F458440

General Info

Members Datasets Scaffolds Average Seq Length
519 387 1038 179

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0179969|Ga0466961_0179969_519_1148
Length 209
Sequence MLSAVRIISEAAELAARRHNGMARKGRGNEPYINHLAEVANRLAKATDGADAELVAAGWLHDVIEDTDTTRDELARTFSERVAALVVECTDDMTLPKAERRRLQVVDAPKKSASAKLIKIADKISNIGARINPDPASRSAMIWSIIQDGPSRLSPPVVAATLRWTGSSTIPSSLPGAPYDGRAADIDLYWRSCRCCIGCAWLQRTCSRR

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
124 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
125 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
126 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
257 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
262 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
263 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
264 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
265 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
266 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
267 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
268 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
269 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
270 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
271 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
272 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
273 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
274 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
275 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
276 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
277 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
278 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
279 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
280 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
281 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
282 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
283 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
284 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
285 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
286 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
287 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
288 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
289 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
290 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
291 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
292 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
293 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
294 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
295 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
296 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
297 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
298 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
299 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
300 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
301 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
302 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
303 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
304 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
305 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
306 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
307 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
308 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
309 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
310 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
311 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
312 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
313 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
314 2904699407
315 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
316 2922368715
317 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
318 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
319 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
320 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
321 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
322 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
323 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
324 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
325 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
326 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
327 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
328 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
329 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
330 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
331 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
332 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
333 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
334 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
335 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
336 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
337 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
338 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
339 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
340 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
341 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
342 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
343 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
344 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
345 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
346 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
347 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
348 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
349 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
350 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
351 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
352 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
353 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
354 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
355 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
356 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
357 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
358 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
359 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
360 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
361 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
362 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
363 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
364 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
365 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
366 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
367 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
368 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
369 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
370 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
371 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
372 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
373 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
374 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
375 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
376 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
377 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
378 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
379 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
380 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
381 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
382 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
383 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
384 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
385 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
386 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
387 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.6
Metatranscriptomes 0.19
Isolates 23.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.52
Nodule 20.04
Rhizoplane 7.51
Rhizosphere 50.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0179969 3300044693 Bacteria 1313
2 Ga0065165_1019150 3300005262 Bacteria 2454
3 Ga0070676_10429548 3300005328 Bacteria 925
4 Ga0070680_100005141 3300005336 Bacteria 9886
5 Ga0070682_100396195 3300005337 Bacteria 1043
6 Ga0070682_100571803 3300005337 Bacteria 888
7 Ga0070660_100063206 3300005339 Bacteria 2877
8 Ga0070660_100267952 3300005339 Bacteria 1395
9 Ga0070689_100157744 3300005340 Bacteria 1833
10 Ga0070691_10201868 3300005341 Bacteria 1045
11 Ga0070661_100151918 3300005344 Bacteria 1751
12 Ga0070668_100155128 3300005347 Bacteria 1854
13 Ga0070668_100235046 3300005347 Bacteria 1516
14 Ga0070668_100875501 3300005347 Bacteria 802
15 Ga0070668_100901166 3300005347 Bacteria 790
16 Ga0070669_100198704 3300005353 Bacteria 1577
17 Ga0070675_100163507 3300005354 Bacteria 1916
18 Ga0070671_100412987 3300005355 Bacteria 1155
19 Ga0070671_101377491 3300005355 Bacteria 623
20 Ga0070674_100024125 3300005356 Bacteria 3945
21 Ga0070659_100413606 3300005366 Bacteria 1140
22 Ga0070667_101112592 3300005367 Bacteria 738
23 Ga0070709_10409023 3300005434 Bacteria 1015
24 Ga0070663_100008516 3300005455 Bacteria 6314
25 Ga0070663_100265140 3300005455 Bacteria 1364
26 Ga0070663_100331118 3300005455 Bacteria 1227
27 Ga0070678_100164951 3300005456 Bacteria 1799
28 Ga0070678_100461277 3300005456 Bacteria 1115
29 Ga0070681_10094620 3300005458 Bacteria 2936
30 Ga0068867_100363833 3300005459 Bacteria 1210
31 Ga0068867_100777802 3300005459 Bacteria 852
32 Ga0070685_10466376 3300005466 Bacteria 888
33 Ga0070706_100360397 3300005467 Bacteria 1355
34 Ga0070698_100161423 3300005471 Bacteria 2185
35 Ga0070679_100079934 3300005530 Bacteria 3259
36 Ga0070684_100046744 3300005535 Bacteria 3750
37 Ga0070697_100286524 3300005536 Bacteria 1414
38 Ga0068853_100026423 3300005539 Bacteria 4874
39 Ga0068853_100781492 3300005539 Bacteria 914
40 Ga0068853_100882278 3300005539 Bacteria 859
41 Ga0068853_101459987 3300005539 Bacteria 662
42 Ga0070672_100447236 3300005543 Bacteria 1113
43 Ga0070672_100918328 3300005543 Bacteria 774
44 Ga0070686_100132633 3300005544 Bacteria 1725
45 Ga0070665_100100858 3300005548 Bacteria 2891
46 Ga0070665_100131661 3300005548 Bacteria 2503
47 Ga0070665_100490922 3300005548 Bacteria 1239
48 Ga0070665_100965293 3300005548 Bacteria 865
49 Ga0070665_101387741 3300005548 Bacteria 712
50 Ga0068855_100038094 3300005563 Bacteria 5714
51 Ga0068855_100882741 3300005563 Bacteria 946
52 Ga0068855_101280080 3300005563 Bacteria 760
53 Ga0070664_100171957 3300005564 Bacteria 1922
54 Ga0068857_100025776 3300005577 Bacteria 5177
55 Ga0068854_100125831 3300005578 Bacteria 1952
56 Ga0068856_100323070 3300005614 Bacteria 1561
57 Ga0068856_100462538 3300005614 Bacteria 1289
58 Ga0068856_100589509 3300005614 Bacteria 1133
59 Ga0070702_100276630 3300005615 Bacteria 1151
60 Ga0068852_100030155 3300005616 Bacteria 4462
61 Ga0068852_100188677 3300005616 Bacteria 1943
62 Ga0068852_100363639 3300005616 Bacteria 1416
63 Ga0068861_101171061 3300005719 Bacteria 742
64 Ga0068851_10006471 3300005834 Bacteria 5349
65 Ga0068863_100241989 3300005841 Bacteria 1742
66 Ga0068858_100468822 3300005842 Bacteria 1215
67 Ga0068860_101995173 3300005843 Bacteria 602
68 Ga0068862_100237880 3300005844 Bacteria 1654
69 Ga0081540_1062753 3300005983 Bacteria 1763
70 Ga0081540_1163381 3300005983 Bacteria 860
71 Ga0070717_11206514 3300006028 Bacteria 688
72 Ga0075365_10074124 3300006038 Bacteria 2295
73 Ga0075365_10103142 3300006038 Bacteria 1955
74 Ga0075363_100001410 3300006048 Bacteria 9093
75 Ga0075364_10561494 3300006051 Bacteria 780
76 Ga0075364_10564849 3300006051 Bacteria 778
77 Ga0070712_100243151 3300006175 Bacteria 1434
78 Ga0075367_10008466 3300006178 Bacteria 5330
79 Ga0075369_10132716 3300006186 Bacteria 1132
80 Ga0097621_100379278 3300006237 Bacteria 1263
81 Ga0075370_10029115 3300006353 Bacteria 3073
82 Ga0068871_100260839 3300006358 Bacteria 1511
83 Ga0068871_100301846 3300006358 Bacteria 1406
84 Ga0099823_1023273 3300006944 Bacteria 5681
85 Ga0105240_10025071 3300009093 Bacteria 7850
86 Ga0105240_10073053 3300009093 Bacteria 4237
87 Ga0105240_10122488 3300009093 Bacteria 3129
88 Ga0105245_10150293 3300009098 Bacteria 2201
89 Ga0105245_10326876 3300009098 Bacteria 1512
90 Ga0105247_10118877 3300009101 Bacteria 1710
91 Ga0105247_10191361 3300009101 Bacteria 1370
92 Ga0105241_10403215 3300009174 Bacteria 1200
93 Ga0105241_11006847 3300009174 Bacteria 780
94 Ga0105242_11088519 3300009176 Bacteria 812
95 Ga0105248_10673186 3300009177 Bacteria 1167
96 Ga0105248_11250062 3300009177 Bacteria 840
97 Ga0105237_10014802 3300009545 Bacteria 8141
98 Ga0105237_10017110 3300009545 Bacteria 7521
99 Ga0105237_10105484 3300009545 Bacteria 2809
100 Ga0105238_10001521 3300009551 Bacteria 23227
101 Ga0105238_10437958 3300009551 Bacteria 1303
102 Ga0105238_11612842 3300009551 Bacteria 679
103 Ga0105239_10059018 3300010375 Bacteria 4211
104 Ga0105239_10286303 3300010375 Bacteria 1855
105 Ga0105239_10494692 3300010375 Bacteria 1390
106 Ga0105239_10872232 3300010375 Bacteria 1032
107 Ga0105246_10512617 3300011119 Bacteria 1021
108 Ga0157370_10064495 3300013104 Bacteria 3468
109 Ga0157370_10225226 3300013104 Bacteria 1736
110 Ga0157369_10014713 3300013105 Bacteria 8827
111 Ga0157374_10410884 3300013296 Bacteria 1351
112 Ga0163162_10913450 3300013306 Bacteria 991
113 Ga0157372_11975150 3300013307 Bacteria 670
114 Ga0163163_10046845 3300014325 Bacteria 4247
115 Ga0163163_11376836 3300014325 Bacteria 767
116 Ga0157380_10513363 3300014326 Bacteria 1167
117 Ga0157379_10697726 3300014968 Bacteria 952
118 Ga0157376_10354198 3300014969 Bacteria 1406
119 Ga0157376_10786792 3300014969 Bacteria 963
120 Ga0209148_1000944 3300025254 Bacteria 19064
121 Ga0209233_1001163 3300025261 Bacteria 10659
122 Ga0209233_1027541 3300025261 Bacteria 1375
123 Ga0209455_1007845 3300025272 Bacteria 2965
124 Ga0209758_1001853 3300025297 Bacteria 23209
125 Ga0209758_1016012 3300025297 Bacteria 3834
126 Ga0209758_1062500 3300025297 Bacteria 1218
127 Ga0209256_1005602 3300025299 Bacteria 7133
128 Ga0209256_1051525 3300025299 Bacteria 992
129 Ga0207426_1034412 3300025302 Bacteria 1625
130 Ga0209257_1091455 3300025304 Bacteria 759
131 Ga0207688_10111489 3300025901 Bacteria 1588
132 Ga0207680_10553686 3300025903 Bacteria 821
133 Ga0207647_10016170 3300025904 Bacteria 5094
134 Ga0207647_10469259 3300025904 Bacteria 704
135 Ga0207699_10058549 3300025906 Bacteria 2305
136 Ga0207705_10876807 3300025909 Bacteria 696
137 Ga0207684_10321875 3300025910 Bacteria 1333
138 Ga0207654_10394779 3300025911 Bacteria 961
139 Ga0207707_10000706 3300025912 Bacteria 33199
140 Ga0207695_10000006 3300025913 Bacteria 1135309
141 Ga0207695_10032870 3300025913 Bacteria 5671
142 Ga0207695_10145477 3300025913 Bacteria 2315
143 Ga0207671_10003296 3300025914 Bacteria 16242
144 Ga0207660_10002043 3300025917 Bacteria 13422
145 Ga0207657_10004672 3300025919 Bacteria 14460
146 Ga0207652_10003935 3300025921 Bacteria 12151
147 Ga0207681_10387383 3300025923 Bacteria 1126
148 Ga0207644_10900729 3300025931 Bacteria 741
149 Ga0207690_10150765 3300025932 Bacteria 1723
150 Ga0207706_10249322 3300025933 Bacteria 1551
151 Ga0207686_10083041 3300025934 Bacteria 2096
152 Ga0207686_10255276 3300025934 Bacteria 1283
153 Ga0207709_10070549 3300025935 Bacteria 2216
154 Ga0207709_10866387 3300025935 Bacteria 732
155 Ga0207670_10202098 3300025936 Bacteria 1510
156 Ga0207669_10031977 3300025937 Bacteria 2948
157 Ga0207665_10506590 3300025939 Bacteria 933
158 Ga0207691_10187184 3300025940 Bacteria 1807
159 Ga0207711_10807392 3300025941 Bacteria 874
160 Ga0207661_10191699 3300025944 Bacteria 1792
161 Ga0207679_10085456 3300025945 Bacteria 2424
162 Ga0207667_10007733 3300025949 Bacteria 12851
163 Ga0207667_10582302 3300025949 Bacteria 1130
164 Ga0207712_10074342 3300025961 Bacteria 2454
165 Ga0207668_10006973 3300025972 Bacteria 6701
166 Ga0207668_10361037 3300025972 Bacteria 1217
167 Ga0207668_11118364 3300025972 Bacteria 706
168 Ga0207640_10351682 3300025981 Bacteria 1184
169 Ga0207640_10414409 3300025981 Bacteria 1101
170 Ga0207639_10124224 3300026041 Bacteria 2126
171 Ga0207639_10351959 3300026041 Bacteria 1316
172 Ga0207639_11437760 3300026041 Bacteria 647
173 Ga0207678_10007033 3300026067 Bacteria 9990
174 Ga0207678_10106371 3300026067 Bacteria 2393
175 Ga0207678_10746719 3300026067 Bacteria 863
176 Ga0207678_10942413 3300026067 Bacteria 764
177 Ga0207708_10101381 3300026075 Bacteria 2228
178 Ga0207702_10432309 3300026078 Bacteria 1274
179 Ga0207702_10523288 3300026078 Bacteria 1158
180 Ga0207702_10786825 3300026078 Bacteria 940
181 Ga0207648_10090589 3300026089 Bacteria 2672
182 Ga0207648_10697656 3300026089 Bacteria 940
183 Ga0207676_10261115 3300026095 Bacteria 1564
184 Ga0207674_10046693 3300026116 Bacteria 4445
185 Ga0207675_100810752 3300026118 Bacteria 950
186 Ga0207683_10304244 3300026121 Bacteria 1459
187 Ga0207698_10029276 3300026142 Bacteria 3942
188 Ga0207698_10504860 3300026142 Bacteria 1177
189 Ga0207698_11517549 3300026142 Bacteria 685
190 Ga0209389_1000039 3300027296 Bacteria 124545
191 Ga0209589_1000038 3300027357 Bacteria 127285
192 Ga0209489_100023 3300027361 Bacteria 198829
193 Ga0209489_100087 3300027361 Bacteria 124545
194 Ga0209700_100090 3300027363 Bacteria 124545
195 Ga0209179_1026896 3300027512 Bacteria 1157
196 Ga0209813_10024980 3300027866 Bacteria 1714
197 Ga0268266_10001364 3300028379 Bacteria 29475
198 Ga0268266_10033319 3300028379 Bacteria 4379
199 Ga0268266_10824591 3300028379 Bacteria 896
200 Ga0268265_10128250 3300028380 Bacteria 2103
201 Ga0265337_1004679 3300028556 Bacteria 5626
202 Ga0265326_10001084 3300028558 Bacteria 9692
203 Ga0265319_1004856 3300028563 Bacteria 6578
204 Ga0265334_10034125 3300028573 Bacteria 2020
205 Ga0265323_10001297 3300028653 Bacteria 12481
206 Ga0265322_10031991 3300028654 Bacteria 1501
207 Ga0265336_10000620 3300028666 Bacteria 19526
208 Ga0265338_10001434 3300028800 Bacteria 38730
209 Ga0265324_10002184 3300029957 Bacteria 10245
210 Ga0307509_10224940 3300031507 Bacteria 1685
211 Ga0307508_10129029 3300031616 Bacteria 2132
212 Ga0307510_10054119 3300033180 Bacteria 4210
213 Ga0307510_10105648 3300033180 Bacteria 2583
214 Ga0315911_1000005 3300033442 Bacteria 426255
215 Ga0373927_0003781 3300035695 Bacteria 10741
216 Ga0373947_0018352 3300035725 Bacteria 4026
217 Ga0372808_015401 3300036459 Bacteria 1093
218 Ga0373925_0060389 3300037068 Bacteria 2847
219 Ga0395899_0049253 3300037312 Bacteria 3133
220 Ga0395900_0003044 3300037418 Bacteria 18262
221 Ga0395900_0194094 3300037418 Bacteria 2058
222 Ga0395898_0003078 3300037466 Bacteria 18893
223 Ga0395905_0104481 3300037471 Bacteria 2659
224 Ga0395901_0022715 3300038443 Bacteria 6432
225 Ga0395901_0230464 3300038443 Bacteria 1934
226 Ga0436362_0220972 3300039453 Bacteria 5253
227 Ga0436362_1191051 3300039453 Bacteria 1141
228 Ga0451787_528066 3300041441 Bacteria 712
229 Ga0451833_0561817 3300041491 Bacteria 1153
230 Ga0451853_1322345 3300041512 Bacteria 915
231 Ga0495617_165738 3300046452 Bacteria 699
232 Ga0495592_0043578 3300046454 Bacteria 3357
233 Ga0495603_0026413 3300046455 Bacteria 3508
234 Ga0495603_0027767 3300046455 Bacteria 3414
235 Ga0495629_0003885 3300046459 Bacteria 11256
236 Ga0495629_0705419 3300046459 Bacteria 670
237 Ga0495638_0019535 3300046460 Bacteria 4483
238 Ga0495651_0026825 3300046462 Bacteria 4486
239 Ga0495653_0612110 3300046463 Bacteria 668
240 Ga0495606_0076424 3300046507 Bacteria 2093
241 Ga0495606_0433611 3300046507 Bacteria 677
242 Ga0495608_0308392 3300046511 Bacteria 979
243 Ga0495610_0080963 3300046512 Bacteria 1492
244 Ga0495618_0035880 3300046514 Bacteria 3112
245 Ga0495620_0054254 3300046515 Bacteria 1694
246 Ga0495628_0520104 3300046516 Bacteria 857
247 Ga0495643_0053818 3300046522 Bacteria 2156
248 Ga0495643_0143795 3300046522 Bacteria 1187
249 Ga0495644_0066016 3300046523 Bacteria 1359
250 Ga0495648_0001207 3300046524 Bacteria 25895
251 Ga0495648_0055521 3300046524 Bacteria 2387
252 Ga0495648_0154757 3300046524 Bacteria 1192
253 Ga0495652_0557005 3300046529 Bacteria 788
254 Ga0495640_0019349 3300046533 Bacteria 5027
255 Ga0495587_0335757 3300046536 Bacteria 843
256 Ga0495598_0104903 3300046537 Bacteria 940
257 Ga0495597_0027670 3300046542 Bacteria 2599
258 Ga0495645_0318804 3300046543 Bacteria 1010
259 Ga0495622_0033954 3300046557 Bacteria 2380
260 Ga0495622_0049422 3300046557 Bacteria 1952
261 Ga0495667_0332104 3300046559 Bacteria 961
262 Ga0495656_0008009 3300046615 Bacteria 3759
263 Ga0495668_0183593 3300046616 Bacteria 1146
264 Ga0495668_0353773 3300046616 Bacteria 806
265 Ga0495625_0052558 3300046660 Bacteria 2917
266 Ga0495625_0172256 3300046660 Bacteria 1445
267 Ga0495625_0213420 3300046660 Bacteria 1268
268 Ga0495635_0510112 3300046663 Bacteria 791
269 Ga0495661_0038077 3300046665 Bacteria 2999
270 Ga0495661_0199415 3300046665 Bacteria 1049
271 Ga0495657_0290050 3300046675 Bacteria 977
272 Ga0495599_0046793 3300046678 Bacteria 2712
273 Ga0495646_0169857 3300046680 Bacteria 1202
274 Ga0495658_0332785 3300046683 Bacteria 964
275 Ga0495669_0005120 3300046684 Bacteria 5455
276 Ga0495624_0261696 3300046690 Bacteria 1045
277 Ga0495649_0028321 3300046694 Bacteria 3105
278 Ga0495649_0348310 3300046694 Bacteria 749
279 Ga0495589_0082769 3300046794 Bacteria 1560
280 Ga0495600_0000832 3300046809 Bacteria 16425
281 Ga0495600_0133892 3300046809 Bacteria 1610
282 Ga0495660_0227519 3300046810 Bacteria 876
283 Ga0495581_0119377 3300047315 Bacteria 1534
284 Ga0495581_0440889 3300047315 Bacteria 759
285 Ga0495581_0577771 3300047315 Bacteria 651
286 Ga0495604_0010490 3300047317 Bacteria 7344
287 Ga0495604_0367612 3300047317 Bacteria 952
288 Ga0495676_0222941 3300047321 Bacteria 1298
289 Ga0495680_0257390 3300047322 Bacteria 1235
290 Ga0495687_005686 3300047443 Bacteria 7869
291 Ga0495677_0115282 3300047445 Bacteria 1023
292 Ga0495673_0052082 3300047469 Bacteria 1790
293 Ga0495673_0116210 3300047469 Bacteria 1064
294 Ga0495684_0084916 3300047471 Bacteria 2401
295 Ga0495686_0238978 3300047472 Bacteria 1025
296 Ga0495602_0399894 3300048088 Bacteria 980
297 Ga0495626_0235979 3300048091 Bacteria 738
298 Ga0496100_0137553 3300048903 Bacteria 1728
299 Ga0496100_0799227 3300048903 Bacteria 739
300 Ga0496101_0357721 3300048904 Bacteria 1148
301 Ga0496101_0416376 3300048904 Bacteria 1059
302 Ga0496102_0347329 3300048905 Bacteria 1397
303 Ga0496102_0435124 3300048905 Bacteria 1231
304 Ga0496102_0660593 3300048905 Bacteria 968
305 Ga0496102_0861939 3300048905 Bacteria 828
306 Ga0496102_0948710 3300048905 Bacteria 781
307 Ga0496104_0262848 3300048907 Bacteria 1638
308 Ga0496105_0107446 3300048908 Bacteria 2303
309 Ga0496105_0413109 3300048908 Bacteria 1069
310 Ga0496105_0427224 3300048908 Bacteria 1048
311 Ga0496105_0439215 3300048908 Bacteria 1031
312 Ga0496106_0158994 3300048909 Bacteria 1786
313 Ga0496106_0464242 3300048909 Bacteria 1017
314 Ga0496106_0656890 3300048909 Bacteria 837
315 Ga0496107_0143232 3300048910 Bacteria 1767
316 Ga0496107_0188578 3300048910 Bacteria 1532
317 Ga0496107_0269821 3300048910 Bacteria 1266
318 Ga0496107_0591479 3300048910 Bacteria 820
319 Ga0496108_0141180 3300048911 Bacteria 2075
320 Ga0496108_0750288 3300048911 Bacteria 844
321 Ga0496109_0140646 3300048912 Bacteria 2257
322 Ga0496110_0058619 3300048913 Bacteria 3391
323 Ga0496110_0382203 3300048913 Bacteria 1283
324 Ga0496111_0296413 3300048914 Bacteria 1199
325 Ga0496112_0338172 3300048915 Bacteria 1449
326 Ga0496112_0377807 3300048915 Bacteria 1358
327 Ga0496112_0649103 3300048915 Bacteria 985
328 Ga0496112_0722491 3300048915 Bacteria 923
329 Ga0496113_0522441 3300048916 Bacteria 953
330 Ga0496114_0356349 3300048917 Bacteria 1294
331 Ga0496114_0475345 3300048917 Bacteria 1106
332 Ga0496115_0029999 3300048918 Bacteria 4275
333 Ga0496115_0100912 3300048918 Bacteria 2366
334 Ga0496115_0333224 3300048918 Bacteria 1239
335 Ga0496115_0356483 3300048918 Bacteria 1192
336 Ga0496116_0177935 3300048919 Bacteria 1143
337 Ga0496118_0184317 3300048921 Bacteria 1257
338 Ga0496119_0016625 3300048922 Bacteria 5584
339 Ga0496119_0035070 3300048922 Bacteria 3293
340 Ga0496120_0012617 3300048923 Bacteria 5736
341 Ga0496120_0139495 3300048923 Bacteria 1232
342 Ga0496121_0024927 3300048924 Bacteria 5700
343 Ga0496121_0066148 3300048924 Bacteria 2936
344 Ga0496122_0277299 3300048925 Bacteria 919
345 Ga0496124_0080375 3300048927 Bacteria 2683
346 Ga0496126_0071815 3300048929 Bacteria 3080
347 Ga0496126_0089962 3300048929 Bacteria 2701
348 Ga0496126_0125076 3300048929 Bacteria 2226
349 Ga0496126_0227015 3300048929 Bacteria 1566
350 Ga0496126_0341203 3300048929 Bacteria 1227
351 Ga0495682_0050416 3300049460 Bacteria 1515
352 Ga0495682_0140629 3300049460 Bacteria 862
353 Ga0501039_0537093 3300049575 Bacteria 918
354 nmdc:mga03n38_58970_c1 3300050490 Bacteria 1741
355 nmdc:mga00v17_210556_c1 3300050491 Bacteria 1258
356 nmdc:mga00v17_314580_c1 3300050491 Bacteria 1017
357 nmdc:mga0yw44_28850_c1 3300050492 Bacteria 3197
358 nmdc:mga0yw44_52270_c1 3300050492 Bacteria 2476
359 nmdc:mga04h51_15963_c1 3300050495 Bacteria 2173
360 Ga0500578_0098299 3300053086 Bacteria 1854
361 Ga0500578_0141006 3300053086 Bacteria 1507
362 Ga0500643_000168 3300053087 Bacteria 64858
363 Ga0500646_0043653 3300053090 Bacteria 1270
364 Ga0500651_0061214 3300053093 Bacteria 2352
365 Ga0500566_0212098 3300053094 Bacteria 969
366 Ga0500566_0218926 3300053094 Bacteria 948
367 Ga0500566_0366552 3300053094 Bacteria 655
368 Ga0500555_003109 3300053103 Bacteria 4736
369 Ga0500569_001709 3300053109 Bacteria 4194
370 Ga0500572_000255 3300053111 Bacteria 19104
371 Ga0500572_018357 3300053111 Bacteria 1811
372 Ga0500594_0088751 3300053118 Bacteria 936
373 Ga0500595_078177 3300053119 Bacteria 972
374 Ga0500595_115635 3300053119 Bacteria 760
375 Ga0500614_027260 3300053123 Bacteria 1371
376 Ga0500652_032290 3300053131 Bacteria 2062
377 Ga0500655_018677 3300053133 Bacteria 1288
378 Ga0500559_0000299 3300053136 Bacteria 38041
379 Ga0500559_0127865 3300053136 Bacteria 1186
380 Ga0500559_0261064 3300053136 Bacteria 815
381 Ga0500568_0054363 3300053139 Bacteria 1566
382 Ga0500588_0077106 3300053146 Bacteria 1107
383 Ga0500590_180501 3300053148 Bacteria 917
384 Ga0500616_0070164 3300053153 Bacteria 1790
385 Ga0500622_0077056 3300053156 Bacteria 1675
386 Ga0500627_0228425 3300053158 Bacteria 829
387 Ga0500638_029142 3300053162 Bacteria 2654
388 Ga0500639_033573 3300053163 Bacteria 2712
389 Ga0500636_0000659 3300053177 Bacteria 18582
390 Ga0500611_160406 3300053727 Bacteria 622
391 Ga0500645_136650 3300053730 Bacteria 679
392 Ga0500609_001181 3300053731 Bacteria 3881
393 Ga0500596_022801 3300053735 Bacteria 947
394 Ga0500596_042465 3300053735 Bacteria 728
395 Ga0500599_000860 3300053736 Bacteria 3362
396 Ga0500601_000475 3300053737 Bacteria 6405
397 Ga0500661_055519 3300055283 Bacteria 711
398 2507505973 2507262055 Bacteria 8048963
399 2508540162 2508501009 Bacteria 7784016
400 2513638283 2513237094 Bacteria 8789602
401 2513649123 2513237095 Bacteria 8976980
402 2513700188 2513237102 Bacteria 7703324
403 2513716143 2513237104 Bacteria 10034502
404 2513861162 2513237137 Bacteria 9558895
405 2513877197 2513237139 Bacteria 8737671
406 2517889671 2517572143 Bacteria 9484767
407 2524440788 2524023205 Bacteria 8918781
408 2524533160 2524023228 Bacteria 10118060
409 2528850739 2528768022 Bacteria 10457665
410 2617347856 2617270735 Bacteria 9163226
411 2793061493 2791355196 Bacteria 7323613
412 2793070348 2791355197 Bacteria 8420563
413 2805916203 2802429603 Bacteria 8777136
414 2818240514 2816332527 Bacteria 8933356
415 2824603676 2824600985 Bacteria 8488197
416 2824610738 2824609381 Bacteria 8672835
417 2824625157 2824617872 Bacteria 8814715
418 2824630967 2824626560 Bacteria 8813858
419 2824642280 2824635225 Bacteria 8785348
420 2824648304 2824644064 Bacteria 8743947
421 2824666880 2824661429 Bacteria 9877870
422 2824699940 2824696289 Bacteria 8335049
423 2824719484 2824714736 Bacteria 8717648
424 2824729092 2824723954 Bacteria 8758240
425 2824776370 2824773399 Bacteria 8360218
426 2842044439 2842038055 Bacteria 8002051
427 2842051572 2842045827 Bacteria 8006841
428 2847939387 2847930680 Bacteria 9342022
429 2847941144 2847939898 Bacteria 8606328
430 2874616508 2874612657 Bacteria 8252029
431 2874622526 2874620515 Bacteria 8290088
432 2876763686 2876761206 Bacteria 10111113
433 2879087060 2879083081 Bacteria 8587928
434 2879104390 2879099564 Bacteria 10442239
435 2879133738 2879127579 Bacteria 8294491
436 2879148240 2879142872 Bacteria 8267021
437 2881369549 2881364244 Bacteria 7710352
438 2881669734 2881665667 Bacteria 8175609
439 2885367805 2885366525 Bacteria 8326213
440 2885412954 2885409591 Bacteria 9235467
441 2888387191 2888378607 Bacteria 9652610
442 2888421227 2888419890 Bacteria 7857137
443 2903750059 2903748898 Bacteria 9972761
444 2904671467 2904666416 Bacteria 8226587
445 2904692029 2904690495 Bacteria 9412302
446 2904707572
447 2908757308 2908756301 Bacteria 8864324
448 2922377366
449 2929622160 2929615660 Bacteria 9193770
450 2929630193 2929624759 Bacteria 9339455
451 2932787879 2932784394 Bacteria 9704911
452 2932807574 2932801729 Bacteria 7987968
453 2932817604 2932809354 Bacteria 9135765
454 2932826236 2932818245 Bacteria 9955613
455 2932835093 2932828146 Bacteria 9745859
456 2933584225 2933577622 Bacteria 9116884
457 2935614398 2935608549 Bacteria 8203142
458 2935620470 2935616580 Bacteria 9032984
459 2935632852 2935630451 Bacteria 8169952
460 2935640793 2935638405 Bacteria 10015038
461 2935670296 2935665750 Bacteria 9571747
462 2935679726 2935675223 Bacteria 9928132
463 2935687295 2935684952 Bacteria 9590419
464 2935696734 2935694250 Bacteria 9291695
465 2935709174 2935703347 Bacteria 10242284
466 2935718754 2935713505 Bacteria 9608509
467 2935728406 2935722832 Bacteria 9608746
468 2935736997 2935732158 Bacteria 9706831
469 2935746000 2935741537 Bacteria 9707219
470 2935753261 2935750917 Bacteria 9590372
471 2935766347 2935760218 Bacteria 9817913
472 2935770263 2935769743 Bacteria 7878163
473 2935786684 2935785616 Bacteria 7962367
474 2935794738 2935793552 Bacteria 8012592
475 2935809028 2935801545 Bacteria 9301974
476 2935813792 2935810662 Bacteria 9401221
477 2935826616 2935819856 Bacteria 8261050
478 2935832300 2935827899 Bacteria 10038562
479 2935844005 2935837841 Bacteria 9454360
480 2935851090 2935847175 Bacteria 8228321
481 2935862796 2935855204 Bacteria 9035059
482 2935864539 2935864058 Bacteria 9784707
483 2935875109 2935873716 Bacteria 9632195
484 2935913140 2935908558 Bacteria 8568796
485 2935922562 2935916978 Bacteria 9113783
486 2935930935 2935926038 Bacteria 8601059
487 2935939731 2935934488 Bacteria 8602579
488 2935946680 2935942939 Bacteria 8599779
489 2935956119 2935951376 Bacteria 8602333
490 2935965024 2935959822 Bacteria 7869783
491 2935972912 2935967501 Bacteria 8603075
492 2935999273 2935992306 Bacteria 9802711
493 2936005828 2936002035 Bacteria 9362176
494 2936039348 2936037263 Bacteria 9446081
495 2940559174 2940556831 Bacteria 9590747
496 2941508483 2941507105 Bacteria 8166816
497 2941516314 2941515067 Bacteria 8166720
498 2941524670 2941523033 Bacteria 8169134
499 2941541868 2941538514 Bacteria 9402094
500 3005475852 3005474847 Bacteria 9259049
501 3005711861 3005710791 Bacteria 7622528
502 3005719118 3005718088 Bacteria 8283608
503 8016517210 8016511872 Bacteria 9921665
504 8016527033 8016522445 Bacteria 8156687
505 8016532112 8016530956 Bacteria 8155261
506 8016556765 8016548790 Bacteria 8155074
507 8016565120 8016557553 Bacteria 8154380
508 8016570407 8016566248 Bacteria 8158151
509 8016582944 8016575299 Bacteria 8154085
510 8016602767 8016595262 Bacteria 8149947
511 8017059380 8017057580 Bacteria 10023680
512 8019531933 8019530166 Bacteria 8155624
513 8019576239 8019576017 Bacteria 10049540
514 8019607447 8019597564 Bacteria 10041141
515 8019611063 8019608314 Bacteria 10042931
516 8019651353 8019648815 Bacteria 10014479
517 8019693246 8019687851 Bacteria 8712826
518 8055743590 8055742211 Bacteria 9226248
519 8056974101 8056967851 Bacteria 9038162
520 Ga0466961_0179969
521 Ga0065165_1019150
522 Ga0070676_10429548
523 Ga0070680_100005141
524 Ga0070682_100396195
525 Ga0070682_100571803
526 Ga0070660_100063206
527 Ga0070660_100267952
528 Ga0070689_100157744
529 Ga0070691_10201868
530 Ga0070661_100151918
531 Ga0070668_100155128
532 Ga0070668_100235046
533 Ga0070668_100875501
534 Ga0070668_100901166
535 Ga0070669_100198704
536 Ga0070675_100163507
537 Ga0070671_100412987
538 Ga0070671_101377491
539 Ga0070674_100024125
540 Ga0070659_100413606
541 Ga0070667_101112592
542 Ga0070709_10409023
543 Ga0070663_100008516
544 Ga0070663_100265140
545 Ga0070663_100331118
546 Ga0070678_100164951
547 Ga0070678_100461277
548 Ga0070681_10094620
549 Ga0068867_100363833
550 Ga0068867_100777802
551 Ga0070685_10466376
552 Ga0070706_100360397
553 Ga0070698_100161423
554 Ga0070679_100079934
555 Ga0070684_100046744
556 Ga0070697_100286524
557 Ga0068853_100026423
558 Ga0068853_100781492
559 Ga0068853_100882278
560 Ga0068853_101459987
561 Ga0070672_100447236
562 Ga0070672_100918328
563 Ga0070686_100132633
564 Ga0070665_100100858
565 Ga0070665_100131661
566 Ga0070665_100490922
567 Ga0070665_100965293
568 Ga0070665_101387741
569 Ga0068855_100038094
570 Ga0068855_100882741
571 Ga0068855_101280080
572 Ga0070664_100171957
573 Ga0068857_100025776
574 Ga0068854_100125831
575 Ga0068856_100323070
576 Ga0068856_100462538
577 Ga0068856_100589509
578 Ga0070702_100276630
579 Ga0068852_100030155
580 Ga0068852_100188677
581 Ga0068852_100363639
582 Ga0068861_101171061
583 Ga0068851_10006471
584 Ga0068863_100241989
585 Ga0068858_100468822
586 Ga0068860_101995173
587 Ga0068862_100237880
588 Ga0081540_1062753
589 Ga0081540_1163381
590 Ga0070717_11206514
591 Ga0075365_10074124
592 Ga0075365_10103142
593 Ga0075363_100001410
594 Ga0075364_10561494
595 Ga0075364_10564849
596 Ga0070712_100243151
597 Ga0075367_10008466
598 Ga0075369_10132716
599 Ga0097621_100379278
600 Ga0075370_10029115
601 Ga0068871_100260839
602 Ga0068871_100301846
603 Ga0099823_1023273
604 Ga0105240_10025071
605 Ga0105240_10073053
606 Ga0105240_10122488
607 Ga0105245_10150293
608 Ga0105245_10326876
609 Ga0105247_10118877
610 Ga0105247_10191361
611 Ga0105241_10403215
612 Ga0105241_11006847
613 Ga0105242_11088519
614 Ga0105248_10673186
615 Ga0105248_11250062
616 Ga0105237_10014802
617 Ga0105237_10017110
618 Ga0105237_10105484
619 Ga0105238_10001521
620 Ga0105238_10437958
621 Ga0105238_11612842
622 Ga0105239_10059018
623 Ga0105239_10286303
624 Ga0105239_10494692
625 Ga0105239_10872232
626 Ga0105246_10512617
627 Ga0157370_10064495
628 Ga0157370_10225226
629 Ga0157369_10014713
630 Ga0157374_10410884
631 Ga0163162_10913450
632 Ga0157372_11975150
633 Ga0163163_10046845
634 Ga0163163_11376836
635 Ga0157380_10513363
636 Ga0157379_10697726
637 Ga0157376_10354198
638 Ga0157376_10786792
639 Ga0209148_1000944
640 Ga0209233_1001163
641 Ga0209233_1027541
642 Ga0209455_1007845
643 Ga0209758_1001853
644 Ga0209758_1016012
645 Ga0209758_1062500
646 Ga0209256_1005602
647 Ga0209256_1051525
648 Ga0207426_1034412
649 Ga0209257_1091455
650 Ga0207688_10111489
651 Ga0207680_10553686
652 Ga0207647_10016170
653 Ga0207647_10469259
654 Ga0207699_10058549
655 Ga0207705_10876807
656 Ga0207684_10321875
657 Ga0207654_10394779
658 Ga0207707_10000706
659 Ga0207695_10000006
660 Ga0207695_10032870
661 Ga0207695_10145477
662 Ga0207671_10003296
663 Ga0207660_10002043
664 Ga0207657_10004672
665 Ga0207652_10003935
666 Ga0207681_10387383
667 Ga0207644_10900729
668 Ga0207690_10150765
669 Ga0207706_10249322
670 Ga0207686_10083041
671 Ga0207686_10255276
672 Ga0207709_10070549
673 Ga0207709_10866387
674 Ga0207670_10202098
675 Ga0207669_10031977
676 Ga0207665_10506590
677 Ga0207691_10187184
678 Ga0207711_10807392
679 Ga0207661_10191699
680 Ga0207679_10085456
681 Ga0207667_10007733
682 Ga0207667_10582302
683 Ga0207712_10074342
684 Ga0207668_10006973
685 Ga0207668_10361037
686 Ga0207668_11118364
687 Ga0207640_10351682
688 Ga0207640_10414409
689 Ga0207639_10124224
690 Ga0207639_10351959
691 Ga0207639_11437760
692 Ga0207678_10007033
693 Ga0207678_10106371
694 Ga0207678_10746719
695 Ga0207678_10942413
696 Ga0207708_10101381
697 Ga0207702_10432309
698 Ga0207702_10523288
699 Ga0207702_10786825
700 Ga0207648_10090589
701 Ga0207648_10697656
702 Ga0207676_10261115
703 Ga0207674_10046693
704 Ga0207675_100810752
705 Ga0207683_10304244
706 Ga0207698_10029276
707 Ga0207698_10504860
708 Ga0207698_11517549
709 Ga0209389_1000039
710 Ga0209589_1000038
711 Ga0209489_100023
712 Ga0209489_100087
713 Ga0209700_100090
714 Ga0209179_1026896
715 Ga0209813_10024980
716 Ga0268266_10001364
717 Ga0268266_10033319
718 Ga0268266_10824591
719 Ga0268265_10128250
720 Ga0265337_1004679
721 Ga0265326_10001084
722 Ga0265319_1004856
723 Ga0265334_10034125
724 Ga0265323_10001297
725 Ga0265322_10031991
726 Ga0265336_10000620
727 Ga0265338_10001434
728 Ga0265324_10002184
729 Ga0307509_10224940
730 Ga0307508_10129029
731 Ga0307510_10054119
732 Ga0307510_10105648
733 Ga0315911_1000005
734 Ga0373927_0003781
735 Ga0373947_0018352
736 Ga0372808_015401
737 Ga0373925_0060389
738 Ga0395899_0049253
739 Ga0395900_0003044
740 Ga0395900_0194094
741 Ga0395898_0003078
742 Ga0395905_0104481
743 Ga0395901_0022715
744 Ga0395901_0230464
745 Ga0436362_0220972
746 Ga0436362_1191051
747 Ga0451787_528066
748 Ga0451833_0561817
749 Ga0451853_1322345
750 Ga0495617_165738
751 Ga0495592_0043578
752 Ga0495603_0026413
753 Ga0495603_0027767
754 Ga0495629_0003885
755 Ga0495629_0705419
756 Ga0495638_0019535
757 Ga0495651_0026825
758 Ga0495653_0612110
759 Ga0495606_0076424
760 Ga0495606_0433611
761 Ga0495608_0308392
762 Ga0495610_0080963
763 Ga0495618_0035880
764 Ga0495620_0054254
765 Ga0495628_0520104
766 Ga0495643_0053818
767 Ga0495643_0143795
768 Ga0495644_0066016
769 Ga0495648_0001207
770 Ga0495648_0055521
771 Ga0495648_0154757
772 Ga0495652_0557005
773 Ga0495640_0019349
774 Ga0495587_0335757
775 Ga0495598_0104903
776 Ga0495597_0027670
777 Ga0495645_0318804
778 Ga0495622_0033954
779 Ga0495622_0049422
780 Ga0495667_0332104
781 Ga0495656_0008009
782 Ga0495668_0183593
783 Ga0495668_0353773
784 Ga0495625_0052558
785 Ga0495625_0172256
786 Ga0495625_0213420
787 Ga0495635_0510112
788 Ga0495661_0038077
789 Ga0495661_0199415
790 Ga0495657_0290050
791 Ga0495599_0046793
792 Ga0495646_0169857
793 Ga0495658_0332785
794 Ga0495669_0005120
795 Ga0495624_0261696
796 Ga0495649_0028321
797 Ga0495649_0348310
798 Ga0495589_0082769
799 Ga0495600_0000832
800 Ga0495600_0133892
801 Ga0495660_0227519
802 Ga0495581_0119377
803 Ga0495581_0440889
804 Ga0495581_0577771
805 Ga0495604_0010490
806 Ga0495604_0367612
807 Ga0495676_0222941
808 Ga0495680_0257390
809 Ga0495687_005686
810 Ga0495677_0115282
811 Ga0495673_0052082
812 Ga0495673_0116210
813 Ga0495684_0084916
814 Ga0495686_0238978
815 Ga0495602_0399894
816 Ga0495626_0235979
817 Ga0496100_0137553
818 Ga0496100_0799227
819 Ga0496101_0357721
820 Ga0496101_0416376
821 Ga0496102_0347329
822 Ga0496102_0435124
823 Ga0496102_0660593
824 Ga0496102_0861939
825 Ga0496102_0948710
826 Ga0496104_0262848
827 Ga0496105_0107446
828 Ga0496105_0413109
829 Ga0496105_0427224
830 Ga0496105_0439215
831 Ga0496106_0158994
832 Ga0496106_0464242
833 Ga0496106_0656890
834 Ga0496107_0143232
835 Ga0496107_0188578
836 Ga0496107_0269821
837 Ga0496107_0591479
838 Ga0496108_0141180
839 Ga0496108_0750288
840 Ga0496109_0140646
841 Ga0496110_0058619
842 Ga0496110_0382203
843 Ga0496111_0296413
844 Ga0496112_0338172
845 Ga0496112_0377807
846 Ga0496112_0649103
847 Ga0496112_0722491
848 Ga0496113_0522441
849 Ga0496114_0356349
850 Ga0496114_0475345
851 Ga0496115_0029999
852 Ga0496115_0100912
853 Ga0496115_0333224
854 Ga0496115_0356483
855 Ga0496116_0177935
856 Ga0496118_0184317
857 Ga0496119_0016625
858 Ga0496119_0035070
859 Ga0496120_0012617
860 Ga0496120_0139495
861 Ga0496121_0024927
862 Ga0496121_0066148
863 Ga0496122_0277299
864 Ga0496124_0080375
865 Ga0496126_0071815
866 Ga0496126_0089962
867 Ga0496126_0125076
868 Ga0496126_0227015
869 Ga0496126_0341203
870 Ga0495682_0050416
871 Ga0495682_0140629
872 Ga0501039_0537093
873 nmdc:mga03n38_58970_c1
874 nmdc:mga00v17_210556_c1
875 nmdc:mga00v17_314580_c1
876 nmdc:mga0yw44_28850_c1
877 nmdc:mga0yw44_52270_c1
878 nmdc:mga04h51_15963_c1
879 Ga0500578_0098299
880 Ga0500578_0141006
881 Ga0500643_000168
882 Ga0500646_0043653
883 Ga0500651_0061214
884 Ga0500566_0212098
885 Ga0500566_0218926
886 Ga0500566_0366552
887 Ga0500555_003109
888 Ga0500569_001709
889 Ga0500572_000255
890 Ga0500572_018357
891 Ga0500594_0088751
892 Ga0500595_078177
893 Ga0500595_115635
894 Ga0500614_027260
895 Ga0500652_032290
896 Ga0500655_018677
897 Ga0500559_0000299
898 Ga0500559_0127865
899 Ga0500559_0261064
900 Ga0500568_0054363
901 Ga0500588_0077106
902 Ga0500590_180501
903 Ga0500616_0070164
904 Ga0500622_0077056
905 Ga0500627_0228425
906 Ga0500638_029142
907 Ga0500639_033573
908 Ga0500636_0000659
909 Ga0500611_160406
910 Ga0500645_136650
911 Ga0500609_001181
912 Ga0500596_022801
913 Ga0500596_042465
914 Ga0500599_000860
915 Ga0500601_000475
916 Ga0500661_055519
917 2507505973
918 2508540162
919 2513638283
920 2513649123
921 2513700188
922 2513716143
923 2513861162
924 2513877197
925 2517889671
926 2524440788
927 2524533160
928 2528850739
929 2617347856
930 2793061493
931 2793070348
932 2805916203
933 2818240514
934 2824603676
935 2824610738
936 2824625157
937 2824630967
938 2824642280
939 2824648304
940 2824666880
941 2824699940
942 2824719484
943 2824729092
944 2824776370
945 2842044439
946 2842051572
947 2847939387
948 2847941144
949 2874616508
950 2874622526
951 2876763686
952 2879087060
953 2879104390
954 2879133738
955 2879148240
956 2881369549
957 2881669734
958 2885367805
959 2885412954
960 2888387191
961 2888421227
962 2903750059
963 2904671467
964 2904692029
965 2904707572
966 2908757308
967 2922377366
968 2929622160
969 2929630193
970 2932787879
971 2932807574
972 2932817604
973 2932826236
974 2932835093
975 2933584225
976 2935614398
977 2935620470
978 2935632852
979 2935640793
980 2935670296
981 2935679726
982 2935687295
983 2935696734
984 2935709174
985 2935718754
986 2935728406
987 2935736997
988 2935746000
989 2935753261
990 2935766347
991 2935770263
992 2935786684
993 2935794738
994 2935809028
995 2935813792
996 2935826616
997 2935832300
998 2935844005
999 2935851090
1000 2935862796
1001 2935864539
1002 2935875109
1003 2935913140
1004 2935922562
1005 2935930935
1006 2935939731
1007 2935946680
1008 2935956119
1009 2935965024
1010 2935972912
1011 2935999273
1012 2936005828
1013 2936039348
1014 2940559174
1015 2941508483
1016 2941516314
1017 2941524670
1018 2941541868
1019 3005475852
1020 3005711861
1021 3005719118
1022 8016517210
1023 8016527033
1024 8016532112
1025 8016556765
1026 8016565120
1027 8016570407
1028 8016582944
1029 8016602767
1030 8017059380
1031 8019531933
1032 8019576239
1033 8019607447
1034 8019611063
1035 8019651353
1036 8019693246
1037 8055743590
1038 8056974101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13328

HD_4

HD domain

11

145

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vxa-assembly1.cif.gz_A structure of the human mesh1-nadph complex 0.9256 2 175
3nr1-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.9218 2 176
3nr1-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.9021 2 176
5vxa-assembly1.cif.gz_A structure of the human mesh1-nadph complex 0.9009 2 175
3nqw-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.8794 1 179
ID Description Score Start End Superfamily
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9224 5 175 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9164 7 172 1.10.3210.10
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9072 5 175 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8803 7 172 1.10.3210.10
af_P0AG24_2_190_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7309 4 175 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1G7X7K8-F1-model_v4 Very-short-patch-repair endonuclease 0.9967 1 179 GO:0004519
GO:0008893
AF-A0A1G7X7K8-F1-model_v4 Very-short-patch-repair endonuclease 0.9912 1 179 GO:0004519
GO:0008893
AF-A0A7C5ZWP4-F1-model_v4 Bifunctional (P)ppGpp synthetase/guanosine-3',5'-bis(Diphosphate) 3'-pyrophosphohydrolase 0.9611 2 177 GO:0008893
AF-A0A0N4T6P7-F1-model_v4 HD domain-containing protein 0.9553 4 128 GO:0008893
AF-A0A2N5NWT6-F1-model_v4 deleted 0.9551 8 128

Map