F458335

General Info

Members Datasets Scaffolds Average Seq Length
518 279 1036 340

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_45311_c2|nmdc:mga08y16_45311_c2_1130_2194
Length 354
Sequence MTKRRSRASTPKKLRVLVLMHEDLVPPATLEGYSEKESAEWRTEFDVISGLKDLGHDVYMLGVGSDLAPIKNSFAETKPHVAFNLLVHFHGVAVYDQHVVSYMELLRKPYTGCNPRGLMLSRDKALSKKLLAFHRIRSPRFAVFPYGRAARPIKLNYPLVVKSLNEEASLGISQASLVTSDEKLKERVAFMHETFGVDVIAEEFIDGRELYVGVFGNQRLRTLPIWELSFADMPETAPHIATAKLKFDLEYQKKYKIETHRAEGLPENTEQEIHRLCKRIYRVLGLSGYARVDLRLAPDGKVYVLEANPNPDLQRDEDFALSAKSVGIEYSEALQRILTLGMSYQVEWKKADAT

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 0.39
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 12.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_45311_c2 3300050511 Bacteria 2499
2 JGI24737J22298_10011243 3300001990 Bacteria 2936
3 rootH2_10173880 3300003320 Unclassified 1357
4 rootH1_10174852 3300003323 Bacteria 5258
5 JGI26145J50221_1000872 3300003371 Unclassified 2439
6 Ga0065704_10007146 3300005289 Bacteria 3032
7 Ga0065712_10068394 3300005290 Bacteria 10957
8 Ga0065715_10014393 3300005293 Bacteria 3253
9 Ga0065707_10108507 3300005295 Unclassified 2507
10 Ga0070676_10000921 3300005328 Bacteria 14556
11 Ga0070676_10106287 3300005328 Unclassified 1741
12 Ga0070683_100055827 3300005329 Bacteria 3666
13 Ga0070690_100001123 3300005330 Bacteria 13752
14 Ga0070690_100001436 3300005330 Bacteria 12439
15 Ga0070690_100003599 3300005330 Bacteria 8515
16 Ga0070690_100010637 3300005330 Bacteria 5360
17 Ga0070690_100015017 3300005330 Bacteria 4609
18 Ga0070670_100097964 3300005331 Unclassified 2523
19 Ga0070670_100145180 3300005331 Unclassified 2052
20 Ga0070677_10011267 3300005333 Bacteria 3080
21 Ga0068869_100001082 3300005334 Bacteria 15879
22 Ga0068869_100010031 3300005334 Bacteria 6159
23 Ga0070666_10009035 3300005335 Bacteria 6209
24 Ga0070666_10059586 3300005335 Unclassified 2582
25 Ga0070680_100012711 3300005336 Bacteria 6543
26 Ga0070682_100117324 3300005337 Bacteria 1782
27 Ga0070660_100032158 3300005339 Bacteria 3946
28 Ga0070689_100000033 3300005340 Bacteria 91630
29 Ga0070689_100003516 3300005340 Bacteria 10416
30 Ga0070689_100025232 3300005340 Bacteria 4464
31 Ga0070689_100161620 3300005340 Bacteria 1811
32 Ga0070691_10008178 3300005341 Bacteria 4793
33 Ga0070687_100000871 3300005343 Bacteria 10134
34 Ga0070687_100004674 3300005343 Bacteria 5476
35 Ga0070661_100012450 3300005344 Bacteria 5950
36 Ga0070661_100045057 3300005344 Bacteria 3224
37 Ga0070661_100045466 3300005344 Bacteria 3210
38 Ga0070668_100003662 3300005347 Bacteria 11340
39 Ga0070668_100046908 3300005347 Bacteria 3320
40 Ga0070669_100010712 3300005353 Bacteria 6506
41 Ga0070669_100122025 3300005353 Unclassified 1989
42 Ga0070675_100002472 3300005354 Bacteria 13834
43 Ga0070675_100062425 3300005354 Unclassified 3078
44 Ga0070674_100000732 3300005356 Bacteria 16745
45 Ga0070673_100000998 3300005364 Bacteria 16053
46 Ga0070673_100021995 3300005364 Bacteria 4634
47 Ga0070673_100376667 3300005364 Unclassified 1265
48 Ga0070688_100000009 3300005365 Bacteria 85664
49 Ga0070688_100000655 3300005365 Bacteria 17199
50 Ga0070688_100006483 3300005365 Bacteria 6260
51 Ga0070688_100155669 3300005365 Unclassified 1565
52 Ga0070688_100194100 3300005365 Unclassified 1416
53 Ga0070659_100000535 3300005366 Bacteria 27772
54 Ga0070667_100064528 3300005367 Bacteria 3107
55 Ga0070709_10029605 3300005434 Bacteria 3277
56 Ga0070713_100005490 3300005436 Bacteria 8678
57 Ga0070710_10013696 3300005437 Bacteria 4069
58 Ga0070710_10095682 3300005437 Bacteria 1759
59 Ga0070701_10000496 3300005438 Bacteria 13494
60 Ga0070701_10000525 3300005438 Bacteria 13212
61 Ga0070701_10026017 3300005438 Bacteria 2848
62 Ga0070711_100008790 3300005439 Bacteria 6197
63 Ga0070705_100006509 3300005440 Bacteria 5732
64 Ga0070705_100061127 3300005440 Bacteria 2238
65 Ga0070700_100001560 3300005441 Bacteria 11432
66 Ga0070700_100002842 3300005441 Bacteria 8881
67 Ga0070700_100055513 3300005441 Bacteria 2479
68 Ga0070700_100161075 3300005441 Bacteria 1544
69 Ga0070694_100013728 3300005444 Bacteria 5062
70 Ga0070694_100024830 3300005444 Unclassified 3871
71 Ga0070694_100038486 3300005444 Bacteria 3179
72 Ga0070694_100060740 3300005444 Bacteria 2579
73 Ga0070694_100111128 3300005444 Bacteria 1952
74 Ga0070708_100048383 3300005445 Bacteria 3758
75 Ga0070708_100380154 3300005445 Bacteria 1331
76 Ga0070663_100041669 3300005455 Bacteria 3223
77 Ga0070678_100000415 3300005456 Bacteria 20151
78 Ga0070678_100322002 3300005456 Unclassified 1320
79 Ga0070662_100007616 3300005457 Bacteria 7030
80 Ga0070681_10001486 3300005458 Bacteria 20725
81 Ga0070681_10029908 3300005458 Bacteria 5467
82 Ga0070681_10100070 3300005458 Bacteria 2845
83 Ga0070681_10364184 3300005458 Bacteria 1356
84 Ga0068867_100000792 3300005459 Bacteria 21391
85 Ga0068867_100016513 3300005459 Bacteria 5242
86 Ga0068867_100039786 3300005459 Bacteria 3429
87 Ga0070685_10000197 3300005466 Bacteria 40603
88 Ga0070685_10000287 3300005466 Bacteria 32133
89 Ga0070685_10018386 3300005466 Bacteria 3758
90 Ga0070706_100009182 3300005467 Bacteria 9206
91 Ga0070706_100058878 3300005467 Bacteria 3545
92 Ga0070706_100209895 3300005467 Bacteria 1818
93 Ga0070707_100055508 3300005468 Unclassified 3798
94 Ga0070699_100096515 3300005518 Bacteria 2589
95 Ga0070699_100190686 3300005518 Bacteria 1821
96 Ga0070699_100288640 3300005518 Bacteria 1470
97 Ga0070679_100014773 3300005530 Bacteria 7502
98 Ga0070679_100064367 3300005530 Bacteria 3655
99 Ga0070679_100170572 3300005530 Bacteria 2149
100 Ga0070679_100224848 3300005530 Bacteria 1837
101 Ga0070684_100001445 3300005535 Bacteria 17131
102 Ga0070684_100034139 3300005535 Bacteria 4347
103 Ga0070697_100032156 3300005536 Bacteria 4221
104 Ga0070697_100184248 3300005536 Bacteria 1770
105 Ga0070672_100041847 3300005543 Unclassified 3525
106 Ga0070686_100000046 3300005544 Bacteria 101202
107 Ga0070686_100001419 3300005544 Bacteria 13525
108 Ga0070686_100002521 3300005544 Bacteria 10095
109 Ga0070686_100005594 3300005544 Bacteria 6961
110 Ga0070686_100242562 3300005544 Bacteria 1313
111 Ga0070695_100000888 3300005545 Bacteria 16132
112 Ga0070695_100045039 3300005545 Bacteria 2811
113 Ga0070696_100030859 3300005546 Bacteria 3671
114 Ga0070696_100041426 3300005546 Bacteria 3182
115 Ga0070693_100116604 3300005547 Bacteria 1651
116 Ga0070665_100013614 3300005548 Bacteria 8181
117 Ga0070665_100124023 3300005548 Unclassified 2585
118 Ga0068855_100000053 3300005563 Bacteria 139838
119 Ga0068855_100411172 3300005563 Bacteria 1481
120 Ga0070664_100000604 3300005564 Bacteria 27489
121 Ga0070664_100003877 3300005564 Bacteria 12071
122 Ga0070664_100037258 3300005564 Bacteria 4088
123 Ga0068857_100009893 3300005577 Bacteria 8281
124 Ga0068857_100025658 3300005577 Bacteria 5189
125 Ga0068854_100083851 3300005578 Unclassified 2357
126 Ga0068854_100231911 3300005578 Bacteria 1465
127 Ga0070702_100005722 3300005615 Bacteria 5819
128 Ga0070702_100012985 3300005615 Bacteria 4194
129 Ga0070702_100014580 3300005615 Bacteria 3989
130 Ga0068852_100128783 3300005616 Bacteria 2328
131 Ga0068859_100001080 3300005617 Bacteria 27816
132 Ga0068859_100001971 3300005617 Bacteria 20954
133 Ga0068859_100013212 3300005617 Bacteria 8287
134 Ga0068859_100243314 3300005617 Bacteria 1888
135 Ga0068859_100396554 3300005617 Bacteria 1476
136 Ga0068864_100003446 3300005618 Bacteria 13079
137 Ga0068866_10012267 3300005718 Bacteria 3732
138 Ga0068861_100001164 3300005719 Bacteria 16384
139 Ga0068861_100028754 3300005719 Bacteria 4058
140 Ga0068861_100051238 3300005719 Bacteria 3133
141 Ga0068861_100087879 3300005719 Bacteria 2446
142 Ga0068863_100003146 3300005841 Bacteria 16292
143 Ga0068863_100462275 3300005841 Unclassified 1246
144 Ga0068858_100031320 3300005842 Bacteria 4939
145 Ga0068860_100062446 3300005843 Bacteria 3540
146 Ga0068862_100001904 3300005844 Bacteria 18949
147 Ga0081455_10000641 3300005937 Bacteria 45309
148 Ga0081455_10016677 3300005937 Bacteria 7076
149 Ga0081540_1011051 3300005983 Bacteria 6062
150 Ga0070717_10015254 3300006028 Bacteria 5929
151 Ga0075432_10007004 3300006058 Bacteria 3842
152 Ga0070715_10002595 3300006163 Bacteria 5581
153 Ga0070716_100004293 3300006173 Bacteria 6788
154 Ga0097621_100026473 3300006237 Bacteria 4550
155 Ga0097621_100039753 3300006237 Unclassified 3780
156 Ga0068871_100016877 3300006358 Bacteria 5511
157 Ga0068871_100081779 3300006358 Unclassified 2677
158 Ga0075428_100005844 3300006844 Bacteria 13670
159 Ga0075428_100009410 3300006844 Bacteria 10840
160 Ga0075428_100009500 3300006844 Bacteria 10798
161 Ga0075428_100059616 3300006844 Bacteria 4179
162 Ga0075430_100000988 3300006846 Bacteria 22431
163 Ga0075430_100020940 3300006846 Bacteria 5559
164 Ga0075430_100023321 3300006846 Bacteria 5266
165 Ga0075430_100052812 3300006846 Bacteria 3423
166 Ga0075430_100259761 3300006846 Bacteria 1438
167 Ga0075431_100005895 3300006847 Bacteria 12122
168 Ga0075431_100042986 3300006847 Bacteria 4662
169 Ga0075433_10019053 3300006852 Bacteria 5709
170 Ga0075433_10047918 3300006852 Bacteria 3717
171 Ga0075434_100092977 3300006871 Bacteria 3018
172 Ga0075434_100256291 3300006871 Unclassified 1768
173 Ga0075429_100004258 3300006880 Bacteria 12269
174 Ga0075429_100130529 3300006880 Bacteria 2198
175 Ga0075429_100369398 3300006880 Archaea 1256
176 Ga0068865_100015312 3300006881 Bacteria 4889
177 Ga0075436_100042965 3300006914 Unclassified 3116
178 Ga0075436_100055775 3300006914 Unclassified 2729
179 Ga0075436_100060415 3300006914 Bacteria 2618
180 Ga0097620_100001080 3300006931 Bacteria 27816
181 Ga0097620_100001971 3300006931 Bacteria 20954
182 Ga0097620_100013212 3300006931 Bacteria 8287
183 Ga0097620_100243328 3300006931 Bacteria 1888
184 Ga0097620_100396514 3300006931 Bacteria 1476
185 Ga0075435_100050495 3300007076 Bacteria 3347
186 Ga0075435_100054389 3300007076 Unclassified 3230
187 Ga0099794_10144203 3300007265 Bacteria 1207
188 Ga0105240_10470897 3300009093 Bacteria 1402
189 Ga0111539_10012103 3300009094 Bacteria 10823
190 Ga0111539_10015577 3300009094 Bacteria 9452
191 Ga0105245_10005007 3300009098 Bacteria 11647
192 Ga0105245_10029056 3300009098 Bacteria 4882
193 Ga0114129_10000054 3300009147 Bacteria 99951
194 Ga0114129_10009205 3300009147 Bacteria 14082
195 Ga0114129_10116976 3300009147 Bacteria 3673
196 Ga0105243_10001327 3300009148 Bacteria 22055
197 Ga0105243_10130848 3300009148 Bacteria 2128
198 Ga0105242_10030494 3300009176 Bacteria 4305
199 Ga0105242_10034530 3300009176 Bacteria 4055
200 Ga0105248_10000380 3300009177 Bacteria 51815
201 Ga0105248_10000590 3300009177 Bacteria 41307
202 Ga0105237_10462560 3300009545 Bacteria 1275
203 Ga0105249_10088110 3300009553 Bacteria 2898
204 Ga0105239_10022798 3300010375 Bacteria 6902
205 Ga0105239_10112115 3300010375 Bacteria 3024
206 Ga0157374_10006956 3300013296 Bacteria 9625
207 Ga0157378_10035419 3300013297 Unclassified 4414
208 Ga0157378_10051562 3300013297 Bacteria 3661
209 Ga0163162_10016335 3300013306 Bacteria 7256
210 Ga0163162_10167466 3300013306 Unclassified 2321
211 Ga0163162_10643761 3300013306 Unclassified 1184
212 Ga0157372_10092611 3300013307 Unclassified 3438
213 Ga0157372_10182275 3300013307 Unclassified 2431
214 Ga0157375_10187544 3300013308 Bacteria 2222
215 Ga0163163_10001350 3300014325 Bacteria 20704
216 Ga0157380_10001472 3300014326 Bacteria 15425
217 Ga0157380_10005984 3300014326 Bacteria 8512
218 Ga0157380_10006425 3300014326 Bacteria 8277
219 Ga0157380_10041081 3300014326 Bacteria 3607
220 Ga0157380_10430983 3300014326 Unclassified 1260
221 Ga0157377_10014941 3300014745 Unclassified 3959
222 Ga0157377_10022254 3300014745 Bacteria 3344
223 Ga0157376_10017310 3300014969 Bacteria 5493
224 Ga0163161_10374048 3300017792 Bacteria 1137
225 Ga0207682_10011840 3300025893 Bacteria 3407
226 Ga0207692_10001660 3300025898 Bacteria 8412
227 Ga0207642_10013089 3300025899 Bacteria 3016
228 Ga0207688_10012067 3300025901 Bacteria 4700
229 Ga0207688_10028218 3300025901 Bacteria 3088
230 Ga0207680_10044455 3300025903 Bacteria 2612
231 Ga0207680_10112514 3300025903 Bacteria 1768
232 Ga0207685_10010877 3300025905 Bacteria 2710
233 Ga0207699_10144924 3300025906 Bacteria 1565
234 Ga0207645_10000032 3300025907 Bacteria 92521
235 Ga0207645_10019563 3300025907 Bacteria 4438
236 Ga0207645_10140624 3300025907 Unclassified 1573
237 Ga0207684_10048777 3300025910 Bacteria 3592
238 Ga0207684_10134838 3300025910 Bacteria 2120
239 Ga0207684_10183091 3300025910 Bacteria 1807
240 Ga0207707_10007984 3300025912 Bacteria 9194
241 Ga0207707_10029595 3300025912 Bacteria 4788
242 Ga0207693_10007144 3300025915 Bacteria 9211
243 Ga0207663_10084806 3300025916 Bacteria 2084
244 Ga0207660_10012861 3300025917 Bacteria 5480
245 Ga0207660_10029444 3300025917 Bacteria 3767
246 Ga0207660_10257464 3300025917 Bacteria 1379
247 Ga0207662_10002322 3300025918 Bacteria 9530
248 Ga0207662_10012568 3300025918 Bacteria 4717
249 Ga0207662_10019145 3300025918 Unclassified 3892
250 Ga0207657_10006277 3300025919 Bacteria 12353
251 Ga0207649_10010239 3300025920 Bacteria 5147
252 Ga0207649_10019281 3300025920 Bacteria 3896
253 Ga0207649_10035926 3300025920 Bacteria 2981
254 Ga0207652_10007018 3300025921 Bacteria 9078
255 Ga0207652_10370896 3300025921 Unclassified 1292
256 Ga0207646_10076629 3300025922 Bacteria 2988
257 Ga0207646_10079581 3300025922 Bacteria 2930
258 Ga0207681_10007773 3300025923 Bacteria 6566
259 Ga0207681_10126386 3300025923 Unclassified 1883
260 Ga0207681_10140256 3300025923 Unclassified 1799
261 Ga0207694_10144000 3300025924 Bacteria 1917
262 Ga0207650_10065208 3300025925 Unclassified 2728
263 Ga0207650_10074314 3300025925 Unclassified 2562
264 Ga0207659_10126054 3300025926 Bacteria 1969
265 Ga0207659_10146845 3300025926 Unclassified 1837
266 Ga0207687_10052537 3300025927 Bacteria 2844
267 Ga0207700_10005001 3300025928 Bacteria 7883
268 Ga0207664_10053259 3300025929 Bacteria 3202
269 Ga0207690_10030905 3300025932 Bacteria 3421
270 Ga0207706_10002609 3300025933 Bacteria 17551
271 Ga0207706_10002661 3300025933 Bacteria 17387
272 Ga0207686_10024897 3300025934 Bacteria 3474
273 Ga0207709_10006948 3300025935 Bacteria 6327
274 Ga0207709_10173802 3300025935 Bacteria 1514
275 Ga0207709_10270230 3300025935 Archaea 1251
276 Ga0207670_10000024 3300025936 Bacteria 143058
277 Ga0207670_10000042 3300025936 Bacteria 98927
278 Ga0207670_10020475 3300025936 Bacteria 4065
279 Ga0207670_10225210 3300025936 Bacteria 1437
280 Ga0207669_10011521 3300025937 Bacteria 4307
281 Ga0207669_10076071 3300025937 Bacteria 2130
282 Ga0207704_10104961 3300025938 Unclassified 1894
283 Ga0207665_10001974 3300025939 Bacteria 13820
284 Ga0207691_10000159 3300025940 Bacteria 63202
285 Ga0207691_10005798 3300025940 Bacteria 11943
286 Ga0207691_10020265 3300025940 Bacteria 6287
287 Ga0207711_10011059 3300025941 Bacteria 7501
288 Ga0207689_10049523 3300025942 Bacteria 3465
289 Ga0207679_10001459 3300025945 Bacteria 14835
290 Ga0207679_10008298 3300025945 Bacteria 6616
291 Ga0207667_10000057 3300025949 Bacteria 202301
292 Ga0207651_10001866 3300025960 Bacteria 9851
293 Ga0207651_10068846 3300025960 Unclassified 2497
294 Ga0207712_10005886 3300025961 Bacteria 7730
295 Ga0207712_10009600 3300025961 Bacteria 6127
296 Ga0207712_10140546 3300025961 Bacteria 1852
297 Ga0207668_10002934 3300025972 Bacteria 10009
298 Ga0207668_10075890 3300025972 Bacteria 2418
299 Ga0207668_10234549 3300025972 Unclassified 1481
300 Ga0207640_10012806 3300025981 Bacteria 4790
301 Ga0207658_10022888 3300025986 Bacteria 4354
302 Ga0207677_10022614 3300026023 Bacteria 3867
303 Ga0207677_10068031 3300026023 Unclassified 2497
304 Ga0207703_10006504 3300026035 Bacteria 9329
305 Ga0207678_10092432 3300026067 Bacteria 2586
306 Ga0207708_10000780 3300026075 Bacteria 24018
307 Ga0207708_10002391 3300026075 Bacteria 13777
308 Ga0207708_10006234 3300026075 Bacteria 8833
309 Ga0207708_10010939 3300026075 Bacteria 6748
310 Ga0207708_10032903 3300026075 Bacteria 3937
311 Ga0207641_10014269 3300026088 Bacteria 6510
312 Ga0207648_10000034 3300026089 Bacteria 125133
313 Ga0207648_10004243 3300026089 Bacteria 14813
314 Ga0207648_10019796 3300026089 Bacteria 6073
315 Ga0207648_10070137 3300026089 Bacteria 3055
316 Ga0207676_10000876 3300026095 Bacteria 23356
317 Ga0207676_10104805 3300026095 Bacteria 2353
318 Ga0207676_10227053 3300026095 Bacteria 1667
319 Ga0207674_10003041 3300026116 Bacteria 20755
320 Ga0207675_100376016 3300026118 Bacteria 1396
321 Ga0207683_10000013 3300026121 Bacteria 133581
322 Ga0207683_10006209 3300026121 Bacteria 10239
323 Ga0209973_1008282 3300027252 Unclassified 1182
324 Ga0209969_1000203 3300027360 Bacteria 7927
325 Ga0209996_1000088 3300027395 Bacteria 12623
326 Ga0209984_1000858 3300027424 Bacteria 3254
327 Ga0210000_1000050 3300027462 Bacteria 17523
328 Ga0209995_1000056 3300027471 Bacteria 17531
329 Ga0209968_1000044 3300027526 Bacteria 22976
330 Ga0209982_1000227 3300027552 Bacteria 6658
331 Ga0210002_1000687 3300027617 Bacteria 4574
332 Ga0209971_1002051 3300027682 Bacteria 4900
333 Ga0209966_1000140 3300027695 Bacteria 30460
334 Ga0209998_10000011 3300027717 Bacteria 94915
335 Ga0209974_10001611 3300027876 Bacteria 8164
336 Ga0209974_10011181 3300027876 Bacteria 3020
337 Ga0207428_10001209 3300027907 Bacteria 27696
338 Ga0207428_10014783 3300027907 Bacteria 6762
339 Ga0207428_10018634 3300027907 Bacteria 5926
340 Ga0268265_10001740 3300028380 Bacteria 17519
341 Ga0268265_10004508 3300028380 Bacteria 9639
342 Ga0268265_10236303 3300028380 Archaea 1610
343 Ga0268264_10028784 3300028381 Bacteria 4548
344 Ga0268264_10410583 3300028381 Bacteria 1303
345 Ga0307515_10338759 3300028794 Bacteria 1158
346 Ga0307508_10004297 3300031616 Bacteria 13960
347 Ga0307413_10095662 3300031824 Bacteria 1948
348 Ga0307410_10078352 3300031852 Bacteria 2313
349 Ga0307409_100156575 3300031995 Bacteria 1986
350 Ga0307409_100348870 3300031995 Bacteria 1396
351 Ga0307416_100192917 3300032002 Bacteria 1923
352 Ga0373926_0033703 3300035083 Bacteria 1811
353 Ga0373934_0000772 3300035086 Bacteria 11499
354 Ga0373934_0025518 3300035086 Bacteria 2289
355 Ga0373932_0019028 3300035112 Unclassified 1785
356 Ga0373945_0021938 3300035116 Bacteria 2197
357 Ga0373954_0050628 3300035118 Bacteria 1949
358 Ga0373942_0074081 3300035207 Unclassified 999
359 Ga0373924_0022795 3300035410 Bacteria 2450
360 Ga0373935_0011166 3300035692 Bacteria 5392
361 Ga0373933_0048726 3300035724 Bacteria 2523
362 Ga0373933_0094344 3300035724 Bacteria 1850
363 Ga0373937_0082588 3300036401 Bacteria 2973
364 Ga0316582_0004384 3300036647 Bacteria 7118
365 Ga0316584_0097221 3300036712 Bacteria 2204
366 Ga0373925_0046117 3300037068 Bacteria 3240
367 Ga0373925_0101857 3300037068 Bacteria 2208
368 Ga0395898_0015593 3300037466 Bacteria 7791
369 Ga0316581_0009216 3300037588 Unclassified 2708
370 Ga0436365_1270700 3300039437 Bacteria 2742
371 Ga0450894_008056 3300042131 Bacteria 1361
372 Ga0439459_0005572 3300042438 Bacteria 2074
373 Ga0439460_0020150 3300042461 Bacteria 1812
374 Ga0439460_0034784 3300042461 Bacteria 1454
375 Ga0451577_0062942 3300042876 Bacteria 3308
376 Ga0451577_0184998 3300042876 Bacteria 1879
377 Ga0466963_0253050 3300044694 Bacteria 1236
378 Ga0453684_0184771 3300044712 Bacteria 2444
379 Ga0466971_0066789 3300044719 Unclassified 1630
380 Ga0451576_0005445 3300045051 Bacteria 15963
381 Ga0451576_0034321 3300045051 Bacteria 5389
382 Ga0451576_0043180 3300045051 Bacteria 4757
383 Ga0451576_0311533 3300045051 Bacteria 1647
384 Ga0495592_0055128 3300046454 Bacteria 2942
385 Ga0495629_0018223 3300046459 Bacteria 5029
386 Ga0495580_0053574 3300046472 Bacteria 2846
387 Ga0495582_0048180 3300046473 Bacteria 2346
388 Ga0495639_0090614 3300046475 Bacteria 1434
389 Ga0495639_0170794 3300046475 Bacteria 1055
390 Ga0495594_0005710 3300046499 Bacteria 6395
391 Ga0495628_0217183 3300046516 Bacteria 1437
392 Ga0495630_0002116 3300046517 Bacteria 13809
393 Ga0495630_0062354 3300046517 Bacteria 2801
394 Ga0495630_0215857 3300046517 Bacteria 1464
395 Ga0495587_0048701 3300046536 Bacteria 2509
396 Ga0495587_0204846 3300046536 Bacteria 1115
397 Ga0495621_0054422 3300046539 Unclassified 1438
398 Ga0495634_0049607 3300046642 Bacteria 2822
399 Ga0495635_0004486 3300046663 Bacteria 9672
400 Ga0495635_0014567 3300046663 Bacteria 5500
401 Ga0495635_0135569 3300046663 Bacteria 1678
402 Ga0495659_0029100 3300046664 Unclassified 1916
403 Ga0495657_0007834 3300046675 Bacteria 8198
404 Ga0495657_0013232 3300046675 Bacteria 6093
405 Ga0495599_0211509 3300046678 Bacteria 1189
406 Ga0495658_0064301 3300046683 Bacteria 2113
407 Ga0495658_0178850 3300046683 Bacteria 1315
408 Ga0495624_0102440 3300046690 Bacteria 1762
409 Ga0495581_0010068 3300047315 Bacteria 5468
410 Ga0495581_0152670 3300047315 Bacteria 1349
411 Ga0495636_0084121 3300047318 Bacteria 1374
412 Ga0495674_0013931 3300047319 Bacteria 7543
413 Ga0495676_0045288 3300047321 Bacteria 3582
414 Ga0495680_0014867 3300047322 Bacteria 6729
415 Ga0495680_0029680 3300047322 Bacteria 4476
416 Ga0495680_0051897 3300047322 Bacteria 3199
417 Ga0495684_0008101 3300047471 Bacteria 8124
418 Ga0495686_0000025 3300047472 Bacteria 388098
419 Ga0496106_0358330 3300048909 Unclassified 1172
420 Ga0496110_0397482 3300048913 Bacteria 1256
421 Ga0501031_0000384 3300049568 Bacteria 25955
422 Ga0501031_0006033 3300049568 Bacteria 7905
423 Ga0501032_0029910 3300049569 Bacteria 3736
424 Ga0501034_0014295 3300049571 Bacteria 8181
425 Ga0501036_0015796 3300049572 Bacteria 6308
426 Ga0501036_0022521 3300049572 Bacteria 5300
427 Ga0501036_0100738 3300049572 Bacteria 2443
428 Ga0501037_0057036 3300049573 Bacteria 2852
429 Ga0501037_0139734 3300049573 Unclassified 1734
430 Ga0501038_0030097 3300049574 Bacteria 4807
431 Ga0501038_0071611 3300049574 Bacteria 2940
432 Ga0501039_0003595 3300049575 Bacteria 11622
433 Ga0501039_0017579 3300049575 Bacteria 5486
434 Ga0501039_0031872 3300049575 Bacteria 4063
435 Ga0501039_0041873 3300049575 Bacteria 3539
436 Ga0501040_0013182 3300049576 Bacteria 5437
437 Ga0501040_0228400 3300049576 Bacteria 1325
438 Ga0501041_0002108 3300049577 Bacteria 11211
439 Ga0501041_0018521 3300049577 Unclassified 4148
440 Ga0501041_0019008 3300049577 Bacteria 4095
441 Ga0501042_0001514 3300049578 Bacteria 13741
442 Ga0501042_0043276 3300049578 Bacteria 3206
443 Ga0501043_0006843 3300049579 Bacteria 9102
444 Ga0501043_0028799 3300049579 Unclassified 4361
445 Ga0501043_0070580 3300049579 Bacteria 2744
446 Ga0501043_0320545 3300049579 Bacteria 1182
447 Ga0501046_0000971 3300049580 Bacteria 28071
448 Ga0501046_0002476 3300049580 Bacteria 17313
449 Ga0501046_0038134 3300049580 Bacteria 3859
450 Ga0501046_0042498 3300049580 Bacteria 3624
451 Ga0501047_0014529 3300049581 Bacteria 7489
452 Ga0501047_0052984 3300049581 Bacteria 3922
453 Ga0501048_0019735 3300049582 Bacteria 4943
454 Ga0501048_0135922 3300049582 Bacteria 1737
455 Ga0501067_0045806 3300049583 Bacteria 2428
456 Ga0501068_0049477 3300049584 Bacteria 2539
457 Ga0501070_0000873 3300049586 Bacteria 27422
458 Ga0501071_0012638 3300049587 Bacteria 5735
459 Ga0501071_0072868 3300049587 Unclassified 2505
460 Ga0501072_0071050 3300049588 Bacteria 2750
461 Ga0501072_0327360 3300049588 Bacteria 1217
462 Ga0501073_0065052 3300049589 Unclassified 2543
463 Ga0501074_0200013 3300049590 Bacteria 1424
464 Ga0501074_0241572 3300049590 Unclassified 1284
465 Ga0501075_0022757 3300049591 Bacteria 4581
466 Ga0501075_0024196 3300049591 Bacteria 4449
467 Ga0501075_0024289 3300049591 Bacteria 4442
468 Ga0501075_0244942 3300049591 Unclassified 1367
469 Ga0501075_0292732 3300049591 Bacteria 1240
470 Ga0501076_0052971 3300049592 Bacteria 3215
471 Ga0501076_0084837 3300049592 Unclassified 2544
472 Ga0501076_0088399 3300049592 Bacteria 2490
473 Ga0501076_0149713 3300049592 Bacteria 1898
474 Ga0501076_0176754 3300049592 Unclassified 1740
475 Ga0501076_0292181 3300049592 Bacteria 1335
476 Ga0501076_0368361 3300049592 Bacteria 1181
477 Ga0501077_0043418 3300049593 Bacteria 2857
478 Ga0501077_0131084 3300049593 Bacteria 1589
479 Ga0501206_007922 3300049653 Bacteria 1399
480 Ga0501079_0026443 3300049741 Bacteria 4449
481 Ga0501079_0105438 3300049741 Unclassified 2187
482 Ga0501079_0110871 3300049741 Bacteria 2132
483 Ga0501080_0041893 3300049742 Bacteria 4265
484 Ga0501081_0060680 3300049743 Bacteria 2621
485 Ga0501035_0022332 3300049822 Bacteria 5810
486 Ga0501035_0040894 3300049822 Bacteria 4187
487 Ga0501035_0098882 3300049822 Unclassified 2561
488 Ga0501045_0025410 3300049824 Bacteria 4258
489 Ga0501045_0290591 3300049824 Bacteria 1216
490 nmdc:mga05p37_232571_c1 3300050507 Bacteria 2220
491 nmdc:mga05p37_317427_c1 3300050507 Bacteria 1845
492 nmdc:mga05p37_398881_c1 3300050507 Bacteria 1606
493 nmdc:mga05p37_866_c1 3300050507 Bacteria 34051
494 nmdc:mga09592_139488_c1 3300050508 Bacteria 2089
495 nmdc:mga09592_265485_c1 3300050508 Bacteria 1489
496 nmdc:mga09592_33716_c1 3300050508 Bacteria 4277
497 nmdc:mga0qj67_117489_c1 3300050509 Bacteria 2150
498 nmdc:mga0qj67_20876_c1 3300050509 Bacteria 5018
499 nmdc:mga0qj67_3905_c1 3300050509 Bacteria 10772
500 nmdc:mga06r32_3986_c1 3300050510 Bacteria 13228
501 nmdc:mga06r32_74569_c1 3300050510 Bacteria 3290
502 nmdc:mga08y16_26104_c1 3300050511 Bacteria 6162
503 nmdc:mga08y16_43050_c1 3300050511 Bacteria 4730
504 nmdc:mga0n895_158937_c1 3300050512 Bacteria 2291
505 nmdc:mga0n895_82492_c1 3300050512 Bacteria 3205
506 nmdc:mga08x19_42262_c1 3300050514 Unclassified 2905
507 nmdc:mga08x19_5179_c1 3300050514 Bacteria 7707
508 nmdc:mga0a205_14401_c1 3300050515 Bacteria 4178
509 nmdc:mga0a205_18338_c1 3300050515 Bacteria 6577
510 nmdc:mga0a205_233785_c1 3300050515 Bacteria 1721
511 Ga0495601_0047327 3300053077 Bacteria 2707
512 Ga0495601_0258750 3300053077 Bacteria 1136
513 Ga0495619_0040931 3300053085 Bacteria 3029
514 Ga0500568_0031351 3300053139 Bacteria 2194
515 Ga0500622_0001812 3300053156 Bacteria 16271
516 Ga0500622_0003311 3300053156 Bacteria 10889
517 Ga0501084_0265950 3300054114 Bacteria 1448
518 Ga0530510_0084530 3300061734 Bacteria 2311
519 nmdc:mga08y16_45311_c2
520 JGI24737J22298_10011243
521 rootH2_10173880
522 rootH1_10174852
523 JGI26145J50221_1000872
524 Ga0065704_10007146
525 Ga0065712_10068394
526 Ga0065715_10014393
527 Ga0065707_10108507
528 Ga0070676_10000921
529 Ga0070676_10106287
530 Ga0070683_100055827
531 Ga0070690_100001123
532 Ga0070690_100001436
533 Ga0070690_100003599
534 Ga0070690_100010637
535 Ga0070690_100015017
536 Ga0070670_100097964
537 Ga0070670_100145180
538 Ga0070677_10011267
539 Ga0068869_100001082
540 Ga0068869_100010031
541 Ga0070666_10009035
542 Ga0070666_10059586
543 Ga0070680_100012711
544 Ga0070682_100117324
545 Ga0070660_100032158
546 Ga0070689_100000033
547 Ga0070689_100003516
548 Ga0070689_100025232
549 Ga0070689_100161620
550 Ga0070691_10008178
551 Ga0070687_100000871
552 Ga0070687_100004674
553 Ga0070661_100012450
554 Ga0070661_100045057
555 Ga0070661_100045466
556 Ga0070668_100003662
557 Ga0070668_100046908
558 Ga0070669_100010712
559 Ga0070669_100122025
560 Ga0070675_100002472
561 Ga0070675_100062425
562 Ga0070674_100000732
563 Ga0070673_100000998
564 Ga0070673_100021995
565 Ga0070673_100376667
566 Ga0070688_100000009
567 Ga0070688_100000655
568 Ga0070688_100006483
569 Ga0070688_100155669
570 Ga0070688_100194100
571 Ga0070659_100000535
572 Ga0070667_100064528
573 Ga0070709_10029605
574 Ga0070713_100005490
575 Ga0070710_10013696
576 Ga0070710_10095682
577 Ga0070701_10000496
578 Ga0070701_10000525
579 Ga0070701_10026017
580 Ga0070711_100008790
581 Ga0070705_100006509
582 Ga0070705_100061127
583 Ga0070700_100001560
584 Ga0070700_100002842
585 Ga0070700_100055513
586 Ga0070700_100161075
587 Ga0070694_100013728
588 Ga0070694_100024830
589 Ga0070694_100038486
590 Ga0070694_100060740
591 Ga0070694_100111128
592 Ga0070708_100048383
593 Ga0070708_100380154
594 Ga0070663_100041669
595 Ga0070678_100000415
596 Ga0070678_100322002
597 Ga0070662_100007616
598 Ga0070681_10001486
599 Ga0070681_10029908
600 Ga0070681_10100070
601 Ga0070681_10364184
602 Ga0068867_100000792
603 Ga0068867_100016513
604 Ga0068867_100039786
605 Ga0070685_10000197
606 Ga0070685_10000287
607 Ga0070685_10018386
608 Ga0070706_100009182
609 Ga0070706_100058878
610 Ga0070706_100209895
611 Ga0070707_100055508
612 Ga0070699_100096515
613 Ga0070699_100190686
614 Ga0070699_100288640
615 Ga0070679_100014773
616 Ga0070679_100064367
617 Ga0070679_100170572
618 Ga0070679_100224848
619 Ga0070684_100001445
620 Ga0070684_100034139
621 Ga0070697_100032156
622 Ga0070697_100184248
623 Ga0070672_100041847
624 Ga0070686_100000046
625 Ga0070686_100001419
626 Ga0070686_100002521
627 Ga0070686_100005594
628 Ga0070686_100242562
629 Ga0070695_100000888
630 Ga0070695_100045039
631 Ga0070696_100030859
632 Ga0070696_100041426
633 Ga0070693_100116604
634 Ga0070665_100013614
635 Ga0070665_100124023
636 Ga0068855_100000053
637 Ga0068855_100411172
638 Ga0070664_100000604
639 Ga0070664_100003877
640 Ga0070664_100037258
641 Ga0068857_100009893
642 Ga0068857_100025658
643 Ga0068854_100083851
644 Ga0068854_100231911
645 Ga0070702_100005722
646 Ga0070702_100012985
647 Ga0070702_100014580
648 Ga0068852_100128783
649 Ga0068859_100001080
650 Ga0068859_100001971
651 Ga0068859_100013212
652 Ga0068859_100243314
653 Ga0068859_100396554
654 Ga0068864_100003446
655 Ga0068866_10012267
656 Ga0068861_100001164
657 Ga0068861_100028754
658 Ga0068861_100051238
659 Ga0068861_100087879
660 Ga0068863_100003146
661 Ga0068863_100462275
662 Ga0068858_100031320
663 Ga0068860_100062446
664 Ga0068862_100001904
665 Ga0081455_10000641
666 Ga0081455_10016677
667 Ga0081540_1011051
668 Ga0070717_10015254
669 Ga0075432_10007004
670 Ga0070715_10002595
671 Ga0070716_100004293
672 Ga0097621_100026473
673 Ga0097621_100039753
674 Ga0068871_100016877
675 Ga0068871_100081779
676 Ga0075428_100005844
677 Ga0075428_100009410
678 Ga0075428_100009500
679 Ga0075428_100059616
680 Ga0075430_100000988
681 Ga0075430_100020940
682 Ga0075430_100023321
683 Ga0075430_100052812
684 Ga0075430_100259761
685 Ga0075431_100005895
686 Ga0075431_100042986
687 Ga0075433_10019053
688 Ga0075433_10047918
689 Ga0075434_100092977
690 Ga0075434_100256291
691 Ga0075429_100004258
692 Ga0075429_100130529
693 Ga0075429_100369398
694 Ga0068865_100015312
695 Ga0075436_100042965
696 Ga0075436_100055775
697 Ga0075436_100060415
698 Ga0097620_100001080
699 Ga0097620_100001971
700 Ga0097620_100013212
701 Ga0097620_100243328
702 Ga0097620_100396514
703 Ga0075435_100050495
704 Ga0075435_100054389
705 Ga0099794_10144203
706 Ga0105240_10470897
707 Ga0111539_10012103
708 Ga0111539_10015577
709 Ga0105245_10005007
710 Ga0105245_10029056
711 Ga0114129_10000054
712 Ga0114129_10009205
713 Ga0114129_10116976
714 Ga0105243_10001327
715 Ga0105243_10130848
716 Ga0105242_10030494
717 Ga0105242_10034530
718 Ga0105248_10000380
719 Ga0105248_10000590
720 Ga0105237_10462560
721 Ga0105249_10088110
722 Ga0105239_10022798
723 Ga0105239_10112115
724 Ga0157374_10006956
725 Ga0157378_10035419
726 Ga0157378_10051562
727 Ga0163162_10016335
728 Ga0163162_10167466
729 Ga0163162_10643761
730 Ga0157372_10092611
731 Ga0157372_10182275
732 Ga0157375_10187544
733 Ga0163163_10001350
734 Ga0157380_10001472
735 Ga0157380_10005984
736 Ga0157380_10006425
737 Ga0157380_10041081
738 Ga0157380_10430983
739 Ga0157377_10014941
740 Ga0157377_10022254
741 Ga0157376_10017310
742 Ga0163161_10374048
743 Ga0207682_10011840
744 Ga0207692_10001660
745 Ga0207642_10013089
746 Ga0207688_10012067
747 Ga0207688_10028218
748 Ga0207680_10044455
749 Ga0207680_10112514
750 Ga0207685_10010877
751 Ga0207699_10144924
752 Ga0207645_10000032
753 Ga0207645_10019563
754 Ga0207645_10140624
755 Ga0207684_10048777
756 Ga0207684_10134838
757 Ga0207684_10183091
758 Ga0207707_10007984
759 Ga0207707_10029595
760 Ga0207693_10007144
761 Ga0207663_10084806
762 Ga0207660_10012861
763 Ga0207660_10029444
764 Ga0207660_10257464
765 Ga0207662_10002322
766 Ga0207662_10012568
767 Ga0207662_10019145
768 Ga0207657_10006277
769 Ga0207649_10010239
770 Ga0207649_10019281
771 Ga0207649_10035926
772 Ga0207652_10007018
773 Ga0207652_10370896
774 Ga0207646_10076629
775 Ga0207646_10079581
776 Ga0207681_10007773
777 Ga0207681_10126386
778 Ga0207681_10140256
779 Ga0207694_10144000
780 Ga0207650_10065208
781 Ga0207650_10074314
782 Ga0207659_10126054
783 Ga0207659_10146845
784 Ga0207687_10052537
785 Ga0207700_10005001
786 Ga0207664_10053259
787 Ga0207690_10030905
788 Ga0207706_10002609
789 Ga0207706_10002661
790 Ga0207686_10024897
791 Ga0207709_10006948
792 Ga0207709_10173802
793 Ga0207709_10270230
794 Ga0207670_10000024
795 Ga0207670_10000042
796 Ga0207670_10020475
797 Ga0207670_10225210
798 Ga0207669_10011521
799 Ga0207669_10076071
800 Ga0207704_10104961
801 Ga0207665_10001974
802 Ga0207691_10000159
803 Ga0207691_10005798
804 Ga0207691_10020265
805 Ga0207711_10011059
806 Ga0207689_10049523
807 Ga0207679_10001459
808 Ga0207679_10008298
809 Ga0207667_10000057
810 Ga0207651_10001866
811 Ga0207651_10068846
812 Ga0207712_10005886
813 Ga0207712_10009600
814 Ga0207712_10140546
815 Ga0207668_10002934
816 Ga0207668_10075890
817 Ga0207668_10234549
818 Ga0207640_10012806
819 Ga0207658_10022888
820 Ga0207677_10022614
821 Ga0207677_10068031
822 Ga0207703_10006504
823 Ga0207678_10092432
824 Ga0207708_10000780
825 Ga0207708_10002391
826 Ga0207708_10006234
827 Ga0207708_10010939
828 Ga0207708_10032903
829 Ga0207641_10014269
830 Ga0207648_10000034
831 Ga0207648_10004243
832 Ga0207648_10019796
833 Ga0207648_10070137
834 Ga0207676_10000876
835 Ga0207676_10104805
836 Ga0207676_10227053
837 Ga0207674_10003041
838 Ga0207675_100376016
839 Ga0207683_10000013
840 Ga0207683_10006209
841 Ga0209973_1008282
842 Ga0209969_1000203
843 Ga0209996_1000088
844 Ga0209984_1000858
845 Ga0210000_1000050
846 Ga0209995_1000056
847 Ga0209968_1000044
848 Ga0209982_1000227
849 Ga0210002_1000687
850 Ga0209971_1002051
851 Ga0209966_1000140
852 Ga0209998_10000011
853 Ga0209974_10001611
854 Ga0209974_10011181
855 Ga0207428_10001209
856 Ga0207428_10014783
857 Ga0207428_10018634
858 Ga0268265_10001740
859 Ga0268265_10004508
860 Ga0268265_10236303
861 Ga0268264_10028784
862 Ga0268264_10410583
863 Ga0307515_10338759
864 Ga0307508_10004297
865 Ga0307413_10095662
866 Ga0307410_10078352
867 Ga0307409_100156575
868 Ga0307409_100348870
869 Ga0307416_100192917
870 Ga0373926_0033703
871 Ga0373934_0000772
872 Ga0373934_0025518
873 Ga0373932_0019028
874 Ga0373945_0021938
875 Ga0373954_0050628
876 Ga0373942_0074081
877 Ga0373924_0022795
878 Ga0373935_0011166
879 Ga0373933_0048726
880 Ga0373933_0094344
881 Ga0373937_0082588
882 Ga0316582_0004384
883 Ga0316584_0097221
884 Ga0373925_0046117
885 Ga0373925_0101857
886 Ga0395898_0015593
887 Ga0316581_0009216
888 Ga0436365_1270700
889 Ga0450894_008056
890 Ga0439459_0005572
891 Ga0439460_0020150
892 Ga0439460_0034784
893 Ga0451577_0062942
894 Ga0451577_0184998
895 Ga0466963_0253050
896 Ga0453684_0184771
897 Ga0466971_0066789
898 Ga0451576_0005445
899 Ga0451576_0034321
900 Ga0451576_0043180
901 Ga0451576_0311533
902 Ga0495592_0055128
903 Ga0495629_0018223
904 Ga0495580_0053574
905 Ga0495582_0048180
906 Ga0495639_0090614
907 Ga0495639_0170794
908 Ga0495594_0005710
909 Ga0495628_0217183
910 Ga0495630_0002116
911 Ga0495630_0062354
912 Ga0495630_0215857
913 Ga0495587_0048701
914 Ga0495587_0204846
915 Ga0495621_0054422
916 Ga0495634_0049607
917 Ga0495635_0004486
918 Ga0495635_0014567
919 Ga0495635_0135569
920 Ga0495659_0029100
921 Ga0495657_0007834
922 Ga0495657_0013232
923 Ga0495599_0211509
924 Ga0495658_0064301
925 Ga0495658_0178850
926 Ga0495624_0102440
927 Ga0495581_0010068
928 Ga0495581_0152670
929 Ga0495636_0084121
930 Ga0495674_0013931
931 Ga0495676_0045288
932 Ga0495680_0014867
933 Ga0495680_0029680
934 Ga0495680_0051897
935 Ga0495684_0008101
936 Ga0495686_0000025
937 Ga0496106_0358330
938 Ga0496110_0397482
939 Ga0501031_0000384
940 Ga0501031_0006033
941 Ga0501032_0029910
942 Ga0501034_0014295
943 Ga0501036_0015796
944 Ga0501036_0022521
945 Ga0501036_0100738
946 Ga0501037_0057036
947 Ga0501037_0139734
948 Ga0501038_0030097
949 Ga0501038_0071611
950 Ga0501039_0003595
951 Ga0501039_0017579
952 Ga0501039_0031872
953 Ga0501039_0041873
954 Ga0501040_0013182
955 Ga0501040_0228400
956 Ga0501041_0002108
957 Ga0501041_0018521
958 Ga0501041_0019008
959 Ga0501042_0001514
960 Ga0501042_0043276
961 Ga0501043_0006843
962 Ga0501043_0028799
963 Ga0501043_0070580
964 Ga0501043_0320545
965 Ga0501046_0000971
966 Ga0501046_0002476
967 Ga0501046_0038134
968 Ga0501046_0042498
969 Ga0501047_0014529
970 Ga0501047_0052984
971 Ga0501048_0019735
972 Ga0501048_0135922
973 Ga0501067_0045806
974 Ga0501068_0049477
975 Ga0501070_0000873
976 Ga0501071_0012638
977 Ga0501071_0072868
978 Ga0501072_0071050
979 Ga0501072_0327360
980 Ga0501073_0065052
981 Ga0501074_0200013
982 Ga0501074_0241572
983 Ga0501075_0022757
984 Ga0501075_0024196
985 Ga0501075_0024289
986 Ga0501075_0244942
987 Ga0501075_0292732
988 Ga0501076_0052971
989 Ga0501076_0084837
990 Ga0501076_0088399
991 Ga0501076_0149713
992 Ga0501076_0176754
993 Ga0501076_0292181
994 Ga0501076_0368361
995 Ga0501077_0043418
996 Ga0501077_0131084
997 Ga0501206_007922
998 Ga0501079_0026443
999 Ga0501079_0105438
1000 Ga0501079_0110871
1001 Ga0501080_0041893
1002 Ga0501081_0060680
1003 Ga0501035_0022332
1004 Ga0501035_0040894
1005 Ga0501035_0098882
1006 Ga0501045_0025410
1007 Ga0501045_0290591
1008 nmdc:mga05p37_232571_c1
1009 nmdc:mga05p37_317427_c1
1010 nmdc:mga05p37_398881_c1
1011 nmdc:mga05p37_866_c1
1012 nmdc:mga09592_139488_c1
1013 nmdc:mga09592_265485_c1
1014 nmdc:mga09592_33716_c1
1015 nmdc:mga0qj67_117489_c1
1016 nmdc:mga0qj67_20876_c1
1017 nmdc:mga0qj67_3905_c1
1018 nmdc:mga06r32_3986_c1
1019 nmdc:mga06r32_74569_c1
1020 nmdc:mga08y16_26104_c1
1021 nmdc:mga08y16_43050_c1
1022 nmdc:mga0n895_158937_c1
1023 nmdc:mga0n895_82492_c1
1024 nmdc:mga08x19_42262_c1
1025 nmdc:mga08x19_5179_c1
1026 nmdc:mga0a205_14401_c1
1027 nmdc:mga0a205_18338_c1
1028 nmdc:mga0a205_233785_c1
1029 Ga0495601_0047327
1030 Ga0495601_0258750
1031 Ga0495619_0040931
1032 Ga0500568_0031351
1033 Ga0500622_0001812
1034 Ga0500622_0003311
1035 Ga0501084_0265950
1036 Ga0530510_0084530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

147

339

0.89

PF02655

ATP-grasp_3

ATP-grasp domain

121

312

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5x-assembly2.cif.gz_C crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8791 4 333
3r5x-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8716 4 333
3r5x-assembly1.cif.gz_A crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.871 1 333
4egj-assembly5.cif.gz_C-2 crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans 0.8634 5 333
4egj-assembly6.cif.gz_D-2 crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans 0.8553 5 333
ID Description Score Start End Superfamily
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9234 105 330 3.30.470.20
1ehiB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9088 194 331 3.30.470.20
5d8dD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.903 105 329 3.30.470.20
1ehiA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.889 197 331 3.30.470.20
af_P9WP31_140_368_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8885 101 332 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A532BWC4-F1-model_v4 ATP-grasp domain-containing protein 0.9769 192 340 GO:0005524
GO:0006520
GO:0008716
GO:0016597
GO:0016743
GO:0046872
AF-A0A2V8PF42-F1-model_v4 ATP-grasp domain-containing protein 0.9688 192 335 GO:0005524
GO:0008716
GO:0046872
AF-A0A353EST0-F1-model_v4 D-alanine--D-alanine ligase 0.9608 32 336 GO:0005524
GO:0008716
GO:0046872
AF-X1CHP1-F1-model_v4 ATP-grasp domain-containing protein 0.9604 102 331 GO:0005524
GO:0008716
GO:0046872
AF-A0A7V1N8J5-F1-model_v4 D-alanine--D-alanine ligase 0.9577 103 334 GO:0005524
GO:0008716
GO:0046872

Map