F458284

General Info

Members Datasets Scaffolds Average Seq Length
518 255 1036 266

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0810858|Ga0436360_0810858_219_1211
Length 330
Sequence MSALDGAAGDGNFSPAMGQPRTWKPRRAITVTLRRPASERTGDGDGGVPAPYALKAMPPAPAGTVRIATWNINSVRLRLRLIKRLAMAASPDIICLQETKTPDEHFPRAALAKLGYEHQAACGMKGYNGVAILSRLPLHAAVPREWCGRVDCRHILAEVDVGGQRIELHNVYVPAGGDVPDPKVNPKFDHKLSFLREQVAWWEAQPKHGAARILVGDLNVAPLEADVWSHKQLLDVVSHTPVETELLGHLLAAHEWTDAARHVVPEPTRMYTWWSYRNRDWKASDRGRRLDHIWITRDLKPLIAGVHIVKGARDWRQPSDHVPVIVDLKA

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
232 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
233 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
234 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
235 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
236 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
237 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
238 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
239 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
240 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
241 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
242 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
243 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
244 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
245 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
246 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
247 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
248 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
249 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
250 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
251 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
252 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
253 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
254 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
255 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 0
Isolates 4.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 3.67
Rhizosphere 86.87
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0810858 3300039438 Bacteria 1936
2 JGI24746J21847_1007479 3300001977 Bacteria 1670
3 JGI24743J22301_10002955 3300001991 Bacteria 2633
4 JGI24745J21846_1003424 3300002073 Bacteria 1659
5 JGI24738J21930_10003763 3300002075 Bacteria 3791
6 JGI25406J46586_10000405 3300003203 Bacteria 19839
7 Ga0055536_1015958 3300003781 Bacteria 2539
8 Ga0070658_10232890 3300005327 Bacteria 1560
9 Ga0070670_100002057 3300005331 Bacteria 16470
10 Ga0070670_100061311 3300005331 Bacteria 3229
11 Ga0070666_10001390 3300005335 Bacteria 14648
12 Ga0070666_10159308 3300005335 Bacteria 1577
13 Ga0070680_100000317 3300005336 Bacteria 32367
14 Ga0070680_100038054 3300005336 Bacteria 3889
15 Ga0070660_100001661 3300005339 Bacteria 15288
16 Ga0070689_100348941 3300005340 Bacteria 1241
17 Ga0070691_10000082 3300005341 Bacteria 26541
18 Ga0070691_10013637 3300005341 Bacteria 3725
19 Ga0070661_100075991 3300005344 Bacteria 2475
20 Ga0070661_100123255 3300005344 Bacteria 1942
21 Ga0070668_100000007 3300005347 Bacteria 150621
22 Ga0070668_100000030 3300005347 Bacteria 87912
23 Ga0070668_100010669 3300005347 Bacteria 6830
24 Ga0070669_100167747 3300005353 Bacteria 1710
25 Ga0070671_100000125 3300005355 Bacteria 49771
26 Ga0070671_100001727 3300005355 Bacteria 16594
27 Ga0070671_100060397 3300005355 Bacteria 3156
28 Ga0070673_100440762 3300005364 Bacteria 1170
29 Ga0070659_100003489 3300005366 Bacteria 11192
30 Ga0070659_100362409 3300005366 Bacteria 1218
31 Ga0070667_100000071 3300005367 Bacteria 125713
32 Ga0070667_100029011 3300005367 Bacteria 4608
33 Ga0070709_10001323 3300005434 Bacteria 13496
34 Ga0070709_10069288 3300005434 Bacteria 2271
35 Ga0070714_100145560 3300005435 Bacteria 2131
36 Ga0070714_100161715 3300005435 Bacteria 2026
37 Ga0070714_100419557 3300005435 Bacteria 1267
38 Ga0070713_100629406 3300005436 Bacteria 1021
39 Ga0070713_100695964 3300005436 Bacteria 970
40 Ga0070711_100255841 3300005439 Bacteria 1375
41 Ga0070663_100022278 3300005455 Bacteria 4233
42 Ga0070663_100036891 3300005455 Bacteria 3399
43 Ga0070681_10000002 3300005458 Bacteria 821814
44 Ga0070681_10057538 3300005458 Bacteria 3868
45 Ga0070681_10159118 3300005458 Bacteria 2182
46 Ga0070706_100040722 3300005467 Bacteria 4289
47 Ga0070707_100305129 3300005468 Bacteria 1547
48 Ga0070679_100000865 3300005530 Bacteria 26309
49 Ga0070679_100001275 3300005530 Bacteria 22239
50 Ga0070679_100115879 3300005530 Bacteria 2664
51 Ga0070679_100301185 3300005530 Bacteria 1554
52 Ga0070679_100394675 3300005530 Bacteria 1330
53 Ga0070679_100472845 3300005530 Bacteria 1198
54 Ga0070697_100115990 3300005536 Bacteria 2236
55 Ga0070697_100163885 3300005536 Bacteria 1879
56 Ga0068853_100000169 3300005539 Bacteria 45200
57 Ga0068853_100031789 3300005539 Bacteria 4466
58 Ga0070696_100086544 3300005546 Bacteria 2225
59 Ga0070693_100247630 3300005547 Bacteria 1180
60 Ga0070665_100055730 3300005548 Bacteria 3964
61 Ga0068855_100000069 3300005563 Bacteria 124154
62 Ga0068855_100009020 3300005563 Bacteria 12053
63 Ga0070664_100036488 3300005564 Bacteria 4130
64 Ga0068857_100089470 3300005577 Bacteria 2755
65 Ga0068857_100157428 3300005577 Bacteria 2060
66 Ga0068857_100194522 3300005577 Bacteria 1848
67 Ga0068857_100265185 3300005577 Bacteria 1577
68 Ga0068854_100004844 3300005578 Bacteria 8491
69 Ga0068856_100123639 3300005614 Bacteria 2590
70 Ga0068852_100072950 3300005616 Bacteria 3018
71 Ga0068859_100010739 3300005617 Bacteria 9217
72 Ga0068859_100034215 3300005617 Bacteria 5101
73 Ga0068864_100003212 3300005618 Bacteria 13494
74 Ga0068864_100467164 3300005618 Bacteria 1209
75 Ga0068864_100533886 3300005618 Bacteria 1132
76 Ga0068863_100000027 3300005841 Bacteria 181884
77 Ga0068863_100086351 3300005841 Bacteria 2973
78 Ga0068858_100252328 3300005842 Bacteria 1676
79 Ga0068860_100000049 3300005843 Bacteria 208782
80 Ga0068862_100002193 3300005844 Bacteria 17520
81 Ga0081538_10016940 3300005981 Bacteria 5558
82 Ga0081538_10046647 3300005981 Bacteria 2669
83 Ga0081539_10000240 3300005985 Bacteria 128629
84 Ga0081539_10007832 3300005985 Bacteria 9549
85 Ga0070712_100453963 3300006175 Bacteria 1068
86 Ga0075430_100054200 3300006846 Bacteria 3375
87 Ga0075433_10352487 3300006852 Bacteria 1300
88 Ga0075434_100088481 3300006871 Bacteria 3098
89 Ga0075434_100266044 3300006871 Bacteria 1734
90 Ga0075436_100055922 3300006914 Bacteria 2726
91 Ga0075436_100335079 3300006914 Bacteria 1089
92 Ga0097620_100010739 3300006931 Bacteria 9217
93 Ga0097620_100034215 3300006931 Bacteria 5101
94 Ga0075435_100116873 3300007076 Bacteria 2222
95 Ga0075435_100153262 3300007076 Bacteria 1938
96 Ga0105240_10000055 3300009093 Bacteria 225380
97 Ga0105240_10057102 3300009093 Bacteria 4880
98 Ga0105240_10232864 3300009093 Bacteria 2139
99 Ga0105240_10369164 3300009093 Bacteria 1623
100 Ga0105245_10149273 3300009098 Bacteria 2209
101 Ga0105245_10206763 3300009098 Bacteria 1887
102 Ga0114129_10022756 3300009147 Bacteria 8887
103 Ga0105241_10073917 3300009174 Bacteria 2653
104 Ga0105241_10095676 3300009174 Bacteria 2351
105 Ga0105248_10000001 3300009177 Bacteria 1881304
106 Ga0105248_10106261 3300009177 Bacteria 3165
107 Ga0105237_10126530 3300009545 Bacteria 2550
108 Ga0105238_10002643 3300009551 Bacteria 17856
109 Ga0105238_10007300 3300009551 Bacteria 11064
110 Ga0105238_10292719 3300009551 Bacteria 1611
111 Ga0105249_10002539 3300009553 Bacteria 15800
112 Ga0105239_10000716 3300010375 Bacteria 47033
113 Ga0105239_10015106 3300010375 Bacteria 8561
114 Ga0105239_10039965 3300010375 Bacteria 5139
115 Ga0105239_10449826 3300010375 Bacteria 1461
116 Ga0157326_1000576 3300012513 Bacteria 4338
117 Ga0157373_10051367 3300013100 Bacteria 2937
118 Ga0157370_10002861 3300013104 Bacteria 20603
119 Ga0157370_10029106 3300013104 Bacteria 5426
120 Ga0157370_10036835 3300013104 Bacteria 4745
121 Ga0157370_10229949 3300013104 Bacteria 1717
122 Ga0157370_10394275 3300013104 Bacteria 1275
123 Ga0157369_10019195 3300013105 Bacteria 7650
124 Ga0157369_10041558 3300013105 Bacteria 5018
125 Ga0157369_10057196 3300013105 Bacteria 4208
126 Ga0157369_10071135 3300013105 Bacteria 3735
127 Ga0157372_10036986 3300013307 Bacteria 5382
128 Ga0157372_10054113 3300013307 Bacteria 4475
129 Ga0157372_10287040 3300013307 Bacteria 1914
130 Ga0157372_10460718 3300013307 Bacteria 1482
131 Ga0157372_10534145 3300013307 Bacteria 1367
132 Ga0163163_10044569 3300014325 Bacteria 4352
133 Ga0163163_10116577 3300014325 Bacteria 2702
134 Ga0182008_10040755 3300014497 Bacteria 2317
135 Ga0182008_10128702 3300014497 Bacteria 1262
136 Ga0157379_10016993 3300014968 Bacteria 6404
137 Ga0213876_10000405 3300021384 Bacteria 36218
138 Ga0213875_10047747 3300021388 Bacteria 2008
139 Ga0209676_1012496 3300025292 Bacteria 3330
140 Ga0209050_1037649 3300025298 Bacteria 1392
141 Ga0207697_10017709 3300025315 Bacteria 2926
142 Ga0207680_10000815 3300025903 Bacteria 14697
143 Ga0207647_10046556 3300025904 Bacteria 2702
144 Ga0207705_10000058 3300025909 Bacteria 155967
145 Ga0207684_10049335 3300025910 Bacteria 3571
146 Ga0207684_10159205 3300025910 Bacteria 1944
147 Ga0207707_10000002 3300025912 Bacteria 1142054
148 Ga0207707_10000263 3300025912 Bacteria 56613
149 Ga0207707_10003883 3300025912 Bacteria 13254
150 Ga0207707_10088586 3300025912 Bacteria 2704
151 Ga0207695_10000012 3300025913 Bacteria 840961
152 Ga0207695_10031600 3300025913 Bacteria 5803
153 Ga0207693_10159945 3300025915 Bacteria 1772
154 Ga0207660_10001759 3300025917 Bacteria 14508
155 Ga0207660_10012203 3300025917 Bacteria 5613
156 Ga0207660_10043994 3300025917 Bacteria 3140
157 Ga0207660_10101472 3300025917 Bacteria 2150
158 Ga0207657_10000305 3300025919 Bacteria 51999
159 Ga0207657_10068445 3300025919 Bacteria 3016
160 Ga0207652_10000205 3300025921 Bacteria 62657
161 Ga0207652_10003391 3300025921 Bacteria 13158
162 Ga0207652_10061620 3300025921 Bacteria 3240
163 Ga0207652_10104448 3300025921 Bacteria 2506
164 Ga0207652_10445760 3300025921 Bacteria 1167
165 Ga0207694_10000006 3300025924 Bacteria 631109
166 Ga0207694_10120473 3300025924 Bacteria 2095
167 Ga0207694_10159254 3300025924 Bacteria 1823
168 Ga0207650_10020435 3300025925 Bacteria 4670
169 Ga0207650_10083007 3300025925 Bacteria 2433
170 Ga0207659_10148832 3300025926 Bacteria 1826
171 Ga0207687_10132522 3300025927 Bacteria 1881
172 Ga0207644_10000804 3300025931 Bacteria 19896
173 Ga0207644_10008673 3300025931 Bacteria 6651
174 Ga0207644_10082510 3300025931 Bacteria 2378
175 Ga0207690_10009208 3300025932 Bacteria 5862
176 Ga0207706_10212723 3300025933 Bacteria 1694
177 Ga0207665_10003874 3300025939 Bacteria 10005
178 Ga0207711_10000001 3300025941 Bacteria 1325674
179 Ga0207711_10073856 3300025941 Bacteria 2965
180 Ga0207711_10626549 3300025941 Bacteria 1004
181 Ga0207661_10172015 3300025944 Bacteria 1886
182 Ga0207661_10321587 3300025944 Bacteria 1391
183 Ga0207679_10036180 3300025945 Bacteria 3499
184 Ga0207667_10000026 3300025949 Bacteria 343713
185 Ga0207667_10171143 3300025949 Bacteria 2232
186 Ga0207667_10247498 3300025949 Bacteria 1824
187 Ga0207668_10000011 3300025972 Bacteria 184484
188 Ga0207668_10000054 3300025972 Bacteria 95426
189 Ga0207658_10000014 3300025986 Bacteria 218248
190 Ga0207658_10026246 3300025986 Bacteria 4083
191 Ga0207677_10154649 3300026023 Bacteria 1774
192 Ga0207703_10001634 3300026035 Bacteria 20198
193 Ga0207639_10526572 3300026041 Bacteria 1083
194 Ga0207678_10038333 3300026067 Bacteria 4164
195 Ga0207702_10298051 3300026078 Bacteria 1529
196 Ga0207641_10000045 3300026088 Bacteria 181882
197 Ga0207641_10000292 3300026088 Bacteria 62689
198 Ga0207641_10024253 3300026088 Bacteria 5000
199 Ga0207676_10002466 3300026095 Bacteria 13199
200 Ga0207674_10046228 3300026116 Bacteria 4471
201 Ga0207674_10073354 3300026116 Bacteria 3436
202 Ga0207674_10177959 3300026116 Bacteria 2079
203 Ga0207674_10181394 3300026116 Bacteria 2057
204 Ga0207674_10480935 3300026116 Bacteria 1200
205 Ga0207698_10410905 3300026142 Bacteria 1296
206 Ga0209179_1002894 3300027512 Bacteria 2395
207 Ga0268265_10004499 3300028380 Bacteria 9648
208 Ga0268264_10000121 3300028381 Bacteria 190368
209 Ga0268264_10027825 3300028381 Bacteria 4621
210 Ga0265318_10002250 3300028577 Bacteria 10409
211 Ga0265338_10000011 3300028800 Bacteria 433370
212 Ga0265338_10023115 3300028800 Bacteria 6403
213 Ga0265338_10060168 3300028800 Bacteria 3340
214 Ga0265338_10072750 3300028800 Bacteria 2933
215 Ga0265332_10023259 3300031238 Bacteria 2733
216 Ga0265328_10080909 3300031239 Bacteria 1197
217 Ga0265320_10000462 3300031240 Bacteria 31842
218 Ga0265325_10000009 3300031241 Bacteria 184273
219 Ga0265325_10000118 3300031241 Bacteria 54374
220 Ga0265325_10038351 3300031241 Bacteria 2529
221 Ga0265325_10051972 3300031241 Bacteria 2105
222 Ga0265329_10047192 3300031242 Bacteria 1375
223 Ga0265340_10001692 3300031247 Bacteria 12685
224 Ga0265340_10015143 3300031247 Bacteria 4012
225 Ga0265340_10018937 3300031247 Bacteria 3547
226 Ga0265340_10064569 3300031247 Bacteria 1745
227 Ga0265339_10000709 3300031249 Bacteria 25841
228 Ga0265339_10012958 3300031249 Bacteria 5069
229 Ga0265331_10001283 3300031250 Bacteria 18731
230 Ga0265331_10001539 3300031250 Bacteria 16960
231 Ga0265331_10004511 3300031250 Bacteria 8687
232 Ga0265331_10065972 3300031250 Bacteria 1701
233 Ga0265327_10073310 3300031251 Bacteria 1708
234 Ga0265316_10003090 3300031344 Bacteria 16962
235 Ga0265316_10085519 3300031344 Bacteria 2413
236 Ga0265316_10096408 3300031344 Bacteria 2252
237 Ga0265313_10000338 3300031595 Bacteria 50856
238 Ga0265313_10000374 3300031595 Bacteria 48486
239 Ga0265313_10000599 3300031595 Bacteria 37436
240 Ga0265313_10000674 3300031595 Bacteria 35158
241 Ga0265313_10004086 3300031595 Bacteria 11370
242 Ga0265314_10009324 3300031711 Bacteria 8306
243 Ga0265314_10009385 3300031711 Bacteria 8266
244 Ga0265314_10146415 3300031711 Bacteria 1454
245 Ga0265342_10005440 3300031712 Bacteria 9706
246 Ga0307516_10053130 3300031730 Bacteria 3963
247 Ga0307412_10091283 3300031911 Bacteria 2132
248 Ga0307412_10165999 3300031911 Bacteria 1646
249 Ga0307412_10297844 3300031911 Bacteria 1273
250 Ga0307411_10375147 3300032005 Bacteria 1168
251 Ga0373926_0024051 3300035083 Bacteria 2119
252 Ga0373955_0067453 3300035172 Bacteria 1992
253 Ga0316574_0002266 3300035398 Bacteria 9590
254 Ga0373931_0020566 3300035691 Bacteria 3304
255 Ga0373927_0000135 3300035695 Bacteria 56787
256 Ga0373927_0098513 3300035695 Bacteria 1901
257 Ga0373927_0212122 3300035695 Bacteria 1272
258 Ga0373947_0133363 3300035725 Bacteria 1587
259 Ga0373937_0022221 3300036401 Bacteria 5701
260 Ga0373937_0679437 3300036401 Bacteria 976
261 Ga0373925_0001135 3300037068 Bacteria 23635
262 Ga0373925_0040245 3300037068 Bacteria 3460
263 Ga0395900_0000086 3300037418 Bacteria 171749
264 Ga0395900_0216043 3300037418 Bacteria 1935
265 Ga0395898_0000901 3300037466 Bacteria 47807
266 Ga0395905_0000614 3300037471 Bacteria 47761
267 Ga0395905_0001522 3300037471 Bacteria 27718
268 Ga0395905_0012935 3300037471 Bacteria 8022
269 Ga0395905_0045508 3300037471 Bacteria 4115
270 Ga0436364_0030470 3300037853 Bacteria 2196
271 Ga0436364_0212691 3300037853 Bacteria 4484
272 Ga0436364_0680830 3300037853 Bacteria 1969
273 Ga0395901_0000449 3300038443 Bacteria 47853
274 Ga0395901_0365877 3300038443 Bacteria 1486
275 Ga0400484_18877 3300038725 Bacteria 1386
276 Ga0400483_112777 3300039062 Bacteria 6238
277 Ga0400483_239193 3300039062 Bacteria 3397
278 Ga0436365_1419691 3300039437 Bacteria 3265
279 Ga0436365_1445176 3300039437 Bacteria 2494
280 Ga0436365_1513507 3300039437 Bacteria 68714
281 Ga0436360_0216424 3300039438 Bacteria 4260
282 Ga0436360_0492203 3300039438 Bacteria 6569
283 Ga0436360_0998867 3300039438 Bacteria 3383
284 Ga0436360_1157111 3300039438 Bacteria 1296
285 Ga0436361_0477291 3300039447 Bacteria 1829
286 Ga0436363_0959335 3300039450 Bacteria 3085
287 Ga0436362_0908536 3300039453 Bacteria 786
288 Ga0436362_1036236 3300039453 Bacteria 1179
289 Ga0436362_1041227 3300039453 Bacteria 3238
290 Ga0439465_0031482 3300041413 Bacteria 1690
291 Ga0495630_0066581 3300046517 Bacteria 2708
292 Ga0495645_0063811 3300046543 Bacteria 2666
293 Ga0495633_0194329 3300046558 Bacteria 932
294 Ga0495624_0049764 3300046690 Bacteria 2657
295 Ga0495676_0039108 3300047321 Bacteria 3933
296 Ga0495602_0283728 3300048088 Bacteria 1219
297 Ga0496101_0121160 3300048904 Bacteria 1978
298 Ga0496102_0030545 3300048905 Bacteria 4824
299 Ga0496103_0010938 3300048906 Bacteria 5371
300 Ga0496104_0027156 3300048907 Bacteria 5295
301 Ga0496105_0003043 3300048908 Bacteria 12330
302 Ga0496106_0049843 3300048909 Bacteria 3155
303 Ga0496108_0006309 3300048911 Bacteria 9608
304 Ga0496109_0007308 3300048912 Bacteria 9338
305 Ga0496110_0006667 3300048913 Bacteria 9174
306 Ga0496110_0113626 3300048913 Bacteria 2436
307 Ga0496111_0092859 3300048914 Bacteria 2212
308 Ga0496112_0119706 3300048915 Bacteria 2603
309 Ga0496112_0142688 3300048915 Bacteria 2364
310 Ga0496112_0165502 3300048915 Bacteria 2177
311 Ga0496112_0195781 3300048915 Bacteria 1982
312 Ga0496112_0682814 3300048915 Bacteria 955
313 Ga0496113_0010999 3300048916 Bacteria 6014
314 Ga0496115_0012905 3300048918 Bacteria 6299
315 Ga0496119_0000709 3300048922 Bacteria 44727
316 Ga0496121_0006998 3300048924 Bacteria 13702
317 Ga0496122_0010104 3300048925 Bacteria 9795
318 Ga0496122_0072035 3300048925 Bacteria 2459
319 Ga0496123_0001738 3300048926 Bacteria 28825
320 Ga0496126_0000653 3300048929 Bacteria 64292
321 Ga0495682_0008284 3300049460 Bacteria 4104
322 Ga0501031_0019176 3300049568 Bacteria 4454
323 Ga0501031_0045201 3300049568 Bacteria 2873
324 Ga0501031_0139691 3300049568 Bacteria 1583
325 Ga0501032_0000047 3300049569 Bacteria 108107
326 Ga0501032_0061255 3300049569 Bacteria 2523
327 Ga0501032_0162569 3300049569 Bacteria 1466
328 Ga0501032_0204340 3300049569 Bacteria 1289
329 Ga0501033_0015412 3300049570 Bacteria 5798
330 Ga0501033_0017040 3300049570 Bacteria 5491
331 Ga0501033_0017857 3300049570 Bacteria 5356
332 Ga0501033_0021924 3300049570 Bacteria 4820
333 Ga0501033_0131601 3300049570 Bacteria 1812
334 Ga0501033_0210255 3300049570 Bacteria 1387
335 Ga0501033_0274902 3300049570 Bacteria 1190
336 Ga0501033_0360467 3300049570 Bacteria 1017
337 Ga0501034_0000001 3300049571 Bacteria 2184493
338 Ga0501034_0000947 3300049571 Bacteria 42017
339 Ga0501034_0037298 3300049571 Bacteria 4921
340 Ga0501034_0047347 3300049571 Bacteria 4342
341 Ga0501034_0128552 3300049571 Bacteria 2518
342 Ga0501034_0277461 3300049571 Unclassified 1616
343 Ga0501036_0035359 3300049572 Bacteria 4228
344 Ga0501036_0197970 3300049572 Bacteria 1690
345 Ga0501036_0403679 3300049572 Bacteria 1140
346 Ga0501037_0000293 3300049573 Bacteria 42480
347 Ga0501037_0025611 3300049573 Bacteria 4359
348 Ga0501037_0044588 3300049573 Bacteria 3257
349 Ga0501037_0201688 3300049573 Bacteria 1406
350 Ga0501037_0231890 3300049573 Bacteria 1296
351 Ga0501038_0000086 3300049574 Bacteria 78939
352 Ga0501038_0023645 3300049574 Bacteria 5490
353 Ga0501038_0034066 3300049574 Bacteria 4480
354 Ga0501038_0076677 3300049574 Bacteria 2824
355 Ga0501039_0000001 3300049575 Bacteria 449008
356 Ga0501039_0076164 3300049575 Bacteria 2608
357 Ga0501039_0086524 3300049575 Bacteria 2441
358 Ga0501040_0020615 3300049576 Bacteria 4394
359 Ga0501040_0082557 3300049576 Bacteria 2228
360 Ga0501041_0019445 3300049577 Bacteria 4056
361 Ga0501042_0014202 3300049578 Bacteria 5432
362 Ga0501042_0450617 3300049578 Bacteria 933
363 Ga0501043_0000042 3300049579 Bacteria 116080
364 Ga0501043_0015274 3300049579 Bacteria 6015
365 Ga0501043_0032500 3300049579 Bacteria 4103
366 Ga0501043_0069113 3300049579 Bacteria 2774
367 Ga0501043_0080928 3300049579 Bacteria 2552
368 Ga0501043_0157382 3300049579 Bacteria 1777
369 Ga0501043_0224017 3300049579 Bacteria 1454
370 Ga0501043_0387302 3300049579 Bacteria 1058
371 Ga0501043_0498777 3300049579 Bacteria 910
372 Ga0501046_0012304 3300049580 Bacteria 7292
373 Ga0501046_0078856 3300049580 Bacteria 2547
374 Ga0501046_0082533 3300049580 Bacteria 2482
375 Ga0501047_0000896 3300049581 Bacteria 30435
376 Ga0501047_0002217 3300049581 Bacteria 18619
377 Ga0501047_0018676 3300049581 Bacteria 6648
378 Ga0501047_0037821 3300049581 Bacteria 4667
379 Ga0501047_0141420 3300049581 Bacteria 2285
380 Ga0501047_0148022 3300049581 Bacteria 2225
381 Ga0501047_0183743 3300049581 Bacteria 1956
382 Ga0501047_0291183 3300049581 Bacteria 1476
383 Ga0501047_0449927 3300049581 Bacteria 1117
384 Ga0501047_0626360 3300049581 Bacteria 896
385 Ga0501048_0042043 3300049582 Bacteria 3274
386 Ga0501067_0000181 3300049583 Bacteria 35717
387 Ga0501067_0037403 3300049583 Bacteria 2696
388 Ga0501067_0188429 3300049583 Bacteria 1149
389 Ga0501068_0058828 3300049584 Bacteria 2333
390 Ga0501069_0000001 3300049585 Bacteria 289100
391 Ga0501069_0001060 3300049585 Bacteria 13174
392 Ga0501069_0004580 3300049585 Bacteria 7148
393 Ga0501069_0022931 3300049585 Bacteria 3399
394 Ga0501069_0164053 3300049585 Bacteria 1280
395 Ga0501070_0000358 3300049586 Bacteria 41528
396 Ga0501070_0001014 3300049586 Bacteria 25206
397 Ga0501070_0006287 3300049586 Bacteria 10109
398 Ga0501070_0025869 3300049586 Bacteria 4923
399 Ga0501070_0038915 3300049586 Bacteria 3968
400 Ga0501070_0046177 3300049586 Bacteria 3622
401 Ga0501070_0189891 3300049586 Bacteria 1689
402 Ga0501070_0235488 3300049586 Bacteria 1499
403 Ga0501070_0289067 3300049586 Bacteria 1336
404 Ga0501070_0313051 3300049586 Bacteria 1278
405 Ga0501070_0504659 3300049586 Bacteria 972
406 Ga0501071_0026885 3300049587 Bacteria 4043
407 Ga0501071_0038992 3300049587 Bacteria 3398
408 Ga0501072_0005246 3300049588 Bacteria 9866
409 Ga0501072_0024916 3300049588 Bacteria 4658
410 Ga0501072_0218878 3300049588 Bacteria 1518
411 Ga0501072_0404677 3300049588 Bacteria 1082
412 Ga0501073_0014465 3300049589 Bacteria 5733
413 Ga0501073_0018634 3300049589 Bacteria 5017
414 Ga0501073_0057026 3300049589 Bacteria 2731
415 Ga0501073_0071598 3300049589 Bacteria 2415
416 Ga0501073_0077595 3300049589 Bacteria 2311
417 Ga0501074_0000335 3300049590 Bacteria 27393
418 Ga0501074_0109052 3300049590 Bacteria 1981
419 Ga0501075_0023942 3300049591 Bacteria 4472
420 Ga0501075_0462090 3300049591 Bacteria 968
421 Ga0501076_0367847 3300049592 Bacteria 1181
422 Ga0501077_0053824 3300049593 Bacteria 2555
423 Ga0501077_0168557 3300049593 Bacteria 1391
424 Ga0501198_016011 3300049649 Bacteria 1155
425 Ga0501249_000235 3300049679 Bacteria 16458
426 Ga0501079_0001647 3300049741 Bacteria 15901
427 Ga0501079_0018932 3300049741 Bacteria 5261
428 Ga0501079_0451011 3300049741 Bacteria 1010
429 Ga0501080_0006568 3300049742 Bacteria 10449
430 Ga0501080_0014889 3300049742 Bacteria 7162
431 Ga0501080_0081344 3300049742 Bacteria 3009
432 Ga0501080_0086362 3300049742 Bacteria 2915
433 Ga0501080_0164263 3300049742 Bacteria 2049
434 Ga0501080_0185526 3300049742 Bacteria 1913
435 Ga0501080_0205715 3300049742 Bacteria 1805
436 Ga0501080_0456068 3300049742 Bacteria 1146
437 Ga0501080_0724615 3300049742 Bacteria 876
438 Ga0501081_0150632 3300049743 Bacteria 1671
439 Ga0501081_0165426 3300049743 Unclassified 1595
440 Ga0501083_0001894 3300049744 Bacteria 14360
441 Ga0501083_0074594 3300049744 Bacteria 2253
442 Ga0501083_0227334 3300049744 Bacteria 1215
443 Ga0501083_0393086 3300049744 Bacteria 902
444 Ga0501035_0003929 3300049822 Bacteria 14176
445 Ga0501035_0005096 3300049822 Bacteria 12443
446 Ga0501035_0005635 3300049822 Bacteria 11824
447 Ga0501035_0007474 3300049822 Bacteria 10206
448 Ga0501035_0013088 3300049822 Bacteria 7657
449 Ga0501035_0023276 3300049822 Bacteria 5681
450 Ga0501035_0035312 3300049822 Bacteria 4537
451 Ga0501035_0045707 3300049822 Bacteria 3939
452 Ga0501035_0302467 3300049822 Bacteria 1347
453 Ga0501044_0000018 3300049823 Bacteria 225885
454 Ga0501044_0024278 3300049823 Bacteria 6439
455 Ga0501044_0027344 3300049823 Bacteria 6029
456 Ga0501044_0034423 3300049823 Bacteria 5312
457 Ga0501044_0055015 3300049823 Bacteria 4088
458 Ga0501044_0071478 3300049823 Bacteria 3528
459 Ga0501044_0084902 3300049823 Bacteria 3199
460 Ga0501044_0251116 3300049823 Bacteria 1710
461 Ga0501044_0352877 3300049823 Bacteria 1390
462 Ga0501044_0583329 3300049823 Bacteria 1012
463 Ga0501045_0037766 3300049824 Bacteria 3511
464 Ga0501045_0069567 3300049824 Bacteria 2588
465 Ga0501204_000412 3300049850 Bacteria 3682
466 nmdc:mga07m45_192194_c1 3300050496 Bacteria 1187
467 nmdc:mga0qj67_42724_c1 3300050509 Bacteria 3568
468 nmdc:mga0n895_122045_c1 3300050512 Bacteria 2627
469 nmdc:mga0rr50_301381_c1 3300050513 Bacteria 1341
470 nmdc:mga0rr50_88056_c1 3300050513 Bacteria 2411
471 nmdc:mga08x19_29144_c1 3300050514 Bacteria 3461
472 nmdc:mga08x19_63076_c1 3300050514 Bacteria 2404
473 nmdc:mga0a205_138332_c1 3300050515 Bacteria 2335
474 Ga0500643_000566 3300053087 Bacteria 25752
475 Ga0500556_0000077 3300053104 Bacteria 94403
476 Ga0500556_0026099 3300053104 Bacteria 1937
477 Ga0500642_0011560 3300053130 Bacteria 3163
478 Ga0500655_003110 3300053133 Bacteria 3013
479 Ga0500622_0000541 3300053156 Bacteria 34818
480 Ga0500639_078010 3300053163 Bacteria 1674
481 Ga0500636_0003367 3300053177 Bacteria 8991
482 Ga0500645_018360 3300053730 Unclassified 2185
483 Ga0501084_0001715 3300054114 Bacteria 17404
484 Ga0501084_0075963 3300054114 Bacteria 2815
485 Ga0501084_0109421 3300054114 Bacteria 2322
486 Ga0501084_0154708 3300054114 Bacteria 1933
487 Ga0501084_0182628 3300054114 Bacteria 1771
488 Ga0501082_0055341 3300060353 Bacteria 3418
489 Ga0501082_0138626 3300060353 Bacteria 2111
490 Ga0501082_0183006 3300060353 Bacteria 1822
491 Ga0501082_0203063 3300060353 Bacteria 1724
492 Ga0501082_0544097 3300060353 Bacteria 1015
493 Ga0530510_0016287 3300061734 Bacteria 5258
494 2512031993 2511231221 Bacteria 6846400
495 2599102741 2597490356 Bacteria 7030811
496 2643728006 2643221541 Bacteria 5498788
497 2644039265 2643221605 Bacteria 4772303
498 2644043044 2643221606 Bacteria 5588032
499 2644131552 2643221623 Bacteria 5239945
500 2644395525 2643221671 Bacteria 5496681
501 2770198369 2767802442 Bacteria 5747986
502 2776269619 2775506902 Bacteria 6208009
503 2776282550 2775506904 Bacteria 5954060
504 2821450182 2821443989 Bacteria 7658172
505 2840766318 2840764183 Bacteria 6358399
506 2846952615 2846952575 Bacteria 6587527
507 2848861105 2848858292 Bacteria 7391279
508 2883359962 2883354860 Bacteria 5865246
509 2883579553 2883577096 Bacteria 4709178
510 2894653806 2894652903 Bacteria 4587256
511 2894774105 2894772417 Bacteria 5305674
512 2919452671 2919450847 Bacteria 5631160
513 2929200446 2929199973 Bacteria 7260745
514 2937848645 2937843397 Bacteria 5256375
515 2996315270 2996310559 Bacteria 6357320
516 8001846958 8001845381 Bacteria 5804942
517 8054005826 8054002106 Bacteria 7987183
518 8055914763 8055909800 Bacteria 7278581
519 Ga0436360_0810858
520 JGI24746J21847_1007479
521 JGI24743J22301_10002955
522 JGI24745J21846_1003424
523 JGI24738J21930_10003763
524 JGI25406J46586_10000405
525 Ga0055536_1015958
526 Ga0070658_10232890
527 Ga0070670_100002057
528 Ga0070670_100061311
529 Ga0070666_10001390
530 Ga0070666_10159308
531 Ga0070680_100000317
532 Ga0070680_100038054
533 Ga0070660_100001661
534 Ga0070689_100348941
535 Ga0070691_10000082
536 Ga0070691_10013637
537 Ga0070661_100075991
538 Ga0070661_100123255
539 Ga0070668_100000007
540 Ga0070668_100000030
541 Ga0070668_100010669
542 Ga0070669_100167747
543 Ga0070671_100000125
544 Ga0070671_100001727
545 Ga0070671_100060397
546 Ga0070673_100440762
547 Ga0070659_100003489
548 Ga0070659_100362409
549 Ga0070667_100000071
550 Ga0070667_100029011
551 Ga0070709_10001323
552 Ga0070709_10069288
553 Ga0070714_100145560
554 Ga0070714_100161715
555 Ga0070714_100419557
556 Ga0070713_100629406
557 Ga0070713_100695964
558 Ga0070711_100255841
559 Ga0070663_100022278
560 Ga0070663_100036891
561 Ga0070681_10000002
562 Ga0070681_10057538
563 Ga0070681_10159118
564 Ga0070706_100040722
565 Ga0070707_100305129
566 Ga0070679_100000865
567 Ga0070679_100001275
568 Ga0070679_100115879
569 Ga0070679_100301185
570 Ga0070679_100394675
571 Ga0070679_100472845
572 Ga0070697_100115990
573 Ga0070697_100163885
574 Ga0068853_100000169
575 Ga0068853_100031789
576 Ga0070696_100086544
577 Ga0070693_100247630
578 Ga0070665_100055730
579 Ga0068855_100000069
580 Ga0068855_100009020
581 Ga0070664_100036488
582 Ga0068857_100089470
583 Ga0068857_100157428
584 Ga0068857_100194522
585 Ga0068857_100265185
586 Ga0068854_100004844
587 Ga0068856_100123639
588 Ga0068852_100072950
589 Ga0068859_100010739
590 Ga0068859_100034215
591 Ga0068864_100003212
592 Ga0068864_100467164
593 Ga0068864_100533886
594 Ga0068863_100000027
595 Ga0068863_100086351
596 Ga0068858_100252328
597 Ga0068860_100000049
598 Ga0068862_100002193
599 Ga0081538_10016940
600 Ga0081538_10046647
601 Ga0081539_10000240
602 Ga0081539_10007832
603 Ga0070712_100453963
604 Ga0075430_100054200
605 Ga0075433_10352487
606 Ga0075434_100088481
607 Ga0075434_100266044
608 Ga0075436_100055922
609 Ga0075436_100335079
610 Ga0097620_100010739
611 Ga0097620_100034215
612 Ga0075435_100116873
613 Ga0075435_100153262
614 Ga0105240_10000055
615 Ga0105240_10057102
616 Ga0105240_10232864
617 Ga0105240_10369164
618 Ga0105245_10149273
619 Ga0105245_10206763
620 Ga0114129_10022756
621 Ga0105241_10073917
622 Ga0105241_10095676
623 Ga0105248_10000001
624 Ga0105248_10106261
625 Ga0105237_10126530
626 Ga0105238_10002643
627 Ga0105238_10007300
628 Ga0105238_10292719
629 Ga0105249_10002539
630 Ga0105239_10000716
631 Ga0105239_10015106
632 Ga0105239_10039965
633 Ga0105239_10449826
634 Ga0157326_1000576
635 Ga0157373_10051367
636 Ga0157370_10002861
637 Ga0157370_10029106
638 Ga0157370_10036835
639 Ga0157370_10229949
640 Ga0157370_10394275
641 Ga0157369_10019195
642 Ga0157369_10041558
643 Ga0157369_10057196
644 Ga0157369_10071135
645 Ga0157372_10036986
646 Ga0157372_10054113
647 Ga0157372_10287040
648 Ga0157372_10460718
649 Ga0157372_10534145
650 Ga0163163_10044569
651 Ga0163163_10116577
652 Ga0182008_10040755
653 Ga0182008_10128702
654 Ga0157379_10016993
655 Ga0213876_10000405
656 Ga0213875_10047747
657 Ga0209676_1012496
658 Ga0209050_1037649
659 Ga0207697_10017709
660 Ga0207680_10000815
661 Ga0207647_10046556
662 Ga0207705_10000058
663 Ga0207684_10049335
664 Ga0207684_10159205
665 Ga0207707_10000002
666 Ga0207707_10000263
667 Ga0207707_10003883
668 Ga0207707_10088586
669 Ga0207695_10000012
670 Ga0207695_10031600
671 Ga0207693_10159945
672 Ga0207660_10001759
673 Ga0207660_10012203
674 Ga0207660_10043994
675 Ga0207660_10101472
676 Ga0207657_10000305
677 Ga0207657_10068445
678 Ga0207652_10000205
679 Ga0207652_10003391
680 Ga0207652_10061620
681 Ga0207652_10104448
682 Ga0207652_10445760
683 Ga0207694_10000006
684 Ga0207694_10120473
685 Ga0207694_10159254
686 Ga0207650_10020435
687 Ga0207650_10083007
688 Ga0207659_10148832
689 Ga0207687_10132522
690 Ga0207644_10000804
691 Ga0207644_10008673
692 Ga0207644_10082510
693 Ga0207690_10009208
694 Ga0207706_10212723
695 Ga0207665_10003874
696 Ga0207711_10000001
697 Ga0207711_10073856
698 Ga0207711_10626549
699 Ga0207661_10172015
700 Ga0207661_10321587
701 Ga0207679_10036180
702 Ga0207667_10000026
703 Ga0207667_10171143
704 Ga0207667_10247498
705 Ga0207668_10000011
706 Ga0207668_10000054
707 Ga0207658_10000014
708 Ga0207658_10026246
709 Ga0207677_10154649
710 Ga0207703_10001634
711 Ga0207639_10526572
712 Ga0207678_10038333
713 Ga0207702_10298051
714 Ga0207641_10000045
715 Ga0207641_10000292
716 Ga0207641_10024253
717 Ga0207676_10002466
718 Ga0207674_10046228
719 Ga0207674_10073354
720 Ga0207674_10177959
721 Ga0207674_10181394
722 Ga0207674_10480935
723 Ga0207698_10410905
724 Ga0209179_1002894
725 Ga0268265_10004499
726 Ga0268264_10000121
727 Ga0268264_10027825
728 Ga0265318_10002250
729 Ga0265338_10000011
730 Ga0265338_10023115
731 Ga0265338_10060168
732 Ga0265338_10072750
733 Ga0265332_10023259
734 Ga0265328_10080909
735 Ga0265320_10000462
736 Ga0265325_10000009
737 Ga0265325_10000118
738 Ga0265325_10038351
739 Ga0265325_10051972
740 Ga0265329_10047192
741 Ga0265340_10001692
742 Ga0265340_10015143
743 Ga0265340_10018937
744 Ga0265340_10064569
745 Ga0265339_10000709
746 Ga0265339_10012958
747 Ga0265331_10001283
748 Ga0265331_10001539
749 Ga0265331_10004511
750 Ga0265331_10065972
751 Ga0265327_10073310
752 Ga0265316_10003090
753 Ga0265316_10085519
754 Ga0265316_10096408
755 Ga0265313_10000338
756 Ga0265313_10000374
757 Ga0265313_10000599
758 Ga0265313_10000674
759 Ga0265313_10004086
760 Ga0265314_10009324
761 Ga0265314_10009385
762 Ga0265314_10146415
763 Ga0265342_10005440
764 Ga0307516_10053130
765 Ga0307412_10091283
766 Ga0307412_10165999
767 Ga0307412_10297844
768 Ga0307411_10375147
769 Ga0373926_0024051
770 Ga0373955_0067453
771 Ga0316574_0002266
772 Ga0373931_0020566
773 Ga0373927_0000135
774 Ga0373927_0098513
775 Ga0373927_0212122
776 Ga0373947_0133363
777 Ga0373937_0022221
778 Ga0373937_0679437
779 Ga0373925_0001135
780 Ga0373925_0040245
781 Ga0395900_0000086
782 Ga0395900_0216043
783 Ga0395898_0000901
784 Ga0395905_0000614
785 Ga0395905_0001522
786 Ga0395905_0012935
787 Ga0395905_0045508
788 Ga0436364_0030470
789 Ga0436364_0212691
790 Ga0436364_0680830
791 Ga0395901_0000449
792 Ga0395901_0365877
793 Ga0400484_18877
794 Ga0400483_112777
795 Ga0400483_239193
796 Ga0436365_1419691
797 Ga0436365_1445176
798 Ga0436365_1513507
799 Ga0436360_0216424
800 Ga0436360_0492203
801 Ga0436360_0998867
802 Ga0436360_1157111
803 Ga0436361_0477291
804 Ga0436363_0959335
805 Ga0436362_0908536
806 Ga0436362_1036236
807 Ga0436362_1041227
808 Ga0439465_0031482
809 Ga0495630_0066581
810 Ga0495645_0063811
811 Ga0495633_0194329
812 Ga0495624_0049764
813 Ga0495676_0039108
814 Ga0495602_0283728
815 Ga0496101_0121160
816 Ga0496102_0030545
817 Ga0496103_0010938
818 Ga0496104_0027156
819 Ga0496105_0003043
820 Ga0496106_0049843
821 Ga0496108_0006309
822 Ga0496109_0007308
823 Ga0496110_0006667
824 Ga0496110_0113626
825 Ga0496111_0092859
826 Ga0496112_0119706
827 Ga0496112_0142688
828 Ga0496112_0165502
829 Ga0496112_0195781
830 Ga0496112_0682814
831 Ga0496113_0010999
832 Ga0496115_0012905
833 Ga0496119_0000709
834 Ga0496121_0006998
835 Ga0496122_0010104
836 Ga0496122_0072035
837 Ga0496123_0001738
838 Ga0496126_0000653
839 Ga0495682_0008284
840 Ga0501031_0019176
841 Ga0501031_0045201
842 Ga0501031_0139691
843 Ga0501032_0000047
844 Ga0501032_0061255
845 Ga0501032_0162569
846 Ga0501032_0204340
847 Ga0501033_0015412
848 Ga0501033_0017040
849 Ga0501033_0017857
850 Ga0501033_0021924
851 Ga0501033_0131601
852 Ga0501033_0210255
853 Ga0501033_0274902
854 Ga0501033_0360467
855 Ga0501034_0000001
856 Ga0501034_0000947
857 Ga0501034_0037298
858 Ga0501034_0047347
859 Ga0501034_0128552
860 Ga0501034_0277461
861 Ga0501036_0035359
862 Ga0501036_0197970
863 Ga0501036_0403679
864 Ga0501037_0000293
865 Ga0501037_0025611
866 Ga0501037_0044588
867 Ga0501037_0201688
868 Ga0501037_0231890
869 Ga0501038_0000086
870 Ga0501038_0023645
871 Ga0501038_0034066
872 Ga0501038_0076677
873 Ga0501039_0000001
874 Ga0501039_0076164
875 Ga0501039_0086524
876 Ga0501040_0020615
877 Ga0501040_0082557
878 Ga0501041_0019445
879 Ga0501042_0014202
880 Ga0501042_0450617
881 Ga0501043_0000042
882 Ga0501043_0015274
883 Ga0501043_0032500
884 Ga0501043_0069113
885 Ga0501043_0080928
886 Ga0501043_0157382
887 Ga0501043_0224017
888 Ga0501043_0387302
889 Ga0501043_0498777
890 Ga0501046_0012304
891 Ga0501046_0078856
892 Ga0501046_0082533
893 Ga0501047_0000896
894 Ga0501047_0002217
895 Ga0501047_0018676
896 Ga0501047_0037821
897 Ga0501047_0141420
898 Ga0501047_0148022
899 Ga0501047_0183743
900 Ga0501047_0291183
901 Ga0501047_0449927
902 Ga0501047_0626360
903 Ga0501048_0042043
904 Ga0501067_0000181
905 Ga0501067_0037403
906 Ga0501067_0188429
907 Ga0501068_0058828
908 Ga0501069_0000001
909 Ga0501069_0001060
910 Ga0501069_0004580
911 Ga0501069_0022931
912 Ga0501069_0164053
913 Ga0501070_0000358
914 Ga0501070_0001014
915 Ga0501070_0006287
916 Ga0501070_0025869
917 Ga0501070_0038915
918 Ga0501070_0046177
919 Ga0501070_0189891
920 Ga0501070_0235488
921 Ga0501070_0289067
922 Ga0501070_0313051
923 Ga0501070_0504659
924 Ga0501071_0026885
925 Ga0501071_0038992
926 Ga0501072_0005246
927 Ga0501072_0024916
928 Ga0501072_0218878
929 Ga0501072_0404677
930 Ga0501073_0014465
931 Ga0501073_0018634
932 Ga0501073_0057026
933 Ga0501073_0071598
934 Ga0501073_0077595
935 Ga0501074_0000335
936 Ga0501074_0109052
937 Ga0501075_0023942
938 Ga0501075_0462090
939 Ga0501076_0367847
940 Ga0501077_0053824
941 Ga0501077_0168557
942 Ga0501198_016011
943 Ga0501249_000235
944 Ga0501079_0001647
945 Ga0501079_0018932
946 Ga0501079_0451011
947 Ga0501080_0006568
948 Ga0501080_0014889
949 Ga0501080_0081344
950 Ga0501080_0086362
951 Ga0501080_0164263
952 Ga0501080_0185526
953 Ga0501080_0205715
954 Ga0501080_0456068
955 Ga0501080_0724615
956 Ga0501081_0150632
957 Ga0501081_0165426
958 Ga0501083_0001894
959 Ga0501083_0074594
960 Ga0501083_0227334
961 Ga0501083_0393086
962 Ga0501035_0003929
963 Ga0501035_0005096
964 Ga0501035_0005635
965 Ga0501035_0007474
966 Ga0501035_0013088
967 Ga0501035_0023276
968 Ga0501035_0035312
969 Ga0501035_0045707
970 Ga0501035_0302467
971 Ga0501044_0000018
972 Ga0501044_0024278
973 Ga0501044_0027344
974 Ga0501044_0034423
975 Ga0501044_0055015
976 Ga0501044_0071478
977 Ga0501044_0084902
978 Ga0501044_0251116
979 Ga0501044_0352877
980 Ga0501044_0583329
981 Ga0501045_0037766
982 Ga0501045_0069567
983 Ga0501204_000412
984 nmdc:mga07m45_192194_c1
985 nmdc:mga0qj67_42724_c1
986 nmdc:mga0n895_122045_c1
987 nmdc:mga0rr50_301381_c1
988 nmdc:mga0rr50_88056_c1
989 nmdc:mga08x19_29144_c1
990 nmdc:mga08x19_63076_c1
991 nmdc:mga0a205_138332_c1
992 Ga0500643_000566
993 Ga0500556_0000077
994 Ga0500556_0026099
995 Ga0500642_0011560
996 Ga0500655_003110
997 Ga0500622_0000541
998 Ga0500639_078010
999 Ga0500636_0003367
1000 Ga0500645_018360
1001 Ga0501084_0001715
1002 Ga0501084_0075963
1003 Ga0501084_0109421
1004 Ga0501084_0154708
1005 Ga0501084_0182628
1006 Ga0501082_0055341
1007 Ga0501082_0138626
1008 Ga0501082_0183006
1009 Ga0501082_0203063
1010 Ga0501082_0544097
1011 Ga0530510_0016287
1012 2512031993
1013 2599102741
1014 2643728006
1015 2644039265
1016 2644043044
1017 2644131552
1018 2644395525
1019 2770198369
1020 2776269619
1021 2776282550
1022 2821450182
1023 2840766318
1024 2846952615
1025 2848861105
1026 2883359962
1027 2883579553
1028 2894653806
1029 2894774105
1030 2919452671
1031 2929200446
1032 2937848645
1033 2996315270
1034 8001846958
1035 8054005826
1036 8055914763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

68

321

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.8929 24 271
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.8897 24 271
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.8886 24 271
1ako-assembly1.cif.gz_A exonuclease iii from escherichia coli 0.8854 24 269
1e9n-assembly1.cif.gz_A a second divalent metal ion in the active site of a new crystal form of human apurinic/apyrimidinic endonuclease, ape1, and its implications for the catalytic mechanism 0.8724 24 271
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8855 24 271 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8853 24 271 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8818 24 269 3.60.10.10
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8793 24 269 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8553 24 271 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A519JB75-F1-model_v4 Exodeoxyribonuclease III 0.987 110 271 GO:0006281
GO:0008311
GO:0046872
AF-A0A258E8S5-F1-model_v4 Exodeoxyribonuclease III 0.9855 133 271 GO:0006281
GO:0008311
AF-A0A2S5MGI2-F1-model_v4 Exodeoxyribonuclease III 0.9782 24 90 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-R5QRJ2-F1-model_v4 deleted 0.9767 22 271
AF-A0A3B9FF77-F1-model_v4 Exodeoxyribonuclease III 0.9758 113 269 GO:0006281
GO:0008311
GO:0046872

Map