046452 Bacteria 4692
140 Ga0495617_089258 3300046452 Bacteria 1007
141 Ga0495592_0015988 3300046454 Bacteria 5692
142 Ga0495592_0042960 3300046454 Bacteria 3384
143 Ga0495592_0044462 3300046454 Bacteria 3318
144 Ga0495603_0000350 3300046455 Bacteria 24761
145 Ga0495603_0007624 3300046455 Bacteria 6515
146 Ga0495603_0012720 3300046455 Bacteria 5091
147 Ga0495603_0152194 3300046455 Bacteria 1343
148 Ga0495590_0027192 3300046457 Bacteria 2007
149 Ga0495590_0046248 3300046457 Bacteria 1518
150 Ga0495629_0000990 3300046459 Bacteria 22773
151 Ga0495629_0020591 3300046459 Bacteria 4710
152 Ga0495629_0034428 3300046459 Bacteria 3581
153 Ga0495638_0059642 3300046460 Bacteria 2362
154 Ga0495638_0137915 3300046460 Bacteria 1426
155 Ga0495651_0014386 3300046462 Bacteria 6118
156 Ga0495651_0047430 3300046462 Bacteria 3321
157 Ga0495651_0164304 3300046462 Bacteria 1587
158 Ga0495653_0207579 3300046463 Bacteria 1325
159 Ga0495582_0012643 3300046473 Bacteria 4655
160 Ga0495582_0076461 3300046473 Bacteria 1856
161 Ga0495605_0044563 3300046474 Bacteria 2192
162 Ga0495639_0009899 3300046475 Bacteria 4094
163 Ga0495662_0007110 3300046476 Bacteria 5553
164 Ga0495662_0022289 3300046476 Bacteria 3059
165 Ga0495664_0010661 3300046477 Bacteria 5159
166 Ga0495584_0085600 3300046491 Bacteria 1588
167 Ga0495585_0134379 3300046492 Bacteria 1299
168 Ga0495585_0226655 3300046492 Bacteria 941
169 Ga0495594_0014374 3300046499 Bacteria 4146
170 Ga0495594_0062461 3300046499 Bacteria 2062
171 Ga0495596_0021897 3300046500 Bacteria 2604
172 Ga0495607_0033553 3300046501 Bacteria 3122
173 Ga0495583_0020413 3300046506 Bacteria 3432
174 Ga0495606_0042476 3300046507 Bacteria 3039
175 Ga0495608_0139778 3300046511 Bacteria 1546
176 Ga0495610_0109108 3300046512 Bacteria 1228
177 Ga0495610_0249241 3300046512 Bacteria 704
178 Ga0495616_0092952 3300046513 Bacteria 1425
179 Ga0495618_0026914 3300046514 Bacteria 3578
180 Ga0495618_0083761 3300046514 Bacteria 2037
181 Ga0495618_0189756 3300046514 Bacteria 1303
182 Ga0495620_0006145 3300046515 Bacteria 6626
183 Ga0495620_0044757 3300046515 Bacteria 1921
184 Ga0495620_0070972 3300046515 Bacteria 1425
185 Ga0495620_0115385 3300046515 Bacteria 1062
186 Ga0495628_0042472 3300046516 Bacteria 3626
187 Ga0495628_0089030 3300046516 Bacteria 2391
188 Ga0495628_0233356 3300046516 Bacteria 1378
189 Ga0495630_0047583 3300046517 Bacteria 3209
190 Ga0495631_0002860 3300046518 Bacteria 9582
191 Ga0495631_0054961 3300046518 Bacteria 1735
192 Ga0495637_0022797 3300046520 Bacteria 2852
193 Ga0495643_0003592 3300046522 Bacteria 11270
194 Ga0495643_0005069 3300046522 Bacteria 9014
195 Ga0495648_0050438 3300046524 Bacteria 2542
196 Ga0495666_0131047 3300046526 Bacteria 1171
197 Ga0495666_0132325 3300046526 Bacteria 1165
198 Ga0495652_0042546 3300046529 Bacteria 3916
199 Ga0495652_0064039 3300046529 Bacteria 3094
200 Ga0495652_0127752 3300046529 Bacteria 2017
201 Ga0495654_0097146 3300046530 Bacteria 1360
202 Ga0495640_0006261 3300046533 Bacteria 9424
203 Ga0495640_0014341 3300046533 Bacteria 6000
204 Ga0495640_0025281 3300046533 Bacteria 4309
205 Ga0495586_0075799 3300046535 Bacteria 1842
206 Ga0495587_0296020 3300046536 Bacteria 905
207 Ga0495609_0013338 3300046538 Bacteria 3884
208 Ga0495597_0065597 3300046542 Bacteria 1574
209 Ga0495622_0047781 3300046557 Bacteria 1988
210 Ga0495633_0021494 3300046558 Bacteria 3226
211 Ga0495667_0290349 3300046559 Bacteria 1037
212 Ga0495667_0342237 3300046559 Bacteria 945
213 Ga0495656_0357481 3300046615 Bacteria 758
214 Ga0495634_0000458 3300046642 Bacteria 40403
215 Ga0495634_0016025 3300046642 Bacteria 5368
216 Ga0495611_0053605 3300046648 Bacteria 1820
217 Ga0495611_0122030 3300046648 Bacteria 1215
218 Ga0495611_0321456 3300046648 Bacteria 712
219 Ga0495625_0074982 3300046660 Bacteria 2367
220 Ga0495625_0159251 3300046660 Bacteria 1513
221 Ga0495625_0317530 3300046660 Bacteria 993
222 Ga0495635_0007607 3300046663 Bacteria 7558
223 Ga0495659_0087605 3300046664 Bacteria 1191
224 Ga0495661_0031140 3300046665 Bacteria 3389
225 Ga0495661_0112922 3300046665 Bacteria 1512
226 Ga0495588_0001743 3300046674 Bacteria 9261
227 Ga0495657_0001238 3300046675 Bacteria 22342
228 Ga0495657_0020033 3300046675 Bacteria 4815
229 Ga0495657_0336255 3300046675 Bacteria 895
230 Ga0495623_0052863 3300046679 Bacteria 2566
231 Ga0495646_0019396 3300046680 Bacteria 4306
232 Ga0495646_0065611 3300046680 Bacteria 2149
233 Ga0495658_0078799 3300046683 Bacteria 1929
234 Ga0495613_0004836 3300046689 Bacteria 10103
235 Ga0495613_0007095 3300046689 Bacteria 8340
236 Ga0495613_0020168 3300046689 Bacteria 4967
237 Ga0495613_0031657 3300046689 Bacteria 3929
238 Ga0495613_0386299 3300046689 Bacteria 956
239 Ga0495613_0573483 3300046689 Bacteria 753
240 Ga0495624_0094027 3300046690 Bacteria 1848
241 Ga0495670_0040009 3300046691 Bacteria 2338
242 Ga0495670_0438272 3300046691 Bacteria 707
243 Ga0495671_0066399 3300046692 Bacteria 1775
244 Ga0495649_0020590 3300046694 Bacteria 3699
245 Ga0495649_0063423 3300046694 Bacteria 1985
246 Ga0495649_0188202 3300046694 Bacteria 1075
247 Ga0495589_0006628 3300046794 Bacteria 6098
248 Ga0495589_0012588 3300046794 Bacteria 4376
249 Ga0495589_0018436 3300046794 Bacteria 3577
250 Ga0495589_0073255 3300046794 Bacteria 1671
251 Ga0495589_0145765 3300046794 Bacteria 1132
252 Ga0495600_0022025 3300046809 Bacteria 4088
253 Ga0495600_0106018 3300046809 Bacteria 1831
254 Ga0495600_0320671 3300046809 Bacteria 974
255 Ga0495660_0007782 3300046810 Bacteria 6292
256 Ga0495660_0011282 3300046810 Bacteria 5188
257 Ga0495581_0025577 3300047315 Bacteria 3423
258 Ga0495581_0027408 3300047315 Bacteria 3304
259 Ga0495581_0058854 3300047315 Bacteria 2219
260 Ga0495581_0506840 3300047315 Bacteria 701
261 Ga0495604_0006701 3300047317 Bacteria 9131
262 Ga0495604_0018551 3300047317 Bacteria 5574
263 Ga0495604_0028044 3300047317 Bacteria 4478
264 Ga0495604_0109212 3300047317 Bacteria 2019
265 Ga0495636_0000529 3300047318 Bacteria 14090
266 Ga0495636_0001825 3300047318 Bacteria 8146
267 Ga0495636_0025355 3300047318 Bacteria 2407
268 Ga0495636_0099955 3300047318 Bacteria 1267
269 Ga0495672_0014408 3300047320 Bacteria 5415
270 Ga0495676_0003494 3300047321 Bacteria 14226
271 Ga0495676_0008568 3300047321 Bacteria 9368
272 Ga0495676_0032067 3300047321 Bacteria 4439
273 Ga0495676_0185750 3300047321 Bacteria 1453
274 Ga0495676_0326755 3300047321 Bacteria 1029
275 Ga0495680_0021438 3300047322 Bacteria 5409
276 Ga0495683_0024991 3300047323 Bacteria 3062
277 Ga0495683_0045158 3300047323 Bacteria 2214
278 Ga0495683_0067862 3300047323 Bacteria 1755
279 Ga0495683_0068785 3300047323 Bacteria 1741
280 Ga0495683_0218417 3300047323 Bacteria 851
281 Ga0495687_005140 3300047443 Bacteria 8469
282 Ga0495687_012412 3300047443 Bacteria 4505
283 Ga0495687_042595 3300047443 Bacteria 1982
284 Ga0495687_105236 3300047443 Bacteria 1049
285 Ga0495675_0006648 3300047444 Bacteria 7081
286 Ga0495675_0058022 3300047444 Bacteria 2455
287 Ga0495679_031232 3300047446 Bacteria 1720
288 Ga0495685_002033 3300047447 Bacteria 6289
289 Ga0495685_002055 3300047447 Bacteria 6257
290 Ga0495685_038622 3300047447 Bacteria 1635
291 Ga0495673_0081878 3300047469 Bacteria 1336
292 Ga0495681_0007261 3300047470 Bacteria 7121
293 Ga0495681_0013708 3300047470 Bacteria 4689
294 Ga0495681_0029124 3300047470 Bacteria 2830
295 Ga0495684_0099874 3300047471 Bacteria 2194
296 Ga0495684_0620166 3300047471 Bacteria 727
297 Ga0495593_0015822 3300047673 Bacteria 4262
298 Ga0495593_0052002 3300047673 Bacteria 2166
299 Ga0495602_0106139 3300048088 Bacteria 2293
300 Ga0495614_0015814 3300048089 Bacteria 3286
301 Ga0495614_0027232 3300048089 Bacteria 2465
302 Ga0495614_0044725 3300048089 Bacteria 1899
303 Ga0496104_0117801 3300048907 Bacteria 2549
304 Ga0496106_0135749 3300048909 Bacteria 1932
305 Ga0496108_0086036 3300048911 Bacteria 2669
306 Ga0496112_0745790 3300048915 Bacteria 906
307 Ga0496113_0721925 3300048916 Bacteria 794
308 Ga0495678_104976 3300049459 Bacteria 973
309 Ga0501031_0003587 3300049568 Bacteria 9983
310 Ga0501031_0028523 3300049568 Bacteria 3639
311 Ga0501031_0029774 3300049568 Bacteria 3562
312 Ga0501031_0120590 3300049568 Bacteria 1713
313 Ga0501031_0129398 3300049568 Bacteria 1649
314 Ga0501031_0360836 3300049568 Bacteria 940
315 Ga0501032_0006047 3300049569 Bacteria 8925
316 Ga0501032_0007941 3300049569 Bacteria 7729
317 Ga0501032_0017046 3300049569 Bacteria 5103
318 Ga0501032_0026133 3300049569 Bacteria 4021
319 Ga0501033_0006438 3300049570 Bacteria 9192
320 Ga0501033_0010358 3300049570 Bacteria 7157
321 Ga0501033_0022267 3300049570 Bacteria 4781
322 Ga0501033_0041517 3300049570 Bacteria 3432
323 Ga0501033_0058868 3300049570 Bacteria 2837
324 Ga0501033_0067663 3300049570 Bacteria 2626
325 Ga0501033_0099058 3300049570 Bacteria 2128
326 Ga0501033_0378198 3300049570 Bacteria 989
327 Ga0501034_0003189 3300049571 Bacteria 18861
328 Ga0501034_0011728 3300049571 Bacteria 9066
329 Ga0501034_0011990 3300049571 Bacteria 8957
330 Ga0501034_0029497 3300049571 Bacteria 5576
331 Ga0501034_0108537 3300049571 Bacteria 2766
332 Ga0501034_0155108 3300049571 Bacteria 2264
333 Ga0501034_0166411 3300049571 Bacteria 2173
334 Ga0501034_0293877 3300049571 Bacteria 1562
335 Ga0501036_0010604 3300049572 Bacteria 7615
336 Ga0501036_0010765 3300049572 Bacteria 7561
337 Ga0501036_0040085 3300049572 Bacteria 3962
338 Ga0501036_0041575 3300049572 Bacteria 3888
339 Ga0501036_0122973 3300049572 Bacteria 2191
340 Ga0501036_0177362 3300049572 Bacteria 1794
341 Ga0501036_0289551 3300049572 Bacteria 1370
342 Ga0501036_0298159 3300049572 Bacteria 1348
343 Ga0501037_0004885 3300049573 Bacteria 9750
344 Ga0501037_0005110 3300049573 Bacteria 9543
345 Ga0501037_0056596 3300049573 Bacteria 2863
346 Ga0501037_0329022 3300049573 Bacteria 1057
347 Ga0501037_0332561 3300049573 Bacteria 1050
348 Ga0501038_0005838 3300049574 Bacteria 11385
349 Ga0501038_0013836 3300049574 Bacteria 7353
350 Ga0501038_0053550 3300049574 Bacteria 3473
351 Ga0501038_0083402 3300049574 Bacteria 2690
352 Ga0501038_0103024 3300049574 Bacteria 2374
353 Ga0501038_0169683 3300049574 Bacteria 1767
354 Ga0501038_0360038 3300049574 Bacteria 1131
355 Ga0501039_0032817 3300049575 Bacteria 4004
356 Ga0501039_0262505 3300049575 Bacteria 1357
357 Ga0501039_0330915 3300049575 Bacteria 1197
358 Ga0501039_0595787 3300049575 Bacteria 866
359 Ga0501041_0002940 3300049577 Bacteria 9772
360 Ga0501042_0033787 3300049578 Bacteria 3626
361 Ga0501043_0011478 3300049579 Bacteria 6935
362 Ga0501043_0012717 3300049579 Bacteria 6580
363 Ga0501043_0055712 3300049579 Bacteria 3106
364 Ga0501043_0056561 3300049579 Bacteria 3081
365 Ga0501043_0059391 3300049579 Bacteria 3001
366 Ga0501043_0095141 3300049579 Bacteria 2341
367 Ga0501043_0100933 3300049579 Bacteria 2268
368 Ga0501043_0367848 3300049579 Bacteria 1090
369 Ga0501046_0009223 3300049580 Bacteria 8543
370 Ga0501046_0052178 3300049580 Bacteria 3223
371 Ga0501046_0060305 3300049580 Bacteria 2969
372 Ga0501046_0212886 3300049580 Bacteria 1434
373 Ga0501047_0009976 3300049581 Bacteria 8977
374 Ga0501047_0014084 3300049581 Bacteria 7599
375 Ga0501047_0023181 3300049581 Bacteria 5959
376 Ga0501047_0044875 3300049581 Bacteria 4272
377 Ga0501047_0114570 3300049581 Bacteria 2578
378 Ga0501047_0182643 3300049581 Bacteria 1964
379 Ga0501047_0219967 3300049581 Bacteria 1755
380 Ga0501047_0391740 3300049581 Bacteria 1222
381 Ga0501048_0061642 3300049582 Bacteria 2655
382 Ga0501048_0092598 3300049582 Bacteria 2131
383 Ga0501067_0006058 3300049583 Bacteria 6704
384 Ga0501068_0002501 3300049584 Bacteria 9764
385 Ga0501069_0008664 3300049585 Bacteria 5356
386 Ga0501069_0629112 3300049585 Bacteria 645
387 Ga0501070_0007469 3300049586 Bacteria 9284
388 Ga0501070_0061168 3300049586 Bacteria 3120
389 Ga0501070_0358609 3300049586 Bacteria 1183
390 Ga0501071_0000759 3300049587 Bacteria 17111
391 Ga0501072_0004361 3300049588 Bacteria 10737
392 Ga0501072_0046715 3300049588 Bacteria 3409
393 Ga0501073_0344465 3300049589 Bacteria 1029
394 Ga0501074_0006513 3300049590 Bacteria 8430
395 Ga0501074_0114814 3300049590 Bacteria 1926
396 Ga0501076_0006174 3300049592 Bacteria 8673
397 Ga0501077_0013524 3300049593 Bacteria 5119
398 Ga0501079_0034809 3300049741 Bacteria 3875
399 Ga0501079_0609790 3300049741 Bacteria 859
400 Ga0501080_0009372 3300049742 Bacteria 8929
401 Ga0501080_0075747 3300049742 Bacteria 3129
402 Ga0501083_0014645 3300049744 Bacteria 5482
403 Ga0501035_0009999 3300049822 Bacteria 8803
404 Ga0501035_0019012 3300049822 Bacteria 6323
405 Ga0501035_0022321 3300049822 Bacteria 5811
406 Ga0501035_0056688 3300049822 Bacteria 3495
407 Ga0501035_0091215 3300049822 Bacteria 2682
408 Ga0501035_0156685 3300049822 Bacteria 1974
409 Ga0501035_0178564 3300049822 Bacteria 1830
410 Ga0501035_0204863 3300049822 Bacteria 1690
411 Ga0501035_0224064 3300049822 Bacteria 1604
412 Ga0501044_0004657 3300049823 Bacteria 15348
413 Ga0501044_0007487 3300049823 Bacteria 12007
414 Ga0501044_0010357 3300049823 Bacteria 10119
415 Ga0501044_0017610 3300049823 Bacteria 7663
416 Ga0501044_0019610 3300049823 Bacteria 7229
417 Ga0501044_0021560 3300049823 Bacteria 6870
418 Ga0501044_0025758 3300049823 Bacteria 6235
419 Ga0501044_0059609 3300049823 Bacteria 3910
420 Ga0501044_0184718 3300049823 Bacteria 2050
421 Ga0501044_0222754 3300049823 Bacteria 1837
422 Ga0501044_0740358 3300049823 Bacteria 866
423 Ga0501045_0068104 3300049824 Bacteria 2614
424 nmdc:mga03n38_10736_c1 3300050490 Bacteria 3384
425 nmdc:mga06z11_626_c1 3300050494 Bacteria 12865
426 nmdc:mga07m45_114473_c1 3300050496 Bacteria 1555
427 Ga0500610_0081717 3300053079 Bacteria 1684
428 Ga0495655_0102590 3300053083 Bacteria 849
429 Ga0495619_0091280 3300053085 Bacteria 2062
430 Ga0500578_0016817 3300053086 Bacteria 4697
431 Ga0500578_0143353 3300053086 Bacteria 1493
432 Ga0500644_0171096 3300053088 Bacteria 883
433 Ga0500647_0156822 3300053091 Bacteria 1059
434 Ga0500566_0015457 3300053094 Bacteria 4481
435 Ga0500640_007772 3300053095 Bacteria 4197
436 Ga0500654_031974 3300053099 Bacteria 3148
437 Ga0500560_003770 3300053107 Bacteria 3117
438 Ga0500652_018558 3300053131 Bacteria 2570
439 Ga0500658_0019128 3300053134 Bacteria 2575
440 Ga0500573_0015804 3300053140 Bacteria 4281
441 Ga0500577_0171237 3300053142 Bacteria 929
442 Ga0500588_0049286 3300053146 Bacteria 1306
443 Ga0500600_0069189 3300053149 Bacteria 1940
444 Ga0500634_0057104 3300053161 Bacteria 2084
445 Ga0500636_0303016 3300053177 Bacteria 786
446 Ga0500656_000499 3300053732 Bacteria 2900
447 Ga0501084_0012357 3300054114 Bacteria 7073
448 Ga0501082_0005799 3300060353 Bacteria 10720
449 Ga0466962_0011620 3300061719 Bacteria 4240
450 Ga0466962_0028422 3300061719 Bacteria 2679
451 Ga0466962_0403098 3300061719 Bacteria 685
452 Ga0530510_0033810 3300061734 Bacteria 3681
453 2547406868 2547132111 Bacteria 8013147
454 2585304776 2582581313 Bacteria 10042643
455 2585319492 2582581314 Bacteria 11452267
456 2616700778 2616644814 Bacteria 11555299
457 2616905630 2616644941 Bacteria 8510691
458 2644263092 2643221647 Bacteria 10741251
459 2774394347 2773857762 Bacteria 5971770
460 2784587894 2784132148 Bacteria 8627943
461 2785344242 2784746763 Bacteria 9783172
462 2785368632 2784746768 Bacteria 10036182
463 2786669738 2786546132 Bacteria 10419719
464 2793976104 2791355406 Bacteria 11364898
465 2804844911 2802429296 Bacteria 7227771
466 2808841316 2808606359 Bacteria 9866990
467 2808919842 2808606375 Bacteria 9466072
468 2809231488 2808606448 Bacteria 8656184
469 2811848304 2808606982 Bacteria 7791042
470 2812358936 2811994879 Bacteria 9313447
471 2812481203 2811994917 Bacteria 7761064
472 2852642176 2852635781 Bacteria 8251373
473 2862184861 2862178590 Bacteria 8583590
474 2862288100 2862281513 Bacteria 9621493
475 2862289218 2862281513 Bacteria 9621493
476 2862291922 2862290372 Bacteria 7471434
477 2862386795 2862382967 Bacteria 10317375
478 2862509525 2862507626 Bacteria 9425308
479 2863405493 2863404153 Bacteria 9672205
480 2867348161 2867346516 Bacteria 7608576
481 2867371120 2867369537 Bacteria 6501581
482 2867433618 2867428634 Bacteria 9590268
483 2867479699 2867475112 Bacteria 6909112
484 2875393835 2875391855 Bacteria 7600475
485 2877681880 2877676314 Bacteria 9512378
486 2912720865 2912715099 Bacteria 9460473
487 2912724975 2912723979 Bacteria 8557534
488 2912759970 2912757875 Bacteria 7940295
489 2919468711 2919468124 Bacteria 9133025
490 2946066946 2946064051 Bacteria 8957905
491 2946075255 2946072368 Bacteria 8999607
492 2947230291 2947224130 Bacteria 9938529
493 2954003620 2954002825 Bacteria 9173742
494 2954387020 2954380949 Bacteria 10050426
495 2954676164 2954673503 Bacteria 9685905
496 2954688004 2954682443 Bacteria 9862841
497 2954697855 2954691527 Bacteria 10720516
498 2954704361 2954701450 Bacteria 10834262
499 2954716968 2954711539 Bacteria 10867210
500 2954726919 2954721474 Bacteria 10456478
501 2954734879 2954731030 Bacteria 10243860
502 2954745840 2954740390 Bacteria 10229294
503 2954753750 2954749733 Bacteria 10366972
504 2954764813 2954759201 Bacteria 9358192
505 2997608136 2997600082 Bacteria 9896405
506 3006321804 3006321560 Bacteria 8247479
507 3006399668 3006393351 Bacteria 6615579
508 3006501804 3006493962 Bacteria 8825450
509 8008559577 8008558824 Bacteria 10610750
510 8008579578 8008574985 Bacteria 7815457
511 8023629299 8023623736 Bacteria 8593882
512 8025419349 8025413630 Bacteria 7014048
513 8025533580 8025530807 Bacteria 8495698
514 8047898905 8047893842 Bacteria 11723082
515 8048127727 8048127548 Bacteria 11053136
516 8048360014 8048356638 Bacteria 11044339
517 8048375863 8048369669 Bacteria 11666822
518 8048382344 8048379754 Bacteria 11877923
519 8048409244 8048406513 Bacteria 8936924
520 8056833941 8056829672 Bacteria 9045328
521 Ga0105246_10028854
522 JGI24739J22299_10027281
523 JGI24735J21928_10058719
524 JGI24738J21930_10015711
525 JGI25153J46596_10038137
526 rootH1_10010056
527 rootH2_10023803
528 rootL2_10032446
529 rootL2_10052067
530 rootH1_10013028
531 rootH1_10079868
532 rootH1_10101839
533 Ga0006562J51391_1119786
534 Ga0070713_100186321
535 Ga0070681_10484931
536 Ga0070698_100708255
537 Ga0070665_101504122
538 Ga0081455_10063190
539 Ga0075363_100070343
540 Ga0075367_10054245
541 Ga0099826_10097765
542 Ga0105244_10229406
543 Ga0105243_10406191
544 Ga0105248_11099352
545 Ga0105238_10163236
546 Ga0157342_1007370
547 Ga0157372_10479677
548 Ga0182008_10004161
549 Ga0157376_10149117
550 Ga0182006_1031128
551 Ga0182007_10000752
552 Ga0183367_1006
553 Ga0209758_1003326
554 Ga0207426_1002953
555 Ga0207426_1021841
556 Ga0207426_1030614
557 Ga0207426_1042372
558 Ga0207647_10009427
559 Ga0207694_10700744
560 Ga0207709_10308377
561 Ga0207639_10040202
562 Ga0207641_10641050
563 Ga0268266_10028709
564 Ga0307517_10006681
565 Ga0307517_10018307
566 Ga0307515_10002026
567 Ga0307515_10040763
568 Ga0307515_10079981
569 Ga0307511_10000836
570 Ga0307511_10118121
571 Ga0307512_10024336
572 Ga0307512_10276056
573 Ga0316180_1168537
574 Ga0307513_10104255
575 Ga0307513_10242980
576 Ga0307509_10010382
577 Ga0307509_10254792
578 Ga0307508_10015837
579 Ga0307508_10079499
580 Ga0307514_10002400
581 Ga0307514_10023332
582 Ga0307514_10190393
583 Ga0307516_10002619
584 Ga0307516_10098731
585 Ga0307518_10018485
586 Ga0307518_10048537
587 Ga0307518_10091539
588 Ga0307518_10198722
589 Ga0307410_10560218
590 Ga0307507_10084847
591 Ga0307507_10302217
592 Ga0307510_10003848
593 Ga0307510_10049806
594 Ga0307510_10057607
595 Ga0307510_10178169
596 Ga0373937_1404668
597 Ga0395898_0003192
598 Ga0395898_0147187
599 Ga0395905_0350726
600 Ga0395901_0192017
601 Ga0395901_0639988
602 Ga0439436_0000414
603 Ga0439436_0001155
604 Ga0439439_0003975
605 Ga0439439_0007219
606 Ga0451789_0583304
607 Ga0451802_0596558
608 Ga0451841_0000327
609 Ga0451853_1425615
610 Ga0439431_0036230
611 Ga0439433_0011335
612 Ga0439433_0014351
613 Ga0439448_0016030
614 Ga0439449_0011384
615 Ga0439449_0021382
616 Ga0439455_0007318
617 Ga0439457_003214
618 Ga0439462_0012692
619 Ga0450894_000405
620 Ga0450894_025069
621 Ga0450896_001042
622 Ga0450898_001777
623 Ga0450900_013794
624 Ga0450900_042062
625 Ga0450902_012167
626 Ga0450903_000527
627 Ga0450906_001007
628 Ga0439458_0000156
629 Ga0466972_0000475
630 Ga0466972_0030391
631 Ga0466972_0042872
632 Ga0466972_0057642
633 Ga0466965_0092490
634 Ga0466965_0097765
635 Ga0466965_0132497
636 Ga0466966_0005922
637 Ga0466966_0010871
638 Ga0466966_0034067
639 Ga0466961_0002465
640 Ga0466961_0061743
641 Ga0466961_0215910
642 Ga0466961_0219736
643 Ga0466963_0005720
644 Ga0466963_0053129
645 Ga0466963_0073646
646 Ga0466971_0041859
647 Ga0466971_0077248
648 Ga0466970_0002579
649 Ga0466970_0007775
650 Ga0466970_0338046
651 Ga0466957_0058403
652 Ga0466957_0084241
653 Ga0466960_0002156
654 Ga0466959_0003381
655 Ga0466959_0312873
656 Ga0466958_0020890
657 Ga0466967_0009362
658 Ga0466967_0221421
659 Ga0495617_005104
660 Ga0495617_089258
661 Ga0495592_0015988
662 Ga0495592_0042960
663 Ga0495592_0044462
664 Ga0495603_0000350
665 Ga0495603_0007624
666 Ga0495603_0012720
667 Ga0495603_0152194
668 Ga0495590_0027192
669 Ga0495590_0046248
670 Ga0495629_0000990
671 Ga0495629_0020591
672 Ga0495629_0034428
673 Ga0495638_0059642
674 Ga0495638_0137915
675 Ga0495651_0014386
676 Ga0495651_0047430
677 Ga0495651_0164304
678 Ga0495653_0207579
679 Ga0495582_0012643
680 Ga0495582_0076461
681 Ga0495605_0044563
682 Ga0495639_0009899
683 Ga0495662_0007110
684 Ga0495662_0022289
685 Ga0495664_0010661
686 Ga0495584_0085600
687 Ga0495585_0134379
688 Ga0495585_0226655
689 Ga0495594_0014374
690 Ga0495594_0062461
691 Ga0495596_0021897
692 Ga0495607_0033553
693 Ga0495583_0020413
694 Ga0495606_0042476
695 Ga0495608_0139778
696 Ga0495610_0109108
697 Ga0495610_0249241
698 Ga0495616_0092952
699 Ga0495618_0026914
700 Ga0495618_0083761
701 Ga0495618_0189756
702 Ga0495620_0006145
703 Ga0495620_0044757
704 Ga0495620_0070972
705 Ga0495620_0115385
706 Ga0495628_0042472
707 Ga0495628_0089030
708 Ga0495628_0233356
709 Ga0495630_0047583
710 Ga0495631_0002860
711 Ga0495631_0054961
712 Ga0495637_0022797
713 Ga0495643_0003592
714 Ga0495643_0005069
715 Ga0495648_0050438
716 Ga0495666_0131047
717 Ga0495666_0132325
718 Ga0495652_0042546
719 Ga0495652_0064039
720 Ga0495652_0127752
721 Ga0495654_0097146
722 Ga0495640_0006261
723 Ga0495640_0014341
724 Ga0495640_0025281
725 Ga0495586_0075799
726 Ga0495587_0296020
727 Ga0495609_0013338
728 Ga0495597_0065597
729 Ga0495622_0047781
730 Ga0495633_0021494
731 Ga0495667_0290349
732 Ga0495667_0342237
733 Ga0495656_0357481
734 Ga0495634_0000458
735 Ga0495634_0016025
736 Ga0495611_0053605
737 Ga0495611_0122030
738 Ga0495611_0321456
739 Ga0495625_0074982
740 Ga0495625_0159251
741 Ga0495625_0317530
742 Ga0495635_0007607
743 Ga0495659_0087605
744 Ga0495661_0031140
745 Ga0495661_0112922
746 Ga0495588_0001743
747 Ga0495657_0001238
748 Ga0495657_0020033
749 Ga0495657_0336255
750 Ga0495623_0052863
751 Ga0495646_0019396
752 Ga0495646_0065611
753 Ga0495658_0078799
754 Ga0495613_0004836
755 Ga0495613_0007095
756 Ga0495613_0020168
757 Ga0495613_0031657
758 Ga0495613_0386299
759 Ga0495613_0573483
760 Ga0495624_0094027
761 Ga0495670_0040009
762 Ga0495670_0438272
763 Ga0495671_0066399
764 Ga0495649_0020590
765 Ga0495649_0063423
766 Ga0495649_0188202
767 Ga0495589_0006628
768 Ga0495589_0012588
769 Ga0495589_0018436
770 Ga0495589_0073255
771 Ga0495589_0145765
772 Ga0495600_0022025
773 Ga0495600_0106018
774 Ga0495600_0320671
775 Ga0495660_0007782
776 Ga0495660_0011282
777 Ga0495581_0025577
778 Ga0495581_0027408
779 Ga0495581_0058854
780 Ga0495581_0506840
781 Ga0495604_0006701
782 Ga0495604_0018551
783 Ga0495604_0028044
784 Ga0495604_0109212
785 Ga0495636_0000529
786 Ga0495636_0001825
787 Ga0495636_0025355
788 Ga0495636_0099955
789 Ga0495672_0014408
790 Ga0495676_0003494
791 Ga0495676_0008568
792 Ga0495676_0032067
793 Ga0495676_0185750
794 Ga0495676_0326755
795 Ga0495680_0021438
796 Ga0495683_0024991
797 Ga0495683_0045158
798 Ga0495683_0067862
799 Ga0495683_0068785
800 Ga0495683_0218417
801 Ga0495687_005140
802 Ga0495687_012412
803 Ga0495687_042595
804 Ga0495687_105236
805 Ga0495675_0006648
806 Ga0495675_0058022
807 Ga0495679_031232
808 Ga0495685_002033
809 Ga0495685_002055
810 Ga0495685_038622
811 Ga0495673_0081878
812 Ga0495681_0007261
813 Ga0495681_0013708
814 Ga0495681_0029124
815 Ga0495684_0099874
816 Ga0495684_0620166
817 Ga0495593_0015822
818 Ga0495593_0052002
819 Ga0495602_0106139
820 Ga0495614_0015814
821 Ga0495614_0027232
822 Ga0495614_0044725
823 Ga0496104_0117801
824 Ga0496106_0135749
825 Ga0496108_0086036
826 Ga0496112_0745790
827 Ga0496113_0721925
828 Ga0495678_104976
829 Ga0501031_0003587
830 Ga0501031_0028523
831 Ga0501031_0029774
832 Ga0501031_0120590
833 Ga0501031_0129398
834 Ga0501031_0360836
835 Ga0501032_0006047
836 Ga0501032_0007941
837 Ga0501032_0017046
838 Ga0501032_0026133
839 Ga0501033_0006438
840 Ga0501033_0010358
841 Ga0501033_0022267
842 Ga0501033_0041517
843 Ga0501033_0058868
844 Ga0501033_0067663
845 Ga0501033_0099058
846 Ga0501033_0378198
847 Ga0501034_0003189
848 Ga0501034_0011728
849 Ga0501034_0011990
850 Ga0501034_0029497
851 Ga0501034_0108537
852 Ga0501034_0155108
853 Ga0501034_0166411
854 Ga0501034_0293877
855 Ga0501036_0010604
856 Ga0501036_0010765
857 Ga0501036_0040085
858 Ga0501036_0041575
859 Ga0501036_0122973
860 Ga0501036_0177362
861 Ga0501036_0289551
862 Ga0501036_0298159
863 Ga0501037_0004885
864 Ga0501037_0005110
865 Ga0501037_0056596
866 Ga0501037_0329022
867 Ga0501037_0332561
868 Ga0501038_0005838
869 Ga0501038_0013836
870 Ga0501038_0053550
871 Ga0501038_0083402
872 Ga0501038_0103024
873 Ga0501038_0169683
874 Ga0501038_0360038
875 Ga0501039_0032817
876 Ga0501039_0262505
877 Ga0501039_0330915
878 Ga0501039_0595787
879 Ga0501041_0002940
880 Ga0501042_0033787
881 Ga0501043_0011478
882 Ga0501043_0012717
883 Ga0501043_0055712
884 Ga0501043_0056561
885 Ga0501043_0059391
886 Ga0501043_0095141
887 Ga0501043_0100933
888 Ga0501043_0367848
889 Ga0501046_0009223
890 Ga0501046_0052178
891 Ga0501046_0060305
892 Ga0501046_0212886
893 Ga0501047_0009976
894 Ga0501047_0014084
895 Ga0501047_0023181
896 Ga0501047_0044875
897 Ga0501047_0114570
898 Ga0501047_0182643
899 Ga0501047_0219967
900 Ga0501047_0391740
901 Ga0501048_0061642
902 Ga0501048_0092598
903 Ga0501067_0006058
904 Ga0501068_0002501
905 Ga0501069_0008664
906 Ga0501069_0629112
907 Ga0501070_0007469
908 Ga0501070_0061168
909 Ga0501070_0358609
910 Ga0501071_0000759
911 Ga0501072_0004361
912 Ga0501072_0046715
913 Ga0501073_0344465
914 Ga0501074_0006513
915 Ga0501074_0114814
916 Ga0501076_0006174
917 Ga0501077_0013524
918 Ga0501079_0034809
919 Ga0501079_0609790
920 Ga0501080_0009372
921 Ga0501080_0075747
922 Ga0501083_0014645
923 Ga0501035_0009999
924 Ga0501035_0019012
925 Ga0501035_0022321
926 Ga0501035_0056688
927 Ga0501035_0091215
928 Ga0501035_0156685
929 Ga0501035_0178564
930 Ga0501035_0204863
931 Ga0501035_0224064
932 Ga0501044_0004657
933 Ga0501044_0007487
934 Ga0501044_0010357
935 Ga0501044_0017610
936 Ga0501044_0019610
937 Ga0501044_0021560
938 Ga0501044_0025758
939 Ga0501044_0059609
940 Ga0501044_0184718
941 Ga0501044_0222754
942 Ga0501044_0740358
943 Ga0501045_0068104
944 nmdc:mga03n38_10736_c1
945 nmdc:mga06z11_626_c1
946 nmdc:mga07m45_114473_c1
947 Ga0500610_0081717
948 Ga0495655_0102590
949 Ga0495619_0091280
950 Ga0500578_0016817
951 Ga0500578_0143353
952 Ga0500644_0171096
953 Ga0500647_0156822
954 Ga0500566_0015457
955 Ga0500640_007772
956 Ga0500654_031974
957 Ga0500560_003770
958 Ga0500652_018558
959 Ga0500658_0019128
960 Ga0500573_0015804
961 Ga0500577_0171237
962 Ga0500588_0049286
963 Ga0500600_0069189
964 Ga0500634_0057104
965 Ga0500636_0303016
966 Ga0500656_000499
967 Ga0501084_0012357
968 Ga0501082_0005799
969 Ga0466962_0011620
970 Ga0466962_0028422
971 Ga0466962_0403098
972 Ga0530510_0033810
973 2547406868
974 2585304776
975 2585319492
976 2616700778
977 2616905630
978 2644263092
979 2774394347
980 2784587894
981 2785344242
982 2785368632
983 2786669738
984 2793976104
985 2804844911
986 2808841316
987 2808919842
988 2809231488
989 2811848304
990 2812358936
991 2812481203
992 2852642176
993 2862184861
994 2862288100
995 2862289218
996 2862291922
997 2862386795
998 2862509525
999 2863405493
1000 2867348161
1001 2867371120
1002 2867433618
1003 2867479699
1004 2875393835
1005 2877681880
1006 2912720865
1007 2912724975
1008 2912759970
1009 2919468711
1010 2946066946
1011 2946075255
1012 2947230291
1013 2954003620
1014 2954387020
1015 2954676164
1016 2954688004
1017 2954697855
1018 2954704361
1019 2954716968
1020 2954726919
1021 2954734879
1022 2954745840
1023 2954753750
1024 2954764813
1025 2997608136
1026 3006321804
1027 3006399668
1028 3006501804
1029 8008559577
1030 8008579578
1031 8023629299
1032 8025419349
1033 8025533580
1034 8047898905
1035 8048127727
1036 8048360014
1037 8048375863
1038 8048382344
1039 8048409244
1040 8056833941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22234

Rv2466c-like

Mycothiol-dependent nitroreductase Rv2466c

39

228

0.96

PF01323

DSBA

DSBA-like thioredoxin domain

31

197

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9519 12 218
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9419 12 218
4wkw-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9287 10 218
4zil-assembly1.cif.gz_B crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state 0.9218 10 220
4wkw-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9152 10 218
ID Description Score Start End Superfamily
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9519 12 218 3.40.30.10
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9419 12 218 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8089 13 212 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7862 13 212 3.40.30.10
af_I1LNA7_556_742_3.40.30.120 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin; 0.7587 10 47 3.40.30.120
ID Description Score Start End GO Terms
AF-A0A6B3GP25-F1-model_v4 Disulfide bond formation protein DsbA 0.985 29 122
AF-A0A4U5X8L6-F1-model_v4 DsbA family protein 0.9793 10 220
AF-A0A1C6MN74-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9788 9 218
AF-A0A4V6AWK5-F1-model_v4 DsbA family protein 0.9773 10 220
AF-A0A0A8EQ36-F1-model_v4 Uncharacterized protein 0.9718 10 218

Map