F458362

General Info

Members Datasets Scaffolds Average Seq Length
519 263 1038 168

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100523160|Ga0070687_1005231601
Length 196
Sequence MPQGALQGAGVDPVWYVRGFTLLTEDTMVLTKPELIGALQHEVHVLLHLTSKIDRSMLDYRPTPKQRSTLELLKYLTNMGPGLIQAAKTGTFDRERFMEASKIAEARDFDQTVAALAAHAEIYQSLLADMSDADFRTEIEMFGRKTTRGAFIVNMVLGGCAAYRTQLFLYLKACGRDELSTMNLWAGMDAPAPAAV

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 4.43
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 31.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100523160 3300005343 Unclassified 802
2 MRS1b_contig_1215545 2162886011 Unclassified 1188
3 MRS1b_contig_4449626 2162886011 Unclassified 987
4 JGI24744J21845_10055891 3300002077 Bacteria 725
5 JGI25406J46586_10009610 3300003203 Bacteria 4326
6 Ga0065714_10081544 3300005288 Bacteria 2367
7 Ga0065712_10000290 3300005290 Bacteria 14650
8 Ga0065712_10077725 3300005290 Unclassified 3450
9 Ga0065712_10134857 3300005290 Bacteria 1508
10 Ga0065712_10155787 3300005290 Bacteria 1336
11 Ga0065712_10168398 3300005290 Bacteria 1258
12 Ga0065712_10299710 3300005290 Bacteria 862
13 Ga0065715_10000217 3300005293 Bacteria 35543
14 Ga0065715_10004870 3300005293 Bacteria 5892
15 Ga0065715_10809880 3300005293 Unclassified 606
16 Ga0065707_10126929 3300005295 Bacteria 1992
17 Ga0065707_10215856 3300005295 Bacteria 1245
18 Ga0070658_10133718 3300005327 Bacteria 2068
19 Ga0070670_100011268 3300005331 Bacteria 7645
20 Ga0070670_100023032 3300005331 Bacteria 5358
21 Ga0070670_100083776 3300005331 Unclassified 2739
22 Ga0070670_100371853 3300005331 Bacteria 1258
23 Ga0070677_10226021 3300005333 Bacteria 917
24 Ga0068869_100485304 3300005334 Unclassified 1029
25 Ga0068869_101395085 3300005334 Bacteria 620
26 Ga0070680_100347591 3300005336 Bacteria 1261
27 Ga0070680_100602720 3300005336 Bacteria 943
28 Ga0068868_100793265 3300005338 Unclassified 854
29 Ga0070660_101151612 3300005339 Unclassified 657
30 Ga0070689_100009051 3300005340 Bacteria 7050
31 Ga0070687_100211981 3300005343 Bacteria 1181
32 Ga0070687_100238263 3300005343 Unclassified 1123
33 Ga0070661_100826769 3300005344 Unclassified 761
34 Ga0070668_100037638 3300005347 Bacteria 3695
35 Ga0070669_100043795 3300005353 Bacteria 3261
36 Ga0070669_101246444 3300005353 Unclassified 643
37 Ga0070675_100000464 3300005354 Bacteria 27701
38 Ga0070675_100199857 3300005354 Bacteria 1735
39 Ga0070675_100213506 3300005354 Unclassified 1678
40 Ga0070675_100246589 3300005354 Bacteria 1562
41 Ga0070675_100958857 3300005354 Unclassified 785
42 Ga0070671_100615134 3300005355 Bacteria 939
43 Ga0070674_100717342 3300005356 Unclassified 856
44 Ga0070673_100205666 3300005364 Unclassified 1697
45 Ga0070673_100283390 3300005364 Bacteria 1454
46 Ga0070673_101766417 3300005364 Archaea 586
47 Ga0070688_100054966 3300005365 Bacteria 2496
48 Ga0070688_100072161 3300005365 Bacteria 2212
49 Ga0070688_100123922 3300005365 Unclassified 1734
50 Ga0070659_100312948 3300005366 Unclassified 1311
51 Ga0070659_100533815 3300005366 Bacteria 1003
52 Ga0070703_10024797 3300005406 Unclassified 1775
53 Ga0070709_10038417 3300005434 Unclassified 2931
54 Ga0070701_10048254 3300005438 Unclassified 2196
55 Ga0070701_10148237 3300005438 Bacteria 1348
56 Ga0070701_10364995 3300005438 Unclassified 906
57 Ga0070701_10684871 3300005438 Unclassified 688
58 Ga0070705_100080180 3300005440 Bacteria 2002
59 Ga0070705_100327777 3300005440 Bacteria 1108
60 Ga0070705_100467770 3300005440 Bacteria 950
61 Ga0070700_100438995 3300005441 Unclassified 990
62 Ga0070700_100635710 3300005441 Bacteria 841
63 Ga0070700_100968671 3300005441 Unclassified 697
64 Ga0070694_100181155 3300005444 Archaea 1558
65 Ga0070694_100861644 3300005444 Unclassified 746
66 Ga0070694_101186907 3300005444 Unclassified 639
67 Ga0070708_100861217 3300005445 Unclassified 851
68 Ga0070678_100032586 3300005456 Bacteria 3608
69 Ga0070662_100195973 3300005457 Unclassified 1600
70 Ga0070662_100248789 3300005457 Bacteria 1428
71 Ga0070662_100415112 3300005457 Bacteria 1113
72 Ga0068867_100034189 3300005459 Bacteria 3684
73 Ga0068867_100969132 3300005459 Bacteria 769
74 Ga0070685_10035630 3300005466 Bacteria 2808
75 Ga0070685_10087608 3300005466 Unclassified 1879
76 Ga0070685_10670755 3300005466 Unclassified 753
77 Ga0070706_100340592 3300005467 Bacteria 1398
78 Ga0070684_100326608 3300005535 Bacteria 1410
79 Ga0070684_101039126 3300005535 Unclassified 769
80 Ga0070684_101199183 3300005535 Bacteria 714
81 Ga0068853_100187261 3300005539 Unclassified 1879
82 Ga0070672_100006840 3300005543 Bacteria 7700
83 Ga0070672_100240645 3300005543 Bacteria 1522
84 Ga0070672_100498155 3300005543 Unclassified 1054
85 Ga0070672_100600868 3300005543 Bacteria 958
86 Ga0070686_100162452 3300005544 Unclassified 1574
87 Ga0070695_100066698 3300005545 Bacteria 2346
88 Ga0070695_100204868 3300005545 Unclassified 1412
89 Ga0070665_100025339 3300005548 Bacteria 5977
90 Ga0070665_100168775 3300005548 Bacteria 2190
91 Ga0070665_102297491 3300005548 Unclassified 542
92 Ga0070704_100125050 3300005549 Unclassified 1983
93 Ga0070704_100702792 3300005549 Bacteria 897
94 Ga0070664_100035650 3300005564 Bacteria 4177
95 Ga0070664_100042723 3300005564 Bacteria 3826
96 Ga0070664_100192453 3300005564 Unclassified 1818
97 Ga0070664_101778434 3300005564 Bacteria 584
98 Ga0068857_100443031 3300005577 Unclassified 1213
99 Ga0070702_100789880 3300005615 Unclassified 733
100 Ga0068859_100015193 3300005617 Bacteria 7728
101 Ga0068859_100017315 3300005617 Bacteria 7237
102 Ga0068859_100474503 3300005617 Unclassified 1346
103 Ga0068859_101636083 3300005617 Unclassified 711
104 Ga0068864_100004319 3300005618 Bacteria 11680
105 Ga0068864_100419698 3300005618 Bacteria 1275
106 Ga0068866_10302207 3300005718 Bacteria 1000
107 Ga0068861_100064776 3300005719 Bacteria 2813
108 Ga0068861_100068257 3300005719 Bacteria 2747
109 Ga0068861_101011943 3300005719 Bacteria 794
110 Ga0068861_101376858 3300005719 Unclassified 688
111 Ga0068851_10096314 3300005834 Unclassified 1565
112 Ga0068870_10072984 3300005840 Unclassified 1876
113 Ga0068870_10076510 3300005840 Unclassified 1838
114 Ga0068870_10203016 3300005840 Bacteria 1203
115 Ga0068863_100025661 3300005841 Bacteria 5620
116 Ga0068863_100064791 3300005841 Bacteria 3456
117 Ga0068863_100206666 3300005841 Unclassified 1890
118 Ga0068863_101429328 3300005841 Unclassified 700
119 Ga0068858_100028654 3300005842 Bacteria 5171
120 Ga0068858_100050008 3300005842 Bacteria 3869
121 Ga0068860_100049857 3300005843 Bacteria 3987
122 Ga0068862_100134916 3300005844 Unclassified 2187
123 Ga0068862_100357042 3300005844 Bacteria 1357
124 Ga0068862_100406171 3300005844 Unclassified 1275
125 Ga0081455_10224994 3300005937 Bacteria 1388
126 Ga0081539_10000175 3300005985 Bacteria 150479
127 Ga0070717_10228360 3300006028 Unclassified 1638
128 Ga0097621_100120444 3300006237 Bacteria 2225
129 Ga0097621_100124782 3300006237 Unclassified 2186
130 Ga0097621_100214539 3300006237 Unclassified 1675
131 Ga0068871_100094100 3300006358 Unclassified 2501
132 Ga0068871_100147911 3300006358 Bacteria 2002
133 Ga0068871_100640565 3300006358 Bacteria 969
134 Ga0075428_100003709 3300006844 Bacteria 16730
135 Ga0075431_100338692 3300006847 Bacteria 1514
136 Ga0075433_10131124 3300006852 Bacteria 2227
137 Ga0075434_100085068 3300006871 Unclassified 3162
138 Ga0075434_100160760 3300006871 Unclassified 2266
139 Ga0075434_100398802 3300006871 Bacteria 1397
140 Ga0075429_100110985 3300006880 Unclassified 2397
141 Ga0075429_100654440 3300006880 Bacteria 920
142 Ga0075436_100794814 3300006914 Unclassified 704
143 Ga0097620_100015192 3300006931 Bacteria 7728
144 Ga0097620_100017315 3300006931 Bacteria 7237
145 Ga0097620_100474507 3300006931 Unclassified 1346
146 Ga0097620_101636157 3300006931 Unclassified 711
147 Ga0075435_100148138 3300007076 Unclassified 1972
148 Ga0075435_100193965 3300007076 Bacteria 1720
149 Ga0111539_10063887 3300009094 Unclassified 4356
150 Ga0111539_10107872 3300009094 Bacteria 3267
151 Ga0111539_10574170 3300009094 Bacteria 1313
152 Ga0111539_11505850 3300009094 Unclassified 780
153 Ga0105245_11788793 3300009098 Unclassified 667
154 Ga0105247_10089403 3300009101 Bacteria 1953
155 Ga0114129_10001076 3300009147 Bacteria 35909
156 Ga0114129_10303220 3300009147 Unclassified 2128
157 Ga0114129_10533198 3300009147 Bacteria 1529
158 Ga0105243_10183138 3300009148 Unclassified 1823
159 Ga0105243_10495056 3300009148 Unclassified 1157
160 Ga0105243_10936755 3300009148 Unclassified 864
161 Ga0105238_10019450 3300009551 Bacteria 6916
162 Ga0105249_10062028 3300009553 Bacteria 3432
163 Ga0105249_10523428 3300009553 Unclassified 1233
164 Ga0105249_10853853 3300009553 Bacteria 976
165 Ga0105239_10331338 3300010375 Unclassified 1717
166 Ga0157374_10373033 3300013296 Unclassified 1420
167 Ga0157374_11012967 3300013296 Bacteria 850
168 Ga0157378_10263744 3300013297 Bacteria 1654
169 Ga0157378_11511510 3300013297 Unclassified 716
170 Ga0163162_10802176 3300013306 Unclassified 1059
171 Ga0157375_10099942 3300013308 Bacteria 2981
172 Ga0157375_10372749 3300013308 Bacteria 1594
173 Ga0163163_11299556 3300014325 Bacteria 789
174 Ga0157380_10288517 3300014326 Bacteria 1505
175 Ga0157380_10554077 3300014326 Bacteria 1128
176 Ga0157377_10011260 3300014745 Unclassified 4459
177 Ga0157377_10028749 3300014745 Bacteria 2995
178 Ga0157377_10181725 3300014745 Bacteria 1323
179 Ga0157379_10654647 3300014968 Unclassified 984
180 Ga0157376_10246514 3300014969 Bacteria 1667
181 Ga0157376_10308745 3300014969 Unclassified 1500
182 Ga0163161_10018342 3300017792 Bacteria 4905
183 Ga0207673_1004363 3300025290 Bacteria 1690
184 Ga0207697_10000815 3300025315 Bacteria 17655
185 Ga0207697_10067550 3300025315 Unclassified 1495
186 Ga0207656_10039351 3300025321 Bacteria 1999
187 Ga0207682_10001982 3300025893 Bacteria 9274
188 Ga0207642_10087425 3300025899 Unclassified 1531
189 Ga0207688_10000479 3300025901 Bacteria 19142
190 Ga0207688_10641208 3300025901 Unclassified 670
191 Ga0207680_10035288 3300025903 Bacteria 2870
192 Ga0207680_10281548 3300025903 Bacteria 1155
193 Ga0207647_10115412 3300025904 Bacteria 1585
194 Ga0207647_10159121 3300025904 Bacteria 1318
195 Ga0207647_10234706 3300025904 Bacteria 1055
196 Ga0207645_10019762 3300025907 Bacteria 4413
197 Ga0207645_10025761 3300025907 Bacteria 3804
198 Ga0207643_10003702 3300025908 Bacteria 8225
199 Ga0207643_10018109 3300025908 Bacteria 3859
200 Ga0207643_10096944 3300025908 Bacteria 1725
201 Ga0207643_10130441 3300025908 Unclassified 1495
202 Ga0207643_10757142 3300025908 Unclassified 629
203 Ga0207660_10550720 3300025917 Bacteria 938
204 Ga0207662_10006459 3300025918 Bacteria 6330
205 Ga0207662_10015961 3300025918 Bacteria 4232
206 Ga0207662_10023415 3300025918 Bacteria 3548
207 Ga0207662_10070837 3300025918 Unclassified 2110
208 Ga0207649_10028171 3300025920 Bacteria 3305
209 Ga0207649_10167643 3300025920 Bacteria 1527
210 Ga0207649_10543813 3300025920 Unclassified 888
211 Ga0207646_10037976 3300025922 Bacteria 4340
212 Ga0207681_10003240 3300025923 Bacteria 10208
213 Ga0207681_10014008 3300025923 Bacteria 4971
214 Ga0207681_10019946 3300025923 Bacteria 4245
215 Ga0207681_10159575 3300025923 Bacteria 1698
216 Ga0207694_10031663 3300025924 Bacteria 4042
217 Ga0207650_10013569 3300025925 Bacteria 5643
218 Ga0207650_10070755 3300025925 Unclassified 2623
219 Ga0207650_10175010 3300025925 Bacteria 1708
220 Ga0207659_10000105 3300025926 Bacteria 50176
221 Ga0207659_10025771 3300025926 Bacteria 3957
222 Ga0207659_10093782 3300025926 Bacteria 2248
223 Ga0207659_10177906 3300025926 Bacteria 1683
224 Ga0207659_10257347 3300025926 Bacteria 1419
225 Ga0207659_10264476 3300025926 Unclassified 1401
226 Ga0207659_10523944 3300025926 Bacteria 1005
227 Ga0207644_10012063 3300025931 Bacteria 5732
228 Ga0207644_10545940 3300025931 Bacteria 959
229 Ga0207690_10298132 3300025932 Unclassified 1261
230 Ga0207690_10343641 3300025932 Bacteria 1178
231 Ga0207706_10005652 3300025933 Bacteria 11653
232 Ga0207706_10051871 3300025933 Bacteria 3621
233 Ga0207706_10075145 3300025933 Bacteria 2972
234 Ga0207706_10293396 3300025933 Bacteria 1417
235 Ga0207706_10493314 3300025933 Bacteria 1057
236 Ga0207686_10139694 3300025934 Bacteria 1672
237 Ga0207709_10626577 3300025935 Bacteria 854
238 Ga0207670_10005628 3300025936 Bacteria 6891
239 Ga0207670_10322231 3300025936 Bacteria 1216
240 Ga0207669_10017526 3300025937 Bacteria 3677
241 Ga0207704_10039400 3300025938 Bacteria 2751
242 Ga0207704_10083697 3300025938 Bacteria 2071
243 Ga0207704_10127762 3300025938 Bacteria 1754
244 Ga0207704_10188335 3300025938 Bacteria 1498
245 Ga0207704_10254852 3300025938 Unclassified 1320
246 Ga0207691_10006968 3300025940 Bacteria 10904
247 Ga0207691_10018325 3300025940 Bacteria 6631
248 Ga0207691_10095304 3300025940 Bacteria 2662
249 Ga0207691_10117259 3300025940 Bacteria 2362
250 Ga0207691_10173982 3300025940 Bacteria 1884
251 Ga0207691_10209149 3300025940 Unclassified 1695
252 Ga0207711_10184434 3300025941 Bacteria 1899
253 Ga0207689_10005872 3300025942 Bacteria 10875
254 Ga0207689_10244344 3300025942 Bacteria 1484
255 Ga0207679_10106931 3300025945 Unclassified 2200
256 Ga0207679_10419531 3300025945 Bacteria 1181
257 Ga0207679_10462752 3300025945 Bacteria 1126
258 Ga0207679_10508806 3300025945 Unclassified 1075
259 Ga0207679_10630169 3300025945 Unclassified 968
260 Ga0207651_10082131 3300025960 Unclassified 2325
261 Ga0207651_10588728 3300025960 Bacteria 971
262 Ga0207712_10008867 3300025961 Bacteria 6359
263 Ga0207712_10103524 3300025961 Unclassified 2121
264 Ga0207712_10317841 3300025961 Bacteria 1283
265 Ga0207668_10041124 3300025972 Bacteria 3123
266 Ga0207668_10214787 3300025972 Bacteria 1540
267 Ga0207658_11020756 3300025986 Unclassified 755
268 Ga0207658_11451417 3300025986 Bacteria 627
269 Ga0207677_10408731 3300026023 Unclassified 1153
270 Ga0207677_10671077 3300026023 Bacteria 917
271 Ga0207677_11906807 3300026023 Bacteria 552
272 Ga0207703_10011711 3300026035 Bacteria 6825
273 Ga0207703_10059723 3300026035 Bacteria 3115
274 Ga0207703_10084481 3300026035 Bacteria 2655
275 Ga0207703_10160765 3300026035 Bacteria 1967
276 Ga0207703_10920114 3300026035 Unclassified 838
277 Ga0207703_10963334 3300026035 Unclassified 818
278 Ga0207678_10186393 3300026067 Unclassified 1772
279 Ga0207678_10481834 3300026067 Unclassified 1080
280 Ga0207708_10002543 3300026075 Bacteria 13415
281 Ga0207708_10015226 3300026075 Bacteria 5766
282 Ga0207708_10043501 3300026075 Bacteria 3422
283 Ga0207708_10311190 3300026075 Unclassified 1283
284 Ga0207641_10020055 3300026088 Bacteria 5489
285 Ga0207641_10038624 3300026088 Unclassified 3991
286 Ga0207641_10042342 3300026088 Bacteria 3820
287 Ga0207641_10089161 3300026088 Bacteria 2695
288 Ga0207648_10002697 3300026089 Bacteria 18883
289 Ga0207648_10021813 3300026089 Bacteria 5754
290 Ga0207648_11041271 3300026089 Bacteria 767
291 Ga0207648_11637916 3300026089 Bacteria 605
292 Ga0207676_10064009 3300026095 Unclassified 2922
293 Ga0207676_10089364 3300026095 Bacteria 2524
294 Ga0207676_10132581 3300026095 Bacteria 2121
295 Ga0207676_10198138 3300026095 Bacteria 1772
296 Ga0207674_10012329 3300026116 Bacteria 9557
297 Ga0207674_10137826 3300026116 Unclassified 2401
298 Ga0207674_10212889 3300026116 Unclassified 1881
299 Ga0207675_100002997 3300026118 Bacteria 16581
300 Ga0207675_100028994 3300026118 Bacteria 5157
301 Ga0207675_100049541 3300026118 Bacteria 3920
302 Ga0207675_100121565 3300026118 Unclassified 2471
303 Ga0207675_100223620 3300026118 Bacteria 1814
304 Ga0207675_100301130 3300026118 Bacteria 1561
305 Ga0207675_100740831 3300026118 Unclassified 994
306 Ga0207683_10015268 3300026121 Bacteria 6537
307 Ga0207683_10101680 3300026121 Unclassified 2567
308 Ga0207683_10219420 3300026121 Bacteria 1732
309 Ga0207683_10392937 3300026121 Bacteria 1275
310 Ga0207698_10833980 3300026142 Bacteria 926
311 Ga0207698_11122243 3300026142 Unclassified 799
312 Ga0209968_1036951 3300027526 Bacteria 827
313 Ga0209974_10050553 3300027876 Unclassified 1396
314 Ga0207428_10000756 3300027907 Bacteria 36837
315 Ga0207428_10002002 3300027907 Bacteria 20654
316 Ga0268266_10021842 3300028379 Bacteria 5453
317 Ga0268265_10000499 3300028380 Bacteria 40655
318 Ga0268265_10005492 3300028380 Bacteria 8652
319 Ga0268265_10090970 3300028380 Bacteria 2439
320 Ga0268265_10109208 3300028380 Unclassified 2254
321 Ga0268265_10109585 3300028380 Unclassified 2251
322 Ga0268265_10313676 3300028380 Unclassified 1417
323 Ga0268265_10460565 3300028380 Unclassified 1190
324 Ga0268265_10791469 3300028380 Bacteria 923
325 Ga0268264_10004132 3300028381 Bacteria 12418
326 Ga0268264_10043214 3300028381 Bacteria 3734
327 Ga0268264_10339246 3300028381 Bacteria 1427
328 Ga0268264_11614323 3300028381 Bacteria 659
329 Ga0265330_10000392 3300031235 Bacteria 30137
330 Ga0265332_10000417 3300031238 Bacteria 30387
331 Ga0265320_10097230 3300031240 Unclassified 1358
332 Ga0265329_10003948 3300031242 Bacteria 6332
333 Ga0265316_10000039 3300031344 Bacteria 147384
334 Ga0307408_100100176 3300031548 Bacteria 2206
335 Ga0265314_10000016 3300031711 Bacteria 365251
336 Ga0265342_10000803 3300031712 Bacteria 31521
337 Ga0307405_10038548 3300031731 Bacteria 2882
338 Ga0307413_10100928 3300031824 Bacteria 1907
339 Ga0307410_10774753 3300031852 Bacteria 814
340 Ga0307406_10043517 3300031901 Bacteria 2809
341 Ga0307406_11089219 3300031901 Bacteria 689
342 Ga0307407_10121400 3300031903 Bacteria 1657
343 Ga0307407_10293779 3300031903 Bacteria 1130
344 Ga0307412_10012563 3300031911 Bacteria 4942
345 Ga0307412_10391320 3300031911 Bacteria 1129
346 Ga0307409_100146465 3300031995 Bacteria 2043
347 Ga0307416_100136932 3300032002 Bacteria 2217
348 Ga0307416_100243288 3300032002 Bacteria 1745
349 Ga0307415_100218706 3300032126 Bacteria 1525
350 Ga0373948_0065112 3300034817 Bacteria 807
351 Ga0373938_0057836 3300034957 Bacteria 900
352 Ga0373940_0029587 3300035088 Bacteria 1452
353 Ga0373944_0141946 3300035089 Bacteria 841
354 Ga0373923_0135231 3300035111 Unclassified 1111
355 Ga0373939_0063900 3300035114 Unclassified 1180
356 Ga0373945_0281239 3300035116 Bacteria 709
357 Ga0373956_0053866 3300035119 Unclassified 1812
358 Ga0373957_0152538 3300035120 Unclassified 949
359 Ga0373960_0027365 3300035121 Unclassified 1565
360 Ga0373960_0124951 3300035121 Bacteria 857
361 Ga0373943_0000741 3300035170 Bacteria 14242
362 Ga0373962_0024368 3300035242 Bacteria 1618
363 Ga0373962_0124773 3300035242 Bacteria 824
364 Ga0373924_0001971 3300035410 Bacteria 6827
365 Ga0373931_0055029 3300035691 Bacteria 2128
366 Ga0373931_0199716 3300035691 Bacteria 1194
367 Ga0373935_0034834 3300035692 Bacteria 3140
368 Ga0373935_0065985 3300035692 Bacteria 2324
369 Ga0373927_0005072 3300035695 Bacteria 9112
370 Ga0373933_0364607 3300035724 Unclassified 940
371 Ga0373947_0486319 3300035725 Bacteria 838
372 Ga0373937_0062097 3300036401 Unclassified 3435
373 Ga0373925_0083114 3300037068 Bacteria 2438
374 Ga0436363_0380610 3300039450 Bacteria 997
375 Ga0439453_0020770 3300041408 Bacteria 1179
376 Ga0451807_0016239 3300041486 Unclassified 1769
377 Ga0439435_0140807 3300042436 Bacteria 768
378 Ga0439464_0023829 3300042439 Unclassified 1691
379 Ga0451577_0017068 3300042876 Bacteria 6713
380 Ga0439440_0037252 3300042993 Unclassified 1174
381 Ga0453683_0373927 3300044673 Unclassified 917
382 Ga0453684_1324007 3300044712 Bacteria 750
383 Ga0451576_0054328 3300045051 Bacteria 4194
384 Ga0451576_0166102 3300045051 Bacteria 2303
385 Ga0451576_0341134 3300045051 Bacteria 1569
386 Ga0495603_0275312 3300046455 Bacteria 968
387 Ga0495603_0720961 3300046455 Unclassified 570
388 Ga0495629_0001987 3300046459 Bacteria 15914
389 Ga0495629_0126996 3300046459 Bacteria 1777
390 Ga0495580_0185148 3300046472 Bacteria 1437
391 Ga0495662_0150540 3300046476 Unclassified 1146
392 Ga0495608_0031931 3300046511 Bacteria 3559
393 Ga0495628_0135374 3300046516 Unclassified 1883
394 Ga0495642_0039901 3300046528 Bacteria 1906
395 Ga0495652_0421146 3300046529 Unclassified 941
396 Ga0495586_0177010 3300046535 Unclassified 1206
397 Ga0495598_0003615 3300046537 Bacteria 3298
398 Ga0495621_0010310 3300046539 Bacteria 2854
399 Ga0495645_0010513 3300046543 Bacteria 6490
400 Ga0495622_0095085 3300046557 Unclassified 1368
401 Ga0495622_0223865 3300046557 Bacteria 833
402 Ga0495633_0165765 3300046558 Bacteria 1019
403 Ga0495634_0169506 3300046642 Bacteria 1373
404 Ga0495634_0242897 3300046642 Unclassified 1104
405 Ga0495659_0014263 3300046664 Bacteria 2600
406 Ga0495658_0172537 3300046683 Bacteria 1339
407 Ga0495658_0447179 3300046683 Unclassified 825
408 Ga0495669_0001531 3300046684 Bacteria 9513
409 Ga0495669_0017704 3300046684 Bacteria 3059
410 Ga0495613_0019952 3300046689 Bacteria 4996
411 Ga0495613_0167985 3300046689 Bacteria 1558
412 Ga0495600_0157700 3300046809 Unclassified 1468
413 Ga0495604_0030016 3300047317 Unclassified 4323
414 Ga0495676_0099306 3300047321 Bacteria 2158
415 Ga0495676_0229502 3300047321 Bacteria 1276
416 Ga0495684_0000444 3300047471 Bacteria 33811
417 Ga0495593_0070848 3300047673 Bacteria 1811
418 Ga0496100_0046935 3300048903 Bacteria 2781
419 Ga0496100_0366282 3300048903 Bacteria 1092
420 Ga0496101_0102652 3300048904 Bacteria 2142
421 Ga0496102_0304425 3300048905 Unclassified 1502
422 Ga0496104_0004935 3300048907 Bacteria 11641
423 Ga0496104_1150217 3300048907 Bacteria 679
424 Ga0496105_0108495 3300048908 Bacteria 2292
425 Ga0496106_0185405 3300048909 Unclassified 1653
426 Ga0496106_0412892 3300048909 Unclassified 1085
427 Ga0496106_0854934 3300048909 Unclassified 720
428 Ga0496106_1038002 3300048909 Unclassified 644
429 Ga0496108_0012736 3300048911 Bacteria 6848
430 Ga0496109_0003266 3300048912 Bacteria 13526
431 Ga0496109_0487808 3300048912 Bacteria 1163
432 Ga0496109_0838503 3300048912 Unclassified 857
433 Ga0496110_0001690 3300048913 Bacteria 16202
434 Ga0496111_1109609 3300048914 Bacteria 563
435 Ga0496112_0002885 3300048915 Bacteria 13989
436 Ga0496112_0479937 3300048915 Bacteria 1180
437 Ga0496113_1214317 3300048916 Unclassified 588
438 Ga0496113_1278577 3300048916 Bacteria 571
439 Ga0496114_0000846 3300048917 Bacteria 22923
440 Ga0501032_0001292 3300049569 Bacteria 20077
441 Ga0501032_0309095 3300049569 Bacteria 1021
442 Ga0501033_0107908 3300049570 Unclassified 2028
443 Ga0501034_0001012 3300049571 Bacteria 40282
444 Ga0501034_0059188 3300049571 Bacteria 3848
445 Ga0501034_0441807 3300049571 Bacteria 1219
446 Ga0501034_0687326 3300049571 Bacteria 922
447 Ga0501036_0046341 3300049572 Bacteria 3681
448 Ga0501036_0436419 3300049572 Bacteria 1091
449 Ga0501036_1337094 3300049572 Unclassified 582
450 Ga0501037_0009984 3300049573 Bacteria 6963
451 Ga0501037_0944557 3300049573 Bacteria 563
452 Ga0501038_0064181 3300049574 Bacteria 3132
453 Ga0501039_0005899 3300049575 Bacteria 9277
454 Ga0501042_0263238 3300049578 Bacteria 1245
455 Ga0501043_0000888 3300049579 Bacteria 26531
456 Ga0501043_0185547 3300049579 Unclassified 1619
457 Ga0501043_0617189 3300049579 Bacteria 799
458 Ga0501046_0011779 3300049580 Bacteria 7466
459 Ga0501046_0059674 3300049580 Bacteria 2987
460 Ga0501047_0000928 3300049581 Bacteria 29951
461 Ga0501047_0005704 3300049581 Bacteria 11713
462 Ga0501047_0162533 3300049581 Bacteria 2104
463 Ga0501047_0213667 3300049581 Unclassified 1786
464 Ga0501048_0020035 3300049582 Bacteria 4906
465 Ga0501068_0052422 3300049584 Bacteria 2469
466 Ga0501068_0771660 3300049584 Unclassified 630
467 Ga0501071_0153465 3300049587 Unclassified 1719
468 Ga0501073_0006121 3300049589 Bacteria 8977
469 Ga0501073_0145010 3300049589 Bacteria 1645
470 Ga0501073_0179257 3300049589 Bacteria 1466
471 Ga0501075_0462162 3300049591 Bacteria 968
472 Ga0501076_0658266 3300049592 Unclassified 864
473 Ga0501077_0536990 3300049593 Unclassified 750
474 Ga0501079_0257917 3300049741 Unclassified 1363
475 Ga0501080_0005526 3300049742 Bacteria 11283
476 Ga0501081_0770540 3300049743 Bacteria 723
477 Ga0501083_0002195 3300049744 Bacteria 13342
478 Ga0501083_0058868 3300049744 Bacteria 2570
479 Ga0501083_0072068 3300049744 Bacteria 2296
480 Ga0501035_0016296 3300049822 Bacteria 6855
481 Ga0501035_0019769 3300049822 Bacteria 6187
482 Ga0501044_0002378 3300049823 Bacteria 21429
483 Ga0501044_0050870 3300049823 Bacteria 4274
484 Ga0501044_0179246 3300049823 Bacteria 2086
485 Ga0501045_1152597 3300049824 Unclassified 566
486 nmdc:mga00v17_130189_c1 3300050491 Bacteria 1607
487 nmdc:mga0k408_116603_c1 3300050493 Bacteria 1580
488 nmdc:mga06z11_116260_c1 3300050494 Unclassified 1487
489 nmdc:mga05p37_6058_c1 3300050507 Bacteria 14237
490 nmdc:mga05p37_72920_c1 3300050507 Unclassified 4225
491 nmdc:mga05p37_798792_c1 3300050507 Bacteria 1033
492 nmdc:mga09592_437848_c1 3300050508 Bacteria 1128
493 nmdc:mga09592_626104_c1 3300050508 Bacteria 920
494 nmdc:mga0qj67_149174_c1 3300050509 Unclassified 1897
495 nmdc:mga0qj67_209157_c1 3300050509 Bacteria 1585
496 nmdc:mga06r32_1508115_c1 3300050510 Unclassified 612
497 nmdc:mga06r32_214906_c1 3300050510 Bacteria 1911
498 nmdc:mga08y16_106914_c1 3300050511 Unclassified 2912
499 nmdc:mga08y16_15644_c1 3300050511 Bacteria 7978
500 nmdc:mga08y16_29420_c1 3300050511 Bacteria 5788
501 nmdc:mga08y16_388432_c1 3300050511 Bacteria 1430
502 nmdc:mga08y16_449857_c1 3300050511 Bacteria 1313
503 nmdc:mga08y16_675934_c1 3300050511 Bacteria 1034
504 nmdc:mga08y16_68007_c1 3300050511 Bacteria 3715
505 nmdc:mga0n895_3221_c1 3300050512 Bacteria 13071
506 nmdc:mga0n895_706517_c1 3300050512 Bacteria 1004
507 nmdc:mga0rr50_875117_c1 3300050513 Unclassified 766
508 nmdc:mga08x19_526620_c1 3300050514 Unclassified 835
509 nmdc:mga0a205_1435_c1 3300050515 Bacteria 20264
510 nmdc:mga0a205_363812_c1 3300050515 Unclassified 1313
511 nmdc:mga0a205_736163_c1 3300050515 Bacteria 835
512 nmdc:mga0a205_80342_c1 3300050515 Bacteria 3151
513 nmdc:mga0a205_912426_c1 3300050515 Unclassified 725
514 Ga0495619_0002582 3300053085 Bacteria 11831
515 Ga0501084_0018696 3300054114 Bacteria 5769
516 Ga0501082_0010491 3300060353 Bacteria 7971
517 Ga0501082_0141030 3300060353 Bacteria 2092
518 Ga0501082_0502104 3300060353 Bacteria 1060
519 Ga0501082_0633055 3300060353 Unclassified 936
520 Ga0070687_100523160
521 MRS1b_contig_1215545
522 MRS1b_contig_4449626
523 JGI24744J21845_10055891
524 JGI25406J46586_10009610
525 Ga0065714_10081544
526 Ga0065712_10000290
527 Ga0065712_10077725
528 Ga0065712_10134857
529 Ga0065712_10155787
530 Ga0065712_10168398
531 Ga0065712_10299710
532 Ga0065715_10000217
533 Ga0065715_10004870
534 Ga0065715_10809880
535 Ga0065707_10126929
536 Ga0065707_10215856
537 Ga0070658_10133718
538 Ga0070670_100011268
539 Ga0070670_100023032
540 Ga0070670_100083776
541 Ga0070670_100371853
542 Ga0070677_10226021
543 Ga0068869_100485304
544 Ga0068869_101395085
545 Ga0070680_100347591
546 Ga0070680_100602720
547 Ga0068868_100793265
548 Ga0070660_101151612
549 Ga0070689_100009051
550 Ga0070687_100211981
551 Ga0070687_100238263
552 Ga0070661_100826769
553 Ga0070668_100037638
554 Ga0070669_100043795
555 Ga0070669_101246444
556 Ga0070675_100000464
557 Ga0070675_100199857
558 Ga0070675_100213506
559 Ga0070675_100246589
560 Ga0070675_100958857
561 Ga0070671_100615134
562 Ga0070674_100717342
563 Ga0070673_100205666
564 Ga0070673_100283390
565 Ga0070673_101766417
566 Ga0070688_100054966
567 Ga0070688_100072161
568 Ga0070688_100123922
569 Ga0070659_100312948
570 Ga0070659_100533815
571 Ga0070703_10024797
572 Ga0070709_10038417
573 Ga0070701_10048254
574 Ga0070701_10148237
575 Ga0070701_10364995
576 Ga0070701_10684871
577 Ga0070705_100080180
578 Ga0070705_100327777
579 Ga0070705_100467770
580 Ga0070700_100438995
581 Ga0070700_100635710
582 Ga0070700_100968671
583 Ga0070694_100181155
584 Ga0070694_100861644
585 Ga0070694_101186907
586 Ga0070708_100861217
587 Ga0070678_100032586
588 Ga0070662_100195973
589 Ga0070662_100248789
590 Ga0070662_100415112
591 Ga0068867_100034189
592 Ga0068867_100969132
593 Ga0070685_10035630
594 Ga0070685_10087608
595 Ga0070685_10670755
596 Ga0070706_100340592
597 Ga0070684_100326608
598 Ga0070684_101039126
599 Ga0070684_101199183
600 Ga0068853_100187261
601 Ga0070672_100006840
602 Ga0070672_100240645
603 Ga0070672_100498155
604 Ga0070672_100600868
605 Ga0070686_100162452
606 Ga0070695_100066698
607 Ga0070695_100204868
608 Ga0070665_100025339
609 Ga0070665_100168775
610 Ga0070665_102297491
611 Ga0070704_100125050
612 Ga0070704_100702792
613 Ga0070664_100035650
614 Ga0070664_100042723
615 Ga0070664_100192453
616 Ga0070664_101778434
617 Ga0068857_100443031
618 Ga0070702_100789880
619 Ga0068859_100015193
620 Ga0068859_100017315
621 Ga0068859_100474503
622 Ga0068859_101636083
623 Ga0068864_100004319
624 Ga0068864_100419698
625 Ga0068866_10302207
626 Ga0068861_100064776
627 Ga0068861_100068257
628 Ga0068861_101011943
629 Ga0068861_101376858
630 Ga0068851_10096314
631 Ga0068870_10072984
632 Ga0068870_10076510
633 Ga0068870_10203016
634 Ga0068863_100025661
635 Ga0068863_100064791
636 Ga0068863_100206666
637 Ga0068863_101429328
638 Ga0068858_100028654
639 Ga0068858_100050008
640 Ga0068860_100049857
641 Ga0068862_100134916
642 Ga0068862_100357042
643 Ga0068862_100406171
644 Ga0081455_10224994
645 Ga0081539_10000175
646 Ga0070717_10228360
647 Ga0097621_100120444
648 Ga0097621_100124782
649 Ga0097621_100214539
650 Ga0068871_100094100
651 Ga0068871_100147911
652 Ga0068871_100640565
653 Ga0075428_100003709
654 Ga0075431_100338692
655 Ga0075433_10131124
656 Ga0075434_100085068
657 Ga0075434_100160760
658 Ga0075434_100398802
659 Ga0075429_100110985
660 Ga0075429_100654440
661 Ga0075436_100794814
662 Ga0097620_100015192
663 Ga0097620_100017315
664 Ga0097620_100474507
665 Ga0097620_101636157
666 Ga0075435_100148138
667 Ga0075435_100193965
668 Ga0111539_10063887
669 Ga0111539_10107872
670 Ga0111539_10574170
671 Ga0111539_11505850
672 Ga0105245_11788793
673 Ga0105247_10089403
674 Ga0114129_10001076
675 Ga0114129_10303220
676 Ga0114129_10533198
677 Ga0105243_10183138
678 Ga0105243_10495056
679 Ga0105243_10936755
680 Ga0105238_10019450
681 Ga0105249_10062028
682 Ga0105249_10523428
683 Ga0105249_10853853
684 Ga0105239_10331338
685 Ga0157374_10373033
686 Ga0157374_11012967
687 Ga0157378_10263744
688 Ga0157378_11511510
689 Ga0163162_10802176
690 Ga0157375_10099942
691 Ga0157375_10372749
692 Ga0163163_11299556
693 Ga0157380_10288517
694 Ga0157380_10554077
695 Ga0157377_10011260
696 Ga0157377_10028749
697 Ga0157377_10181725
698 Ga0157379_10654647
699 Ga0157376_10246514
700 Ga0157376_10308745
701 Ga0163161_10018342
702 Ga0207673_1004363
703 Ga0207697_10000815
704 Ga0207697_10067550
705 Ga0207656_10039351
706 Ga0207682_10001982
707 Ga0207642_10087425
708 Ga0207688_10000479
709 Ga0207688_10641208
710 Ga0207680_10035288
711 Ga0207680_10281548
712 Ga0207647_10115412
713 Ga0207647_10159121
714 Ga0207647_10234706
715 Ga0207645_10019762
716 Ga0207645_10025761
717 Ga0207643_10003702
718 Ga0207643_10018109
719 Ga0207643_10096944
720 Ga0207643_10130441
721 Ga0207643_10757142
722 Ga0207660_10550720
723 Ga0207662_10006459
724 Ga0207662_10015961
725 Ga0207662_10023415
726 Ga0207662_10070837
727 Ga0207649_10028171
728 Ga0207649_10167643
729 Ga0207649_10543813
730 Ga0207646_10037976
731 Ga0207681_10003240
732 Ga0207681_10014008
733 Ga0207681_10019946
734 Ga0207681_10159575
735 Ga0207694_10031663
736 Ga0207650_10013569
737 Ga0207650_10070755
738 Ga0207650_10175010
739 Ga0207659_10000105
740 Ga0207659_10025771
741 Ga0207659_10093782
742 Ga0207659_10177906
743 Ga0207659_10257347
744 Ga0207659_10264476
745 Ga0207659_10523944
746 Ga0207644_10012063
747 Ga0207644_10545940
748 Ga0207690_10298132
749 Ga0207690_10343641
750 Ga0207706_10005652
751 Ga0207706_10051871
752 Ga0207706_10075145
753 Ga0207706_10293396
754 Ga0207706_10493314
755 Ga0207686_10139694
756 Ga0207709_10626577
757 Ga0207670_10005628
758 Ga0207670_10322231
759 Ga0207669_10017526
760 Ga0207704_10039400
761 Ga0207704_10083697
762 Ga0207704_10127762
763 Ga0207704_10188335
764 Ga0207704_10254852
765 Ga0207691_10006968
766 Ga0207691_10018325
767 Ga0207691_10095304
768 Ga0207691_10117259
769 Ga0207691_10173982
770 Ga0207691_10209149
771 Ga0207711_10184434
772 Ga0207689_10005872
773 Ga0207689_10244344
774 Ga0207679_10106931
775 Ga0207679_10419531
776 Ga0207679_10462752
777 Ga0207679_10508806
778 Ga0207679_10630169
779 Ga0207651_10082131
780 Ga0207651_10588728
781 Ga0207712_10008867
782 Ga0207712_10103524
783 Ga0207712_10317841
784 Ga0207668_10041124
785 Ga0207668_10214787
786 Ga0207658_11020756
787 Ga0207658_11451417
788 Ga0207677_10408731
789 Ga0207677_10671077
790 Ga0207677_11906807
791 Ga0207703_10011711
792 Ga0207703_10059723
793 Ga0207703_10084481
794 Ga0207703_10160765
795 Ga0207703_10920114
796 Ga0207703_10963334
797 Ga0207678_10186393
798 Ga0207678_10481834
799 Ga0207708_10002543
800 Ga0207708_10015226
801 Ga0207708_10043501
802 Ga0207708_10311190
803 Ga0207641_10020055
804 Ga0207641_10038624
805 Ga0207641_10042342
806 Ga0207641_10089161
807 Ga0207648_10002697
808 Ga0207648_10021813
809 Ga0207648_11041271
810 Ga0207648_11637916
811 Ga0207676_10064009
812 Ga0207676_10089364
813 Ga0207676_10132581
814 Ga0207676_10198138
815 Ga0207674_10012329
816 Ga0207674_10137826
817 Ga0207674_10212889
818 Ga0207675_100002997
819 Ga0207675_100028994
820 Ga0207675_100049541
821 Ga0207675_100121565
822 Ga0207675_100223620
823 Ga0207675_100301130
824 Ga0207675_100740831
825 Ga0207683_10015268
826 Ga0207683_10101680
827 Ga0207683_10219420
828 Ga0207683_10392937
829 Ga0207698_10833980
830 Ga0207698_11122243
831 Ga0209968_1036951
832 Ga0209974_10050553
833 Ga0207428_10000756
834 Ga0207428_10002002
835 Ga0268266_10021842
836 Ga0268265_10000499
837 Ga0268265_10005492
838 Ga0268265_10090970
839 Ga0268265_10109208
840 Ga0268265_10109585
841 Ga0268265_10313676
842 Ga0268265_10460565
843 Ga0268265_10791469
844 Ga0268264_10004132
845 Ga0268264_10043214
846 Ga0268264_10339246
847 Ga0268264_11614323
848 Ga0265330_10000392
849 Ga0265332_10000417
850 Ga0265320_10097230
851 Ga0265329_10003948
852 Ga0265316_10000039
853 Ga0307408_100100176
854 Ga0265314_10000016
855 Ga0265342_10000803
856 Ga0307405_10038548
857 Ga0307413_10100928
858 Ga0307410_10774753
859 Ga0307406_10043517
860 Ga0307406_11089219
861 Ga0307407_10121400
862 Ga0307407_10293779
863 Ga0307412_10012563
864 Ga0307412_10391320
865 Ga0307409_100146465
866 Ga0307416_100136932
867 Ga0307416_100243288
868 Ga0307415_100218706
869 Ga0373948_0065112
870 Ga0373938_0057836
871 Ga0373940_0029587
872 Ga0373944_0141946
873 Ga0373923_0135231
874 Ga0373939_0063900
875 Ga0373945_0281239
876 Ga0373956_0053866
877 Ga0373957_0152538
878 Ga0373960_0027365
879 Ga0373960_0124951
880 Ga0373943_0000741
881 Ga0373962_0024368
882 Ga0373962_0124773
883 Ga0373924_0001971
884 Ga0373931_0055029
885 Ga0373931_0199716
886 Ga0373935_0034834
887 Ga0373935_0065985
888 Ga0373927_0005072
889 Ga0373933_0364607
890 Ga0373947_0486319
891 Ga0373937_0062097
892 Ga0373925_0083114
893 Ga0436363_0380610
894 Ga0439453_0020770
895 Ga0451807_0016239
896 Ga0439435_0140807
897 Ga0439464_0023829
898 Ga0451577_0017068
899 Ga0439440_0037252
900 Ga0453683_0373927
901 Ga0453684_1324007
902 Ga0451576_0054328
903 Ga0451576_0166102
904 Ga0451576_0341134
905 Ga0495603_0275312
906 Ga0495603_0720961
907 Ga0495629_0001987
908 Ga0495629_0126996
909 Ga0495580_0185148
910 Ga0495662_0150540
911 Ga0495608_0031931
912 Ga0495628_0135374
913 Ga0495642_0039901
914 Ga0495652_0421146
915 Ga0495586_0177010
916 Ga0495598_0003615
917 Ga0495621_0010310
918 Ga0495645_0010513
919 Ga0495622_0095085
920 Ga0495622_0223865
921 Ga0495633_0165765
922 Ga0495634_0169506
923 Ga0495634_0242897
924 Ga0495659_0014263
925 Ga0495658_0172537
926 Ga0495658_0447179
927 Ga0495669_0001531
928 Ga0495669_0017704
929 Ga0495613_0019952
930 Ga0495613_0167985
931 Ga0495600_0157700
932 Ga0495604_0030016
933 Ga0495676_0099306
934 Ga0495676_0229502
935 Ga0495684_0000444
936 Ga0495593_0070848
937 Ga0496100_0046935
938 Ga0496100_0366282
939 Ga0496101_0102652
940 Ga0496102_0304425
941 Ga0496104_0004935
942 Ga0496104_1150217
943 Ga0496105_0108495
944 Ga0496106_0185405
945 Ga0496106_0412892
946 Ga0496106_0854934
947 Ga0496106_1038002
948 Ga0496108_0012736
949 Ga0496109_0003266
950 Ga0496109_0487808
951 Ga0496109_0838503
952 Ga0496110_0001690
953 Ga0496111_1109609
954 Ga0496112_0002885
955 Ga0496112_0479937
956 Ga0496113_1214317
957 Ga0496113_1278577
958 Ga0496114_0000846
959 Ga0501032_0001292
960 Ga0501032_0309095
961 Ga0501033_0107908
962 Ga0501034_0001012
963 Ga0501034_0059188
964 Ga0501034_0441807
965 Ga0501034_0687326
966 Ga0501036_0046341
967 Ga0501036_0436419
968 Ga0501036_1337094
969 Ga0501037_0009984
970 Ga0501037_0944557
971 Ga0501038_0064181
972 Ga0501039_0005899
973 Ga0501042_0263238
974 Ga0501043_0000888
975 Ga0501043_0185547
976 Ga0501043_0617189
977 Ga0501046_0011779
978 Ga0501046_0059674
979 Ga0501047_0000928
980 Ga0501047_0005704
981 Ga0501047_0162533
982 Ga0501047_0213667
983 Ga0501048_0020035
984 Ga0501068_0052422
985 Ga0501068_0771660
986 Ga0501071_0153465
987 Ga0501073_0006121
988 Ga0501073_0145010
989 Ga0501073_0179257
990 Ga0501075_0462162
991 Ga0501076_0658266
992 Ga0501077_0536990
993 Ga0501079_0257917
994 Ga0501080_0005526
995 Ga0501081_0770540
996 Ga0501083_0002195
997 Ga0501083_0058868
998 Ga0501083_0072068
999 Ga0501035_0016296
1000 Ga0501035_0019769
1001 Ga0501044_0002378
1002 Ga0501044_0050870
1003 Ga0501044_0179246
1004 Ga0501045_1152597
1005 nmdc:mga00v17_130189_c1
1006 nmdc:mga0k408_116603_c1
1007 nmdc:mga06z11_116260_c1
1008 nmdc:mga05p37_6058_c1
1009 nmdc:mga05p37_72920_c1
1010 nmdc:mga05p37_798792_c1
1011 nmdc:mga09592_437848_c1
1012 nmdc:mga09592_626104_c1
1013 nmdc:mga0qj67_149174_c1
1014 nmdc:mga0qj67_209157_c1
1015 nmdc:mga06r32_1508115_c1
1016 nmdc:mga06r32_214906_c1
1017 nmdc:mga08y16_106914_c1
1018 nmdc:mga08y16_15644_c1
1019 nmdc:mga08y16_29420_c1
1020 nmdc:mga08y16_388432_c1
1021 nmdc:mga08y16_449857_c1
1022 nmdc:mga08y16_675934_c1
1023 nmdc:mga08y16_68007_c1
1024 nmdc:mga0n895_3221_c1
1025 nmdc:mga0n895_706517_c1
1026 nmdc:mga0rr50_875117_c1
1027 nmdc:mga08x19_526620_c1
1028 nmdc:mga0a205_1435_c1
1029 nmdc:mga0a205_363812_c1
1030 nmdc:mga0a205_736163_c1
1031 nmdc:mga0a205_80342_c1
1032 nmdc:mga0a205_912426_c1
1033 Ga0495619_0002582
1034 Ga0501084_0018696
1035 Ga0501082_0010491
1036 Ga0501082_0141030
1037 Ga0501082_0502104
1038 Ga0501082_0633055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8684 5 146
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8557 3 148
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8487 6 145
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8349 8 153
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8211 6 148
ID Description Score Start End Superfamily
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8262 8 147 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8039 8 147 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7906 5 148 1.20.120.450
2p1aA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7835 6 145 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7674 10 148 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A831LWM8-F1-model_v4 DinB family protein 0.9841 1 164
AF-A0A7V2MJJ7-F1-model_v4 DinB family protein 0.9825 17 164
AF-A0A3D4V6P8-F1-model_v4 DinB family protein 0.9796 1 164
AF-A0A831LWM8-F1-model_v4 DinB family protein 0.9782 1 164
AF-A0A3D4V6P8-F1-model_v4 DinB family protein 0.9737 1 164

Map