F458437

General Info

Members Datasets Scaffolds Average Seq Length
519 228 1038 284

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0182660|Ga0466969_0182660_31_885
Length 284
Sequence MPTISRRKFLHAASAVAAASAVTRIAHADPLGVPIGCQTWPVRQSIAKDFPGTLKQLAAAGFKSIEMCSPVGYADSGFGGLQKYSGAELRKIINDAGLTCVSSHYSMNELRKDQPARIAWAKEMGMTQMLVASLGGPKHPTTDDVKRAADEYNQIGERAHQAGITQGLHNEDFECSTTPDGKRVYDLLFELLDPRYVKFQFQVSNIQYGFDAAEYFTKYPGRFISMHVQGWSAPQKKIAAVGQDTLDWKKIFTAAKTGGIQNYFVEMDLPLMQASVPYLHQLQV

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
147 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.5
Rhizosphere 96.34
Stem 0
Stem Tuber 0
Unclassified 22.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0182660 3300044656 Bacteria 960
2 rootH2_10328943 3300003320 Bacteria 1335
3 rootH1_10307865 3300003323 Bacteria 2728
4 Ga0058863_10037519 3300004799 Unclassified 1747
5 Ga0065707_10279664 3300005295 Bacteria 1051
6 Ga0070676_10165993 3300005328 Bacteria 1424
7 Ga0070683_100104832 3300005329 Bacteria 2665
8 Ga0070683_100257449 3300005329 Bacteria 1660
9 Ga0070683_100325347 3300005329 Bacteria 1463
10 Ga0070666_10018221 3300005335 Bacteria 4512
11 Ga0070680_100059597 3300005336 Bacteria 3124
12 Ga0070682_100091395 3300005337 Unclassified 1992
13 Ga0070682_100127790 3300005337 Unclassified 1716
14 Ga0068868_100009551 3300005338 Bacteria 6992
15 Ga0068868_100057583 3300005338 Unclassified 3071
16 Ga0070660_100366532 3300005339 Bacteria 1188
17 Ga0070691_10006654 3300005341 Bacteria 5290
18 Ga0070661_100027500 3300005344 Bacteria 4096
19 Ga0070671_100233121 3300005355 Unclassified 1562
20 Ga0070659_100091817 3300005366 Unclassified 2434
21 Ga0070703_10001782 3300005406 Bacteria 6383
22 Ga0070703_10055878 3300005406 Bacteria 1276
23 Ga0070709_10045677 3300005434 Bacteria 2720
24 Ga0070709_10055134 3300005434 Unclassified 2509
25 Ga0070714_100000060 3300005435 Bacteria 100913
26 Ga0070714_100004520 3300005435 Bacteria 10489
27 Ga0070714_100250036 3300005435 Unclassified 1639
28 Ga0070713_100000118 3300005436 Bacteria 51698
29 Ga0070713_100024188 3300005436 Bacteria 4728
30 Ga0070713_100033366 3300005436 Bacteria 4122
31 Ga0070713_100236003 3300005436 Bacteria 1664
32 Ga0070713_100402533 3300005436 Bacteria 1278
33 Ga0070710_10009712 3300005437 Unclassified 4714
34 Ga0070701_10000500 3300005438 Bacteria 13424
35 Ga0070711_100000168 3300005439 Bacteria 35269
36 Ga0070711_100027842 3300005439 Bacteria 3714
37 Ga0070711_100243258 3300005439 Bacteria 1408
38 Ga0070705_100001280 3300005440 Bacteria 13561
39 Ga0070705_100024312 3300005440 Bacteria 3268
40 Ga0070705_100300491 3300005440 Unclassified 1150
41 Ga0070700_100019543 3300005441 Bacteria 3911
42 Ga0070694_100176238 3300005444 Bacteria 1578
43 Ga0070708_100019039 3300005445 Bacteria 5758
44 Ga0070708_100031458 3300005445 Bacteria 4593
45 Ga0070708_100056909 3300005445 Bacteria 3479
46 Ga0070708_100081117 3300005445 Bacteria 2936
47 Ga0070681_10000187 3300005458 Bacteria 47873
48 Ga0070681_10004638 3300005458 Bacteria 13124
49 Ga0070681_10045088 3300005458 Bacteria 4413
50 Ga0070681_10097425 3300005458 Unclassified 2888
51 Ga0070681_10381278 3300005458 Bacteria 1321
52 Ga0068867_100318522 3300005459 Bacteria 1288
53 Ga0070706_100006431 3300005467 Bacteria 11098
54 Ga0070706_100029898 3300005467 Bacteria 5018
55 Ga0070706_100055586 3300005467 Bacteria 3654
56 Ga0070707_100011641 3300005468 Bacteria 8208
57 Ga0070707_100070952 3300005468 Bacteria 3356
58 Ga0070707_100150619 3300005468 Bacteria 2265
59 Ga0070707_100191864 3300005468 Bacteria 1992
60 Ga0070698_100026285 3300005471 Bacteria 6060
61 Ga0070698_100052091 3300005471 Bacteria 4166
62 Ga0070699_100003868 3300005518 Bacteria 13237
63 Ga0070699_100005294 3300005518 Bacteria 11315
64 Ga0070699_100106947 3300005518 Bacteria 2454
65 Ga0070679_100012890 3300005530 Bacteria 8004
66 Ga0070679_100081536 3300005530 Bacteria 3224
67 Ga0070679_100113060 3300005530 Unclassified 2701
68 Ga0070684_100013330 3300005535 Bacteria 6624
69 Ga0070684_100084783 3300005535 Bacteria 2809
70 Ga0070684_100088861 3300005535 Bacteria 2746
71 Ga0070697_100000226 3300005536 Bacteria 46212
72 Ga0070697_100001061 3300005536 Bacteria 20778
73 Ga0070697_100050444 3300005536 Bacteria 3377
74 Ga0070697_100353018 3300005536 Unclassified 1270
75 Ga0068853_100067937 3300005539 Bacteria 3098
76 Ga0068853_100399322 3300005539 Bacteria 1286
77 Ga0070672_100104754 3300005543 Unclassified 2299
78 Ga0070686_100003915 3300005544 Bacteria 8188
79 Ga0070686_100376364 3300005544 Bacteria 1074
80 Ga0070695_100000559 3300005545 Bacteria 19707
81 Ga0070696_100019275 3300005546 Bacteria 4619
82 Ga0070693_100000144 3300005547 Bacteria 32168
83 Ga0070665_100121614 3300005548 Unclassified 2612
84 Ga0070665_100133525 3300005548 Bacteria 2484
85 Ga0070704_100017363 3300005549 Bacteria 4575
86 Ga0068855_100004537 3300005563 Bacteria 16961
87 Ga0068855_100007606 3300005563 Bacteria 13106
88 Ga0068855_100019542 3300005563 Bacteria 8138
89 Ga0068855_100032373 3300005563 Bacteria 6244
90 Ga0068855_100082825 3300005563 Bacteria 3718
91 Ga0068855_100240634 3300005563 Unclassified 2023
92 Ga0070664_100145063 3300005564 Unclassified 2093
93 Ga0068857_100002952 3300005577 Bacteria 14005
94 Ga0068857_100146217 3300005577 Unclassified 2139
95 Ga0068854_100061783 3300005578 Bacteria 2714
96 Ga0068854_100177844 3300005578 Bacteria 1660
97 Ga0068854_100236606 3300005578 Unclassified 1452
98 Ga0068856_100000072 3300005614 Bacteria 95094
99 Ga0068856_100010543 3300005614 Bacteria 8973
100 Ga0068856_100034573 3300005614 Bacteria 4950
101 Ga0068856_100043806 3300005614 Bacteria 4402
102 Ga0068856_100048932 3300005614 Unclassified 4166
103 Ga0068856_100110893 3300005614 Bacteria 2741
104 Ga0068856_100624334 3300005614 Unclassified 1098
105 Ga0070702_100134025 3300005615 Bacteria 1569
106 Ga0068852_100000057 3300005616 Bacteria 75410
107 Ga0068852_100004393 3300005616 Bacteria 9966
108 Ga0068852_100080623 3300005616 Bacteria 2886
109 Ga0068859_100064557 3300005617 Unclassified 3694
110 Ga0068866_10106250 3300005718 Unclassified 1558
111 Ga0068851_10041039 3300005834 Bacteria 2326
112 Ga0068851_10041691 3300005834 Bacteria 2309
113 Ga0068863_100008130 3300005841 Bacteria 10241
114 Ga0068863_100081916 3300005841 Unclassified 3057
115 Ga0068863_100888095 3300005841 Bacteria 891
116 Ga0068858_100008187 3300005842 Bacteria 10052
117 Ga0068858_100049666 3300005842 Unclassified 3884
118 Ga0068858_100228179 3300005842 Bacteria 1765
119 Ga0068860_100105417 3300005843 Unclassified 2692
120 Ga0068862_100236484 3300005844 Unclassified 1659
121 Ga0081455_10171139 3300005937 Unclassified 1654
122 Ga0070717_10001588 3300006028 Bacteria 15710
123 Ga0070717_10004202 3300006028 Bacteria 10386
124 Ga0070717_10022730 3300006028 Unclassified 4959
125 Ga0070717_10034041 3300006028 Bacteria 4115
126 Ga0070717_10107713 3300006028 Unclassified 2374
127 Ga0075432_10075894 3300006058 Bacteria 1213
128 Ga0070716_100001474 3300006173 Bacteria 10496
129 Ga0070716_100027403 3300006173 Bacteria 3061
130 Ga0070716_100096204 3300006173 Bacteria 1804
131 Ga0070716_100182690 3300006173 Bacteria 1378
132 Ga0070716_100213732 3300006173 Bacteria 1291
133 Ga0070712_100000110 3300006175 Bacteria 42794
134 Ga0070712_100003435 3300006175 Bacteria 9747
135 Ga0070712_100062977 3300006175 Unclassified 2624
136 Ga0070712_100065152 3300006175 Bacteria 2585
137 Ga0070712_100092705 3300006175 Unclassified 2215
138 Ga0070712_100320609 3300006175 Unclassified 1260
139 Ga0097621_100006951 3300006237 Bacteria 8056
140 Ga0097621_100066888 3300006237 Unclassified 2960
141 Ga0097621_100118627 3300006237 Bacteria 2243
142 Ga0068871_100003081 3300006358 Bacteria 11436
143 Ga0068871_100006579 3300006358 Bacteria 8236
144 Ga0068871_100171017 3300006358 Unclassified 1862
145 Ga0075428_100031757 3300006844 Bacteria 5833
146 Ga0075431_100441745 3300006847 Bacteria 1298
147 Ga0075433_10127793 3300006852 Bacteria 2257
148 Ga0075434_100000496 3300006871 Bacteria 29734
149 Ga0075434_100001926 3300006871 Bacteria 17999
150 Ga0075434_100009753 3300006871 Bacteria 8976
151 Ga0075434_100047635 3300006871 Bacteria 4254
152 Ga0068865_100081531 3300006881 Unclassified 2323
153 Ga0068865_100226311 3300006881 Unclassified 1465
154 Ga0075436_100007406 3300006914 Bacteria 7507
155 Ga0075436_100010687 3300006914 Bacteria 6296
156 Ga0075436_100031127 3300006914 Bacteria 3673
157 Ga0075436_100032560 3300006914 Bacteria 3593
158 Ga0075436_100033265 3300006914 Bacteria 3554
159 Ga0097620_100064559 3300006931 Unclassified 3694
160 Ga0075435_100001764 3300007076 Bacteria 14092
161 Ga0075435_100038836 3300007076 Bacteria 3797
162 Ga0075435_100125926 3300007076 Unclassified 2141
163 Ga0075435_100413198 3300007076 Bacteria 1162
164 Ga0075435_100494614 3300007076 Bacteria 1057
165 Ga0099794_10010021 3300007265 Bacteria 4012
166 Ga0099794_10024693 3300007265 Unclassified 2761
167 Ga0099795_10002935 3300007788 Bacteria 4130
168 Ga0105240_10000454 3300009093 Bacteria 75423
169 Ga0105240_10006399 3300009093 Bacteria 17315
170 Ga0105240_10008372 3300009093 Bacteria 14800
171 Ga0105240_10014538 3300009093 Bacteria 10745
172 Ga0105240_10015467 3300009093 Bacteria 10374
173 Ga0105240_10186291 3300009093 Unclassified 2444
174 Ga0105240_10668123 3300009093 Bacteria 1137
175 Ga0111539_10026068 3300009094 Bacteria 7157
176 Ga0105245_10028833 3300009098 Bacteria 4899
177 Ga0105245_10204178 3300009098 Unclassified 1899
178 Ga0114129_10765049 3300009147 Bacteria 1235
179 Ga0105241_10053532 3300009174 Bacteria 3087
180 Ga0105241_10092141 3300009174 Unclassified 2392
181 Ga0105242_10080113 3300009176 Bacteria 2729
182 Ga0105242_10256526 3300009176 Unclassified 1578
183 Ga0105248_10067384 3300009177 Bacteria 4019
184 Ga0105248_10096356 3300009177 Unclassified 3332
185 Ga0105237_10078300 3300009545 Unclassified 3295
186 Ga0105237_10435860 3300009545 Bacteria 1316
187 Ga0105238_10002254 3300009551 Bacteria 19428
188 Ga0105238_10320863 3300009551 Bacteria 1535
189 Ga0105249_10031496 3300009553 Bacteria 4797
190 Ga0105249_10284440 3300009553 Unclassified 1653
191 Ga0105239_10028962 3300010375 Bacteria 6087
192 Ga0105239_10132759 3300010375 Bacteria 2770
193 Ga0105239_10189317 3300010375 Unclassified 2303
194 Ga0157373_10074285 3300013100 Bacteria 2398
195 Ga0157371_10269788 3300013102 Bacteria 1228
196 Ga0157370_10000294 3300013104 Bacteria 63367
197 Ga0157370_10117143 3300013104 Bacteria 2488
198 Ga0157370_10432837 3300013104 Unclassified 1210
199 Ga0157369_10000244 3300013105 Bacteria 75434
200 Ga0157369_10009034 3300013105 Bacteria 11412
201 Ga0157369_10010525 3300013105 Bacteria 10530
202 Ga0157369_10155727 3300013105 Bacteria 2413
203 Ga0157369_10195100 3300013105 Bacteria 2127
204 Ga0157369_10209286 3300013105 Unclassified 2045
205 Ga0157369_10303845 3300013105 Unclassified 1659
206 Ga0157369_10310839 3300013105 Bacteria 1639
207 Ga0157369_10412747 3300013105 Bacteria 1400
208 Ga0157374_10010653 3300013296 Bacteria 7919
209 Ga0157374_10010654 3300013296 Bacteria 7918
210 Ga0157374_10025709 3300013296 Bacteria 5290
211 Ga0157374_10104111 3300013296 Bacteria 2724
212 Ga0157374_10147210 3300013296 Bacteria 2288
213 Ga0157378_10009064 3300013297 Bacteria 8660
214 Ga0157378_10057247 3300013297 Bacteria 3474
215 Ga0157378_10103327 3300013297 Bacteria 2603
216 Ga0157378_10136088 3300013297 Bacteria 2278
217 Ga0157378_10167972 3300013297 Bacteria 2056
218 Ga0163162_10145033 3300013306 Bacteria 2489
219 Ga0157372_10003967 3300013307 Bacteria 15902
220 Ga0157372_10004946 3300013307 Bacteria 14156
221 Ga0157372_10081767 3300013307 Bacteria 3656
222 Ga0157372_10225166 3300013307 Bacteria 2174
223 Ga0157372_10242196 3300013307 Unclassified 2093
224 Ga0157372_10254914 3300013307 Bacteria 2037
225 Ga0157372_10354697 3300013307 Bacteria 1709
226 Ga0157375_10171370 3300013308 Bacteria 2318
227 Ga0157375_10323475 3300013308 Bacteria 1707
228 Ga0157375_10325325 3300013308 Bacteria 1702
229 Ga0157375_10736201 3300013308 Unclassified 1138
230 Ga0163163_10071314 3300014325 Bacteria 3461
231 Ga0157379_10033441 3300014968 Unclassified 4586
232 Ga0157379_10113970 3300014968 Unclassified 2430
233 Ga0157379_10123487 3300014968 Bacteria 2330
234 Ga0157379_10141371 3300014968 Bacteria 2170
235 Ga0157379_10287950 3300014968 Unclassified 1496
236 Ga0157376_10000032 3300014969 Bacteria 167294
237 Ga0157376_10082715 3300014969 Bacteria 2759
238 Ga0157376_10101499 3300014969 Bacteria 2515
239 Ga0157376_10240844 3300014969 Bacteria 1685
240 Ga0224712_10169906 3300022467 Unclassified 977
241 Ga0224570_101057 3300022730 Unclassified 2161
242 Ga0224572_1000993 3300024225 Bacteria 3915
243 Ga0224572_1007234 3300024225 Bacteria 2030
244 Ga0228598_1003277 3300024227 Bacteria 3489
245 Ga0207656_10032669 3300025321 Bacteria 2162
246 Ga0207653_10000107 3300025885 Bacteria 59076
247 Ga0207692_10006658 3300025898 Unclassified 4697
248 Ga0207692_10007149 3300025898 Bacteria 4562
249 Ga0207642_10021786 3300025899 Unclassified 2530
250 Ga0207647_10003363 3300025904 Bacteria 11995
251 Ga0207647_10066087 3300025904 Unclassified 2194
252 Ga0207699_10003312 3300025906 Bacteria 7681
253 Ga0207699_10031521 3300025906 Unclassified 2977
254 Ga0207699_10039017 3300025906 Bacteria 2726
255 Ga0207699_10043102 3300025906 Bacteria 2620
256 Ga0207645_10074845 3300025907 Bacteria 2168
257 Ga0207705_10058508 3300025909 Unclassified 2780
258 Ga0207684_10000445 3300025910 Bacteria 54460
259 Ga0207684_10016084 3300025910 Bacteria 6426
260 Ga0207684_10082034 3300025910 Bacteria 2745
261 Ga0207684_10284963 3300025910 Bacteria 1425
262 Ga0207654_10289280 3300025911 Bacteria 1111
263 Ga0207707_10026388 3300025912 Bacteria 5078
264 Ga0207707_10268097 3300025912 Unclassified 1480
265 Ga0207695_10000570 3300025913 Bacteria 75451
266 Ga0207695_10007349 3300025913 Bacteria 14059
267 Ga0207695_10008906 3300025913 Bacteria 12493
268 Ga0207695_10009178 3300025913 Bacteria 12268
269 Ga0207695_10035594 3300025913 Bacteria 5397
270 Ga0207695_10124215 3300025913 Bacteria 2545
271 Ga0207695_10251881 3300025913 Unclassified 1665
272 Ga0207671_10038642 3300025914 Bacteria 3537
273 Ga0207671_10092598 3300025914 Bacteria 2279
274 Ga0207671_10146005 3300025914 Unclassified 1825
275 Ga0207671_10202461 3300025914 Unclassified 1551
276 Ga0207671_10206217 3300025914 Unclassified 1536
277 Ga0207693_10000353 3300025915 Bacteria 42212
278 Ga0207693_10002517 3300025915 Bacteria 15937
279 Ga0207693_10007255 3300025915 Bacteria 9123
280 Ga0207693_10007310 3300025915 Bacteria 9087
281 Ga0207693_10011640 3300025915 Bacteria 7117
282 Ga0207693_10040101 3300025915 Bacteria 3687
283 Ga0207693_10097834 3300025915 Bacteria 2301
284 Ga0207693_10231917 3300025915 Unclassified 1449
285 Ga0207663_10000671 3300025916 Bacteria 15122
286 Ga0207663_10024795 3300025916 Bacteria 3459
287 Ga0207663_10074829 3300025916 Bacteria 2196
288 Ga0207660_10115010 3300025917 Bacteria 2030
289 Ga0207649_10016866 3300025920 Bacteria 4131
290 Ga0207652_10013262 3300025921 Bacteria 6674
291 Ga0207652_10113548 3300025921 Bacteria 2405
292 Ga0207652_10260507 3300025921 Unclassified 1564
293 Ga0207646_10000842 3300025922 Bacteria 39742
294 Ga0207646_10002173 3300025922 Bacteria 23409
295 Ga0207646_10053146 3300025922 Bacteria 3624
296 Ga0207646_10248945 3300025922 Unclassified 1605
297 Ga0207694_10004856 3300025924 Bacteria 10440
298 Ga0207700_10000210 3300025928 Bacteria 34895
299 Ga0207700_10003334 3300025928 Bacteria 9315
300 Ga0207700_10060554 3300025928 Bacteria 2868
301 Ga0207700_10081565 3300025928 Bacteria 2526
302 Ga0207664_10000017 3300025929 Bacteria 230967
303 Ga0207664_10014897 3300025929 Bacteria 5629
304 Ga0207664_10068415 3300025929 Unclassified 2852
305 Ga0207664_10379972 3300025929 Unclassified 1254
306 Ga0207704_10022247 3300025938 Unclassified 3393
307 Ga0207704_10335540 3300025938 Bacteria 1172
308 Ga0207665_10000053 3300025939 Bacteria 73573
309 Ga0207665_10048464 3300025939 Bacteria 2852
310 Ga0207665_10054441 3300025939 Bacteria 2698
311 Ga0207665_10058248 3300025939 Bacteria 2611
312 Ga0207665_10117884 3300025939 Bacteria 1872
313 Ga0207665_10184145 3300025939 Bacteria 1514
314 Ga0207665_10425529 3300025939 Unclassified 1015
315 Ga0207691_10005128 3300025940 Bacteria 12642
316 Ga0207691_10128591 3300025940 Bacteria 2239
317 Ga0207711_10069407 3300025941 Unclassified 3055
318 Ga0207711_10129142 3300025941 Unclassified 2264
319 Ga0207711_10315325 3300025941 Bacteria 1444
320 Ga0207711_10572468 3300025941 Unclassified 1054
321 Ga0207689_10060272 3300025942 Unclassified 3121
322 Ga0207661_10121395 3300025944 Bacteria 2225
323 Ga0207661_10134151 3300025944 Unclassified 2125
324 Ga0207661_10193295 3300025944 Bacteria 1785
325 Ga0207667_10001828 3300025949 Bacteria 26767
326 Ga0207667_10018039 3300025949 Bacteria 7927
327 Ga0207667_10050704 3300025949 Bacteria 4378
328 Ga0207667_10077714 3300025949 Bacteria 3441
329 Ga0207667_10149383 3300025949 Bacteria 2405
330 Ga0207667_10154544 3300025949 Bacteria 2361
331 Ga0207640_10176472 3300025981 Bacteria 1597
332 Ga0207677_10045747 3300026023 Unclassified 2924
333 Ga0207677_10088141 3300026023 Bacteria 2249
334 Ga0207703_10004190 3300026035 Bacteria 11887
335 Ga0207703_10293580 3300026035 Unclassified 1480
336 Ga0207639_10034909 3300026041 Bacteria 3720
337 Ga0207639_10046754 3300026041 Bacteria 3267
338 Ga0207639_10583145 3300026041 Unclassified 1030
339 Ga0207708_10113863 3300026075 Bacteria 2102
340 Ga0207702_10000366 3300026078 Bacteria 51814
341 Ga0207702_10076938 3300026078 Unclassified 2884
342 Ga0207702_10123626 3300026078 Unclassified 2319
343 Ga0207702_10513182 3300026078 Bacteria 1169
344 Ga0207702_10525746 3300026078 Unclassified 1155
345 Ga0207641_10001205 3300026088 Bacteria 25890
346 Ga0207641_10034255 3300026088 Bacteria 4223
347 Ga0207641_10203140 3300026088 Bacteria 1828
348 Ga0207641_10222414 3300026088 Unclassified 1751
349 Ga0207641_10875350 3300026088 Bacteria 891
350 Ga0207676_10451604 3300026095 Bacteria 1212
351 Ga0207674_10000245 3300026116 Bacteria 67561
352 Ga0207674_10008755 3300026116 Bacteria 11651
353 Ga0207674_10061506 3300026116 Unclassified 3794
354 Ga0207675_100160150 3300026118 Unclassified 2146
355 Ga0207683_10118112 3300026121 Bacteria 2379
356 Ga0207683_10146407 3300026121 Bacteria 2130
357 Ga0207698_10000033 3300026142 Bacteria 110484
358 Ga0207698_10070569 3300026142 Bacteria 2768
359 Ga0207698_10106910 3300026142 Bacteria 2335
360 Ga0209588_1004615 3300027671 Unclassified 3898
361 Ga0207428_10317670 3300027907 Bacteria 1151
362 Ga0265354_1000071 3300028016 Bacteria 16863
363 Ga0265356_1000111 3300028017 Bacteria 13998
364 Ga0268266_10065986 3300028379 Bacteria 3129
365 Ga0268266_10086742 3300028379 Unclassified 2737
366 Ga0268266_10631886 3300028379 Bacteria 1030
367 Ga0268265_10218707 3300028380 Unclassified 1665
368 Ga0268264_10072168 3300028381 Unclassified 2927
369 Ga0265338_10006709 3300028800 Bacteria 14542
370 Ga0265338_10070827 3300028800 Bacteria 2987
371 Ga0265762_1001913 3300030760 Unclassified 3777
372 Ga0265762_1003447 3300030760 Bacteria 2834
373 Ga0265760_10026738 3300031090 Bacteria 1689
374 Ga0265760_10052431 3300031090 Unclassified 1230
375 Ga0265760_10058114 3300031090 Unclassified 1172
376 Ga0265325_10005171 3300031241 Bacteria 8113
377 Ga0265339_10016184 3300031249 Unclassified 4453
378 Ga0265316_10044825 3300031344 Unclassified 3515
379 Ga0265316_10257609 3300031344 Bacteria 1280
380 Ga0265316_10303139 3300031344 Bacteria 1163
381 Ga0265313_10009148 3300031595 Bacteria 6465
382 Ga0307510_10238537 3300033180 Bacteria 1315
383 Ga0373926_0002145 3300035083 Bacteria 6209
384 Ga0373923_0086422 3300035111 Unclassified 1367
385 Ga0373936_0001594 3300035113 Bacteria 8283
386 Ga0373936_0010109 3300035113 Unclassified 3565
387 Ga0373945_0026875 3300035116 Bacteria 2007
388 Ga0373954_0001349 3300035118 Bacteria 9888
389 Ga0373954_0054558 3300035118 Bacteria 1879
390 Ga0373954_0095267 3300035118 Unclassified 1433
391 Ga0373956_0010139 3300035119 Bacteria 3850
392 Ga0373956_0140255 3300035119 Bacteria 1134
393 Ga0373957_0022518 3300035120 Bacteria 2246
394 Ga0373943_0027175 3300035170 Bacteria 2686
395 Ga0373943_0223813 3300035170 Unclassified 1049
396 Ga0373946_0002501 3300035171 Bacteria 6491
397 Ga0373946_0002850 3300035171 Bacteria 6126
398 Ga0373924_0030839 3300035410 Bacteria 2151
399 Ga0373935_0001452 3300035692 Bacteria 13139
400 Ga0373935_0018862 3300035692 Unclassified 4205
401 Ga0373935_0188397 3300035692 Bacteria 1420
402 Ga0373927_0000230 3300035695 Bacteria 43996
403 Ga0373927_0001907 3300035695 Bacteria 15406
404 Ga0373927_0010455 3300035695 Bacteria 6186
405 Ga0373927_0042414 3300035695 Bacteria 2947
406 Ga0373933_0003934 3300035724 Bacteria 8199
407 Ga0373947_0001966 3300035725 Bacteria 12585
408 Ga0373947_0005727 3300035725 Bacteria 7247
409 Ga0373947_0007449 3300035725 Bacteria 6335
410 Ga0373937_0000082 3300036401 Bacteria 87971
411 Ga0373937_0042058 3300036401 Bacteria 4170
412 Ga0373937_0048376 3300036401 Bacteria 3893
413 Ga0373937_0158239 3300036401 Bacteria 2124
414 Ga0373937_0187397 3300036401 Bacteria 1943
415 Ga0373937_0192795 3300036401 Unclassified 1915
416 Ga0373937_0219268 3300036401 Bacteria 1791
417 Ga0373937_0268870 3300036401 Bacteria 1609
418 Ga0373925_0000105 3300037068 Bacteria 90042
419 Ga0373925_0000873 3300037068 Bacteria 27568
420 Ga0373925_0005959 3300037068 Bacteria 9032
421 Ga0373925_0019615 3300037068 Bacteria 4920
422 Ga0373925_0045003 3300037068 Bacteria 3278
423 Ga0395899_0305361 3300037312 Unclassified 1076
424 Ga0436364_1116354 3300037853 Bacteria 2290
425 Ga0436364_1164114 3300037853 Bacteria 1418
426 Ga0436365_1107063 3300039437 Bacteria 1966
427 Ga0436360_0507165 3300039438 Bacteria 1878
428 Ga0451577_0029083 3300042876 Bacteria 4996
429 Ga0466961_0125736 3300044693 Bacteria 1609
430 Ga0466963_0050085 3300044694 Bacteria 2764
431 Ga0453684_0173281 3300044712 Bacteria 2540
432 Ga0451576_0018870 3300045051 Bacteria 7539
433 Ga0451576_0132681 3300045051 Bacteria 2596
434 Ga0466967_0254282 3300045976 Bacteria 1679
435 Ga0495603_0134644 3300046455 Bacteria 1438
436 Ga0495629_0036894 3300046459 Bacteria 3448
437 Ga0495651_0011121 3300046462 Bacteria 6922
438 Ga0495580_0001996 3300046472 Bacteria 17956
439 Ga0495580_0002625 3300046472 Bacteria 15608
440 Ga0495580_0034905 3300046472 Unclassified 3618
441 Ga0495580_0136316 3300046472 Bacteria 1702
442 Ga0495580_0162047 3300046472 Bacteria 1548
443 Ga0495582_0000650 3300046473 Bacteria 19100
444 Ga0495582_0001904 3300046473 Bacteria 11730
445 Ga0495582_0057862 3300046473 Bacteria 2137
446 Ga0495664_0101991 3300046477 Bacteria 1729
447 Ga0495608_0082886 3300046511 Bacteria 2082
448 Ga0495628_0223603 3300046516 Unclassified 1413
449 Ga0495630_0032670 3300046517 Bacteria 3879
450 Ga0495630_0043386 3300046517 Bacteria 3360
451 Ga0495630_0114424 3300046517 Bacteria 2044
452 Ga0495652_0149170 3300046529 Bacteria 1829
453 Ga0495665_0002094 3300046531 Bacteria 10806
454 Ga0495665_0020830 3300046531 Unclassified 3522
455 Ga0495665_0262394 3300046531 Unclassified 888
456 Ga0495640_0022980 3300046533 Bacteria 4553
457 Ga0495587_0021048 3300046536 Bacteria 4022
458 Ga0495667_0031126 3300046559 Bacteria 3583
459 Ga0495634_0061132 3300046642 Bacteria 2505
460 Ga0495634_0153288 3300046642 Bacteria 1456
461 Ga0495635_0051485 3300046663 Bacteria 2837
462 Ga0495599_0112203 3300046678 Unclassified 1698
463 Ga0495623_0056092 3300046679 Bacteria 2481
464 Ga0495647_0007827 3300046681 Bacteria 3587
465 Ga0495658_0030470 3300046683 Bacteria 2929
466 Ga0495613_0229680 3300046689 Bacteria 1300
467 Ga0495624_0094439 3300046690 Bacteria 1844
468 Ga0495581_0010415 3300047315 Bacteria 5377
469 Ga0495604_0000235 3300047317 Bacteria 49754
470 Ga0495674_0149638 3300047319 Bacteria 1958
471 Ga0495674_0189714 3300047319 Unclassified 1709
472 Ga0495674_0386982 3300047319 Bacteria 1131
473 Ga0495676_0034427 3300047321 Bacteria 4251
474 Ga0495675_0338692 3300047444 Unclassified 887
475 Ga0495684_0003813 3300047471 Bacteria 11747
476 Ga0495684_0008107 3300047471 Bacteria 8121
477 Ga0495684_0076553 3300047471 Bacteria 2541
478 Ga0495684_0381000 3300047471 Unclassified 995
479 Ga0495602_0004006 3300048088 Bacteria 15346
480 Ga0495602_0024975 3300048088 Bacteria 5790
481 Ga0495602_0072585 3300048088 Bacteria 2934
482 Ga0495602_0097302 3300048088 Unclassified 2425
483 Ga0495602_0118107 3300048088 Unclassified 2140
484 Ga0496101_0100745 3300048904 Unclassified 2162
485 Ga0496103_0294817 3300048906 Bacteria 1043
486 Ga0496104_0003899 3300048907 Bacteria 12916
487 Ga0496105_0079654 3300048908 Bacteria 2705
488 Ga0496112_0029534 3300048915 Bacteria 5302
489 Ga0496113_0389800 3300048916 Bacteria 1118
490 Ga0496114_0005831 3300048917 Bacteria 9672
491 Ga0496114_0171636 3300048917 Bacteria 1890
492 Ga0496114_0269072 3300048917 Bacteria 1501
493 Ga0496114_0319922 3300048917 Bacteria 1371
494 Ga0496115_0002947 3300048918 Bacteria 12268
495 Ga0496115_0028603 3300048918 Bacteria 4370
496 Ga0496115_0226901 3300048918 Bacteria 1540
497 nmdc:mga09592_234334_c1 3300050508 Unclassified 1590
498 nmdc:mga06r32_403565_c1 3300050510 Bacteria 1349
499 nmdc:mga08y16_17150_c1 3300050511 Bacteria 7624
500 nmdc:mga08y16_453383_c1 3300050511 Bacteria 1308
501 nmdc:mga0n895_229690_c1 3300050512 Bacteria 1884
502 nmdc:mga0n895_23662_c1 3300050512 Bacteria 5777
503 nmdc:mga0n895_465_c1 3300050512 Bacteria 27165
504 nmdc:mga0n895_53515_c1 3300050512 Bacteria 3966
505 nmdc:mga0rr50_149856_c1 3300050513 Bacteria 1884
506 nmdc:mga0rr50_149902_c1 3300050513 Bacteria 1884
507 nmdc:mga0rr50_30057_c1 3300050513 Unclassified 3841
508 nmdc:mga0rr50_30784_c1 3300050513 Bacteria 3804
509 nmdc:mga0rr50_393_c1 3300050513 Bacteria 23808
510 nmdc:mga08x19_115980_c1 3300050514 Bacteria 1791
511 nmdc:mga08x19_208490_c1 3300050514 Bacteria 1341
512 nmdc:mga08x19_24089_c1 3300050514 Bacteria 3779
513 nmdc:mga08x19_28440_c1 3300050514 Bacteria 3502
514 nmdc:mga08x19_413676_c1 3300050514 Unclassified 947
515 nmdc:mga08x19_5157_c1 3300050514 Bacteria 7726
516 nmdc:mga08x19_6388_c1 3300050514 Bacteria 6976
517 nmdc:mga08x19_64160_c1 3300050514 Bacteria 2384
518 nmdc:mga0a205_20354_c1 3300050515 Bacteria 6258
519 nmdc:mga0a205_9363_c1 3300050515 Bacteria 8952
520 Ga0466969_0182660
521 rootH2_10328943
522 rootH1_10307865
523 Ga0058863_10037519
524 Ga0065707_10279664
525 Ga0070676_10165993
526 Ga0070683_100104832
527 Ga0070683_100257449
528 Ga0070683_100325347
529 Ga0070666_10018221
530 Ga0070680_100059597
531 Ga0070682_100091395
532 Ga0070682_100127790
533 Ga0068868_100009551
534 Ga0068868_100057583
535 Ga0070660_100366532
536 Ga0070691_10006654
537 Ga0070661_100027500
538 Ga0070671_100233121
539 Ga0070659_100091817
540 Ga0070703_10001782
541 Ga0070703_10055878
542 Ga0070709_10045677
543 Ga0070709_10055134
544 Ga0070714_100000060
545 Ga0070714_100004520
546 Ga0070714_100250036
547 Ga0070713_100000118
548 Ga0070713_100024188
549 Ga0070713_100033366
550 Ga0070713_100236003
551 Ga0070713_100402533
552 Ga0070710_10009712
553 Ga0070701_10000500
554 Ga0070711_100000168
555 Ga0070711_100027842
556 Ga0070711_100243258
557 Ga0070705_100001280
558 Ga0070705_100024312
559 Ga0070705_100300491
560 Ga0070700_100019543
561 Ga0070694_100176238
562 Ga0070708_100019039
563 Ga0070708_100031458
564 Ga0070708_100056909
565 Ga0070708_100081117
566 Ga0070681_10000187
567 Ga0070681_10004638
568 Ga0070681_10045088
569 Ga0070681_10097425
570 Ga0070681_10381278
571 Ga0068867_100318522
572 Ga0070706_100006431
573 Ga0070706_100029898
574 Ga0070706_100055586
575 Ga0070707_100011641
576 Ga0070707_100070952
577 Ga0070707_100150619
578 Ga0070707_100191864
579 Ga0070698_100026285
580 Ga0070698_100052091
581 Ga0070699_100003868
582 Ga0070699_100005294
583 Ga0070699_100106947
584 Ga0070679_100012890
585 Ga0070679_100081536
586 Ga0070679_100113060
587 Ga0070684_100013330
588 Ga0070684_100084783
589 Ga0070684_100088861
590 Ga0070697_100000226
591 Ga0070697_100001061
592 Ga0070697_100050444
593 Ga0070697_100353018
594 Ga0068853_100067937
595 Ga0068853_100399322
596 Ga0070672_100104754
597 Ga0070686_100003915
598 Ga0070686_100376364
599 Ga0070695_100000559
600 Ga0070696_100019275
601 Ga0070693_100000144
602 Ga0070665_100121614
603 Ga0070665_100133525
604 Ga0070704_100017363
605 Ga0068855_100004537
606 Ga0068855_100007606
607 Ga0068855_100019542
608 Ga0068855_100032373
609 Ga0068855_100082825
610 Ga0068855_100240634
611 Ga0070664_100145063
612 Ga0068857_100002952
613 Ga0068857_100146217
614 Ga0068854_100061783
615 Ga0068854_100177844
616 Ga0068854_100236606
617 Ga0068856_100000072
618 Ga0068856_100010543
619 Ga0068856_100034573
620 Ga0068856_100043806
621 Ga0068856_100048932
622 Ga0068856_100110893
623 Ga0068856_100624334
624 Ga0070702_100134025
625 Ga0068852_100000057
626 Ga0068852_100004393
627 Ga0068852_100080623
628 Ga0068859_100064557
629 Ga0068866_10106250
630 Ga0068851_10041039
631 Ga0068851_10041691
632 Ga0068863_100008130
633 Ga0068863_100081916
634 Ga0068863_100888095
635 Ga0068858_100008187
636 Ga0068858_100049666
637 Ga0068858_100228179
638 Ga0068860_100105417
639 Ga0068862_100236484
640 Ga0081455_10171139
641 Ga0070717_10001588
642 Ga0070717_10004202
643 Ga0070717_10022730
644 Ga0070717_10034041
645 Ga0070717_10107713
646 Ga0075432_10075894
647 Ga0070716_100001474
648 Ga0070716_100027403
649 Ga0070716_100096204
650 Ga0070716_100182690
651 Ga0070716_100213732
652 Ga0070712_100000110
653 Ga0070712_100003435
654 Ga0070712_100062977
655 Ga0070712_100065152
656 Ga0070712_100092705
657 Ga0070712_100320609
658 Ga0097621_100006951
659 Ga0097621_100066888
660 Ga0097621_100118627
661 Ga0068871_100003081
662 Ga0068871_100006579
663 Ga0068871_100171017
664 Ga0075428_100031757
665 Ga0075431_100441745
666 Ga0075433_10127793
667 Ga0075434_100000496
668 Ga0075434_100001926
669 Ga0075434_100009753
670 Ga0075434_100047635
671 Ga0068865_100081531
672 Ga0068865_100226311
673 Ga0075436_100007406
674 Ga0075436_100010687
675 Ga0075436_100031127
676 Ga0075436_100032560
677 Ga0075436_100033265
678 Ga0097620_100064559
679 Ga0075435_100001764
680 Ga0075435_100038836
681 Ga0075435_100125926
682 Ga0075435_100413198
683 Ga0075435_100494614
684 Ga0099794_10010021
685 Ga0099794_10024693
686 Ga0099795_10002935
687 Ga0105240_10000454
688 Ga0105240_10006399
689 Ga0105240_10008372
690 Ga0105240_10014538
691 Ga0105240_10015467
692 Ga0105240_10186291
693 Ga0105240_10668123
694 Ga0111539_10026068
695 Ga0105245_10028833
696 Ga0105245_10204178
697 Ga0114129_10765049
698 Ga0105241_10053532
699 Ga0105241_10092141
700 Ga0105242_10080113
701 Ga0105242_10256526
702 Ga0105248_10067384
703 Ga0105248_10096356
704 Ga0105237_10078300
705 Ga0105237_10435860
706 Ga0105238_10002254
707 Ga0105238_10320863
708 Ga0105249_10031496
709 Ga0105249_10284440
710 Ga0105239_10028962
711 Ga0105239_10132759
712 Ga0105239_10189317
713 Ga0157373_10074285
714 Ga0157371_10269788
715 Ga0157370_10000294
716 Ga0157370_10117143
717 Ga0157370_10432837
718 Ga0157369_10000244
719 Ga0157369_10009034
720 Ga0157369_10010525
721 Ga0157369_10155727
722 Ga0157369_10195100
723 Ga0157369_10209286
724 Ga0157369_10303845
725 Ga0157369_10310839
726 Ga0157369_10412747
727 Ga0157374_10010653
728 Ga0157374_10010654
729 Ga0157374_10025709
730 Ga0157374_10104111
731 Ga0157374_10147210
732 Ga0157378_10009064
733 Ga0157378_10057247
734 Ga0157378_10103327
735 Ga0157378_10136088
736 Ga0157378_10167972
737 Ga0163162_10145033
738 Ga0157372_10003967
739 Ga0157372_10004946
740 Ga0157372_10081767
741 Ga0157372_10225166
742 Ga0157372_10242196
743 Ga0157372_10254914
744 Ga0157372_10354697
745 Ga0157375_10171370
746 Ga0157375_10323475
747 Ga0157375_10325325
748 Ga0157375_10736201
749 Ga0163163_10071314
750 Ga0157379_10033441
751 Ga0157379_10113970
752 Ga0157379_10123487
753 Ga0157379_10141371
754 Ga0157379_10287950
755 Ga0157376_10000032
756 Ga0157376_10082715
757 Ga0157376_10101499
758 Ga0157376_10240844
759 Ga0224712_10169906
760 Ga0224570_101057
761 Ga0224572_1000993
762 Ga0224572_1007234
763 Ga0228598_1003277
764 Ga0207656_10032669
765 Ga0207653_10000107
766 Ga0207692_10006658
767 Ga0207692_10007149
768 Ga0207642_10021786
769 Ga0207647_10003363
770 Ga0207647_10066087
771 Ga0207699_10003312
772 Ga0207699_10031521
773 Ga0207699_10039017
774 Ga0207699_10043102
775 Ga0207645_10074845
776 Ga0207705_10058508
777 Ga0207684_10000445
778 Ga0207684_10016084
779 Ga0207684_10082034
780 Ga0207684_10284963
781 Ga0207654_10289280
782 Ga0207707_10026388
783 Ga0207707_10268097
784 Ga0207695_10000570
785 Ga0207695_10007349
786 Ga0207695_10008906
787 Ga0207695_10009178
788 Ga0207695_10035594
789 Ga0207695_10124215
790 Ga0207695_10251881
791 Ga0207671_10038642
792 Ga0207671_10092598
793 Ga0207671_10146005
794 Ga0207671_10202461
795 Ga0207671_10206217
796 Ga0207693_10000353
797 Ga0207693_10002517
798 Ga0207693_10007255
799 Ga0207693_10007310
800 Ga0207693_10011640
801 Ga0207693_10040101
802 Ga0207693_10097834
803 Ga0207693_10231917
804 Ga0207663_10000671
805 Ga0207663_10024795
806 Ga0207663_10074829
807 Ga0207660_10115010
808 Ga0207649_10016866
809 Ga0207652_10013262
810 Ga0207652_10113548
811 Ga0207652_10260507
812 Ga0207646_10000842
813 Ga0207646_10002173
814 Ga0207646_10053146
815 Ga0207646_10248945
816 Ga0207694_10004856
817 Ga0207700_10000210
818 Ga0207700_10003334
819 Ga0207700_10060554
820 Ga0207700_10081565
821 Ga0207664_10000017
822 Ga0207664_10014897
823 Ga0207664_10068415
824 Ga0207664_10379972
825 Ga0207704_10022247
826 Ga0207704_10335540
827 Ga0207665_10000053
828 Ga0207665_10048464
829 Ga0207665_10054441
830 Ga0207665_10058248
831 Ga0207665_10117884
832 Ga0207665_10184145
833 Ga0207665_10425529
834 Ga0207691_10005128
835 Ga0207691_10128591
836 Ga0207711_10069407
837 Ga0207711_10129142
838 Ga0207711_10315325
839 Ga0207711_10572468
840 Ga0207689_10060272
841 Ga0207661_10121395
842 Ga0207661_10134151
843 Ga0207661_10193295
844 Ga0207667_10001828
845 Ga0207667_10018039
846 Ga0207667_10050704
847 Ga0207667_10077714
848 Ga0207667_10149383
849 Ga0207667_10154544
850 Ga0207640_10176472
851 Ga0207677_10045747
852 Ga0207677_10088141
853 Ga0207703_10004190
854 Ga0207703_10293580
855 Ga0207639_10034909
856 Ga0207639_10046754
857 Ga0207639_10583145
858 Ga0207708_10113863
859 Ga0207702_10000366
860 Ga0207702_10076938
861 Ga0207702_10123626
862 Ga0207702_10513182
863 Ga0207702_10525746
864 Ga0207641_10001205
865 Ga0207641_10034255
866 Ga0207641_10203140
867 Ga0207641_10222414
868 Ga0207641_10875350
869 Ga0207676_10451604
870 Ga0207674_10000245
871 Ga0207674_10008755
872 Ga0207674_10061506
873 Ga0207675_100160150
874 Ga0207683_10118112
875 Ga0207683_10146407
876 Ga0207698_10000033
877 Ga0207698_10070569
878 Ga0207698_10106910
879 Ga0209588_1004615
880 Ga0207428_10317670
881 Ga0265354_1000071
882 Ga0265356_1000111
883 Ga0268266_10065986
884 Ga0268266_10086742
885 Ga0268266_10631886
886 Ga0268265_10218707
887 Ga0268264_10072168
888 Ga0265338_10006709
889 Ga0265338_10070827
890 Ga0265762_1001913
891 Ga0265762_1003447
892 Ga0265760_10026738
893 Ga0265760_10052431
894 Ga0265760_10058114
895 Ga0265325_10005171
896 Ga0265339_10016184
897 Ga0265316_10044825
898 Ga0265316_10257609
899 Ga0265316_10303139
900 Ga0265313_10009148
901 Ga0307510_10238537
902 Ga0373926_0002145
903 Ga0373923_0086422
904 Ga0373936_0001594
905 Ga0373936_0010109
906 Ga0373945_0026875
907 Ga0373954_0001349
908 Ga0373954_0054558
909 Ga0373954_0095267
910 Ga0373956_0010139
911 Ga0373956_0140255
912 Ga0373957_0022518
913 Ga0373943_0027175
914 Ga0373943_0223813
915 Ga0373946_0002501
916 Ga0373946_0002850
917 Ga0373924_0030839
918 Ga0373935_0001452
919 Ga0373935_0018862
920 Ga0373935_0188397
921 Ga0373927_0000230
922 Ga0373927_0001907
923 Ga0373927_0010455
924 Ga0373927_0042414
925 Ga0373933_0003934
926 Ga0373947_0001966
927 Ga0373947_0005727
928 Ga0373947_0007449
929 Ga0373937_0000082
930 Ga0373937_0042058
931 Ga0373937_0048376
932 Ga0373937_0158239
933 Ga0373937_0187397
934 Ga0373937_0192795
935 Ga0373937_0219268
936 Ga0373937_0268870
937 Ga0373925_0000105
938 Ga0373925_0000873
939 Ga0373925_0005959
940 Ga0373925_0019615
941 Ga0373925_0045003
942 Ga0395899_0305361
943 Ga0436364_1116354
944 Ga0436364_1164114
945 Ga0436365_1107063
946 Ga0436360_0507165
947 Ga0451577_0029083
948 Ga0466961_0125736
949 Ga0466963_0050085
950 Ga0453684_0173281
951 Ga0451576_0018870
952 Ga0451576_0132681
953 Ga0466967_0254282
954 Ga0495603_0134644
955 Ga0495629_0036894
956 Ga0495651_0011121
957 Ga0495580_0001996
958 Ga0495580_0002625
959 Ga0495580_0034905
960 Ga0495580_0136316
961 Ga0495580_0162047
962 Ga0495582_0000650
963 Ga0495582_0001904
964 Ga0495582_0057862
965 Ga0495664_0101991
966 Ga0495608_0082886
967 Ga0495628_0223603
968 Ga0495630_0032670
969 Ga0495630_0043386
970 Ga0495630_0114424
971 Ga0495652_0149170
972 Ga0495665_0002094
973 Ga0495665_0020830
974 Ga0495665_0262394
975 Ga0495640_0022980
976 Ga0495587_0021048
977 Ga0495667_0031126
978 Ga0495634_0061132
979 Ga0495634_0153288
980 Ga0495635_0051485
981 Ga0495599_0112203
982 Ga0495623_0056092
983 Ga0495647_0007827
984 Ga0495658_0030470
985 Ga0495613_0229680
986 Ga0495624_0094439
987 Ga0495581_0010415
988 Ga0495604_0000235
989 Ga0495674_0149638
990 Ga0495674_0189714
991 Ga0495674_0386982
992 Ga0495676_0034427
993 Ga0495675_0338692
994 Ga0495684_0003813
995 Ga0495684_0008107
996 Ga0495684_0076553
997 Ga0495684_0381000
998 Ga0495602_0004006
999 Ga0495602_0024975
1000 Ga0495602_0072585
1001 Ga0495602_0097302
1002 Ga0495602_0118107
1003 Ga0496101_0100745
1004 Ga0496103_0294817
1005 Ga0496104_0003899
1006 Ga0496105_0079654
1007 Ga0496112_0029534
1008 Ga0496113_0389800
1009 Ga0496114_0005831
1010 Ga0496114_0171636
1011 Ga0496114_0269072
1012 Ga0496114_0319922
1013 Ga0496115_0002947
1014 Ga0496115_0028603
1015 Ga0496115_0226901
1016 nmdc:mga09592_234334_c1
1017 nmdc:mga06r32_403565_c1
1018 nmdc:mga08y16_17150_c1
1019 nmdc:mga08y16_453383_c1
1020 nmdc:mga0n895_229690_c1
1021 nmdc:mga0n895_23662_c1
1022 nmdc:mga0n895_465_c1
1023 nmdc:mga0n895_53515_c1
1024 nmdc:mga0rr50_149856_c1
1025 nmdc:mga0rr50_149902_c1
1026 nmdc:mga0rr50_30057_c1
1027 nmdc:mga0rr50_30784_c1
1028 nmdc:mga0rr50_393_c1
1029 nmdc:mga08x19_115980_c1
1030 nmdc:mga08x19_208490_c1
1031 nmdc:mga08x19_24089_c1
1032 nmdc:mga08x19_28440_c1
1033 nmdc:mga08x19_413676_c1
1034 nmdc:mga08x19_5157_c1
1035 nmdc:mga08x19_6388_c1
1036 nmdc:mga08x19_64160_c1
1037 nmdc:mga0a205_20354_c1
1038 nmdc:mga0a205_9363_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

54

277

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8637 37 271
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8488 37 271
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.841 37 272
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8383 27 285
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8285 24 284
ID Description Score Start End Superfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7941 24 284 3.20.20.150
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.762 37 269 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.76 37 287 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7509 24 284 3.20.20.150
3dx5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7502 39 278 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9ZDK5-F1-model_v4 Xylose isomerase 0.9936 49 287 GO:0016853
AF-A0A2V7WTW8-F1-model_v4 Xylose isomerase 0.9899 49 255 GO:0016853
AF-A0A2V9ZDK5-F1-model_v4 Xylose isomerase 0.9895 49 287 GO:0016853
AF-A0A1Q8B116-F1-model_v4 Xylose isomerase 0.9861 87 287 GO:0016853
AF-A0A2V9IAU4-F1-model_v4 Xylose isomerase 0.9818 114 287 GO:0016853

Map