F458279

General Info

Members Datasets Scaffolds Average Seq Length
518 247 1036 192

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0143034|Ga0373927_0143034_664_1347
Length 227
Sequence MPPNRRSGGEYFHTIAVWAGRLKVLERPDSTEHQPHGGSEVSLSDRDEWIRPQALAIPKEGYFKLEQGKYGPVFPKTPACHGFTIIAKIKPGREQVIREYGKTLEVALESDPSVLAPLKLHYLRWVLFDIGKDTYFMYQGIFDTEFDRYTDDAVALFTKSGISTTFENLEGFPEDWKTNVPAFIKFVREHQCPSFLEYGEYPYVTADEIKKALRLKKAFSEMLDQMQ

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
246 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
247 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 1.74
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.86
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 8.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0143034 3300035695 Bacteria 1565
2 ARCol0yngRDRAFT_1004387 3300000652 Bacteria 1025
3 Ga0058861_10086937 3300004800 Bacteria 3212
4 Ga0058861_11591617 3300004800 Bacteria 951
5 Ga0058862_12743767 3300004803 Bacteria 832
6 Ga0065704_10013021 3300005289 Bacteria 1706
7 Ga0065704_10047804 3300005289 Bacteria 795
8 Ga0065712_10321071 3300005290 Bacteria 828
9 Ga0065715_10190665 3300005293 Bacteria 1417
10 Ga0065707_10014982 3300005295 Bacteria 1850
11 Ga0065707_10334152 3300005295 Bacteria 944
12 Ga0070683_100002410 3300005329 Bacteria 14856
13 Ga0070683_100224109 3300005329 Bacteria 1787
14 Ga0070690_100000451 3300005330 Bacteria 20632
15 Ga0070666_10117664 3300005335 Bacteria 1841
16 Ga0068868_100027638 3300005338 Bacteria 4328
17 Ga0068868_100470471 3300005338 Unclassified 1096
18 Ga0070687_100052037 3300005343 Bacteria 2124
19 Ga0070668_100246381 3300005347 Bacteria 1482
20 Ga0070675_100513238 3300005354 Bacteria 1081
21 Ga0070671_100190776 3300005355 Bacteria 1737
22 Ga0070671_101407799 3300005355 Bacteria 616
23 Ga0070673_100844663 3300005364 Bacteria 847
24 Ga0070659_100021245 3300005366 Bacteria 4939
25 Ga0070709_10000266 3300005434 Bacteria 33494
26 Ga0070714_100014218 3300005435 Bacteria 6392
27 Ga0070714_100300115 3300005435 Unclassified 1497
28 Ga0070714_100525987 3300005435 Bacteria 1130
29 Ga0070713_100000756 3300005436 Bacteria 20685
30 Ga0070713_100002186 3300005436 Bacteria 12660
31 Ga0070713_100170461 3300005436 Bacteria 1950
32 Ga0070713_100229648 3300005436 Bacteria 1686
33 Ga0070713_100984023 3300005436 Unclassified 813
34 Ga0070713_101554838 3300005436 Bacteria 642
35 Ga0070710_10001776 3300005437 Bacteria 10199
36 Ga0070710_10026382 3300005437 Bacteria 3086
37 Ga0070710_10030716 3300005437 Bacteria 2893
38 Ga0070711_100003038 3300005439 Bacteria 9703
39 Ga0070711_100005393 3300005439 Bacteria 7651
40 Ga0070711_100324673 3300005439 Bacteria 1231
41 Ga0070711_100642231 3300005439 Bacteria 889
42 Ga0070705_100298831 3300005440 Bacteria 1153
43 Ga0070700_100512044 3300005441 Bacteria 925
44 Ga0070694_100279298 3300005444 Bacteria 1273
45 Ga0070708_100315806 3300005445 Bacteria 1472
46 Ga0070678_100118239 3300005456 Bacteria 2086
47 Ga0070681_10242076 3300005458 Bacteria 1717
48 Ga0070681_10405076 3300005458 Unclassified 1275
49 Ga0068867_100197404 3300005459 Bacteria 1609
50 Ga0070706_100328144 3300005467 Bacteria 1427
51 Ga0070706_100539208 3300005467 Bacteria 1085
52 Ga0070699_100645966 3300005518 Bacteria 966
53 Ga0070679_100082258 3300005530 Bacteria 3210
54 Ga0070679_100474916 3300005530 Bacteria 1195
55 Ga0070684_100189142 3300005535 Bacteria 1873
56 Ga0070684_100249320 3300005535 Bacteria 1623
57 Ga0070684_100334811 3300005535 Bacteria 1391
58 Ga0070697_100252401 3300005536 Bacteria 1508
59 Ga0070697_100609597 3300005536 Bacteria 960
60 Ga0070697_100885392 3300005536 Bacteria 792
61 Ga0068853_100251751 3300005539 Bacteria 1621
62 Ga0070686_100007888 3300005544 Bacteria 5950
63 Ga0070696_100175052 3300005546 Bacteria 1589
64 Ga0070693_100523051 3300005547 Bacteria 845
65 Ga0070693_100998053 3300005547 Bacteria 633
66 Ga0070665_100035911 3300005548 Bacteria 4986
67 Ga0070665_100312620 3300005548 Bacteria 1575
68 Ga0070704_100049540 3300005549 Bacteria 2947
69 Ga0068855_100087253 3300005563 Bacteria 3607
70 Ga0068855_100860588 3300005563 Bacteria 960
71 Ga0070664_100150100 3300005564 Bacteria 2057
72 Ga0068857_100021188 3300005577 Bacteria 5719
73 Ga0068857_100121089 3300005577 Bacteria 2356
74 Ga0068857_100126482 3300005577 Bacteria 2303
75 Ga0068854_100008860 3300005578 Bacteria 6475
76 Ga0068854_100778258 3300005578 Bacteria 832
77 Ga0068856_100211868 3300005614 Unclassified 1953
78 Ga0068856_100410637 3300005614 Bacteria 1374
79 Ga0068856_100595982 3300005614 Bacteria 1126
80 Ga0068859_100478469 3300005617 Bacteria 1341
81 Ga0068866_10115164 3300005718 Bacteria 1506
82 Ga0068860_100495045 3300005843 Bacteria 1220
83 Ga0081455_10098758 3300005937 Bacteria 2350
84 Ga0081538_10011926 3300005981 Bacteria 7012
85 Ga0070717_10003407 3300006028 Bacteria 11374
86 Ga0070717_10010220 3300006028 Bacteria 7071
87 Ga0070717_10023116 3300006028 Unclassified 4921
88 Ga0075432_10076366 3300006058 Bacteria 1209
89 Ga0070715_10008716 3300006163 Bacteria 3546
90 Ga0070715_10123999 3300006163 Bacteria 1235
91 Ga0070715_10204182 3300006163 Bacteria 1006
92 Ga0070716_100002056 3300006173 Bacteria 9212
93 Ga0070716_100022765 3300006173 Plasmid 3315
94 Ga0070716_100144708 3300006173 Bacteria 1521
95 Ga0070716_100160540 3300006173 Bacteria 1456
96 Ga0070712_100000168 3300006175 Bacteria 35814
97 Ga0070712_100001751 3300006175 Bacteria 13278
98 Ga0070712_100077808 3300006175 Unclassified 2392
99 Ga0070712_100214171 3300006175 Bacteria 1521
100 Ga0070712_100383015 3300006175 Bacteria 1158
101 Ga0097621_100012103 3300006237 Bacteria 6385
102 Ga0097621_100067430 3300006237 Unclassified 2949
103 Ga0068871_100006792 3300006358 Bacteria 8134
104 Ga0068871_100664594 3300006358 Bacteria 952
105 Ga0075434_100205629 3300006871 Bacteria 1989
106 Ga0075434_100206662 3300006871 Bacteria 1984
107 Ga0075434_100627878 3300006871 Bacteria 1093
108 Ga0068865_100073632 3300006881 Bacteria 2429
109 Ga0068865_101329312 3300006881 Bacteria 640
110 Ga0097620_100478436 3300006931 Bacteria 1341
111 Ga0099794_10010698 3300007265 Bacteria 3902
112 Ga0099794_10071670 3300007265 Bacteria 1698
113 Ga0099794_10102245 3300007265 Bacteria 1431
114 Ga0099795_10073832 3300007788 Bacteria 1292
115 Ga0099795_10299894 3300007788 Bacteria 706
116 Ga0105240_10469076 3300009093 Bacteria 1405
117 Ga0105240_10887711 3300009093 Bacteria 960
118 Ga0105245_10014252 3300009098 Bacteria 6926
119 Ga0105247_10234687 3300009101 Bacteria 1247
120 Ga0114129_10053787 3300009147 Bacteria 5647
121 Ga0114129_10253791 3300009147 Bacteria 2360
122 Ga0114129_10790797 3300009147 Unclassified 1211
123 Ga0105243_11187283 3300009148 Bacteria 776
124 Ga0105241_10009797 3300009174 Bacteria 7041
125 Ga0105241_10092738 3300009174 Bacteria 2385
126 Ga0105241_10640717 3300009174 Bacteria 964
127 Ga0105242_10012110 3300009176 Bacteria 6636
128 Ga0105242_10574462 3300009176 Unclassified 1085
129 Ga0105248_10118400 3300009177 Bacteria 2988
130 Ga0105248_10150310 3300009177 Bacteria 2627
131 Ga0105248_10698201 3300009177 Bacteria 1145
132 Ga0105248_10913951 3300009177 Bacteria 991
133 Ga0105237_10152841 3300009545 Bacteria 2304
134 Ga0105237_10291452 3300009545 Bacteria 1635
135 Ga0105237_10355037 3300009545 Bacteria 1470
136 Ga0105238_10093297 3300009551 Bacteria 2998
137 Ga0105238_10274454 3300009551 Bacteria 1667
138 Ga0105238_10477583 3300009551 Bacteria 1246
139 Ga0105238_10758321 3300009551 Bacteria 985
140 Ga0105238_11113525 3300009551 Unclassified 813
141 Ga0105030_102389 3300009987 Bacteria 1638
142 Ga0099796_10043079 3300010159 Unclassified 1536
143 Ga0099796_10193076 3300010159 Bacteria 823
144 Ga0105239_10037460 3300010375 Bacteria 5316
145 Ga0105239_10563409 3300010375 Bacteria 1298
146 Ga0105246_10063718 3300011119 Bacteria 2572
147 Ga0157371_10783137 3300013102 Bacteria 718
148 Ga0157369_10051130 3300013105 Plasmid 4473
149 Ga0157369_10216220 3300013105 Bacteria 2007
150 Ga0157374_10004757 3300013296 Bacteria 11387
151 Ga0157374_10015273 3300013296 Bacteria 6734
152 Ga0157374_10037147 3300013296 Bacteria 4468
153 Ga0157374_10851020 3300013296 Unclassified 929
154 Ga0157374_10895630 3300013296 Bacteria 905
155 Ga0157378_10051324 3300013297 Bacteria 3670
156 Ga0157378_10070678 3300013297 Bacteria 3134
157 Ga0157378_10076568 3300013297 Unclassified 3014
158 Ga0163162_10102528 3300013306 Bacteria 2955
159 Ga0157372_10519481 3300013307 Bacteria 1388
160 Ga0157372_10547816 3300013307 Bacteria 1348
161 Ga0157372_10686692 3300013307 Bacteria 1192
162 Ga0157375_10254380 3300013308 Bacteria 1918
163 Ga0157375_10299400 3300013308 Bacteria 1772
164 Ga0163163_10031445 3300014325 Bacteria 5123
165 Ga0163163_10041954 3300014325 Unclassified 4478
166 Ga0163163_10159496 3300014325 Unclassified 2301
167 Ga0163163_10719279 3300014325 Bacteria 1062
168 Ga0163163_10947264 3300014325 Bacteria 924
169 Ga0157380_11874584 3300014326 Bacteria 660
170 Ga0157379_10216292 3300014968 Unclassified 1736
171 Ga0157376_10090011 3300014969 Bacteria 2654
172 Ga0157376_10151441 3300014969 Bacteria 2092
173 Ga0157376_10341580 3300014969 Bacteria 1430
174 Ga0157376_10631189 3300014969 Bacteria 1070
175 Ga0206356_10667603 3300020070 Bacteria 753
176 Ga0206349_1215275 3300020075 Bacteria 704
177 Ga0206350_10285949 3300020080 Bacteria 1168
178 Ga0213873_10001134 3300021358 Bacteria 4357
179 Ga0213872_10018689 3300021361 Bacteria 3195
180 Ga0213872_10030508 3300021361 Bacteria 2471
181 Ga0213871_10125595 3300021441 Bacteria 767
182 Ga0224712_10065982 3300022467 Bacteria 1456
183 Ga0207692_10001035 3300025898 Bacteria 10155
184 Ga0207692_10034473 3300025898 Bacteria 2451
185 Ga0207692_10040892 3300025898 Bacteria 2291
186 Ga0207680_10058432 3300025903 Bacteria 2337
187 Ga0207685_10082297 3300025905 Bacteria 1335
188 Ga0207699_10000153 3300025906 Bacteria 44112
189 Ga0207654_10020747 3300025911 Bacteria 3488
190 Ga0207654_10027364 3300025911 Bacteria 3098
191 Ga0207654_10092206 3300025911 Bacteria 1849
192 Ga0207707_10089756 3300025912 Bacteria 2686
193 Ga0207695_10212330 3300025913 Unclassified 1845
194 Ga0207671_10239283 3300025914 Bacteria 1426
195 Ga0207693_10000033 3300025915 Bacteria 114840
196 Ga0207693_10000344 3300025915 Bacteria 42936
197 Ga0207693_10008719 3300025915 Bacteria 8291
198 Ga0207693_10194197 3300025915 Bacteria 1597
199 Ga0207663_10003406 3300025916 Bacteria 7776
200 Ga0207663_10008362 3300025916 Bacteria 5406
201 Ga0207663_10008395 3300025916 Bacteria 5398
202 Ga0207663_10018021 3300025916 Bacteria 3945
203 Ga0207663_10164177 3300025916 Bacteria 1571
204 Ga0207649_10788058 3300025920 Bacteria 741
205 Ga0207652_10404634 3300025921 Bacteria 1231
206 Ga0207694_10034693 3300025924 Bacteria 3869
207 Ga0207694_10179767 3300025924 Bacteria 1715
208 Ga0207694_10364617 3300025924 Bacteria 1198
209 Ga0207694_10617740 3300025924 Bacteria 912
210 Ga0207687_10054357 3300025927 Bacteria 2801
211 Ga0207700_10000315 3300025928 Bacteria 28400
212 Ga0207700_10071762 3300025928 Bacteria 2667
213 Ga0207700_10123521 3300025928 Bacteria 2102
214 Ga0207700_10196698 3300025928 Bacteria 1697
215 Ga0207700_10647660 3300025928 Unclassified 942
216 Ga0207700_10778039 3300025928 Bacteria 856
217 Ga0207700_10980049 3300025928 Bacteria 757
218 Ga0207664_10006743 3300025929 Bacteria 7930
219 Ga0207664_10038445 3300025929 Bacteria 3711
220 Ga0207664_10311961 3300025929 Unclassified 1386
221 Ga0207664_10389339 3300025929 Unclassified 1238
222 Ga0207644_10153833 3300025931 Bacteria 1782
223 Ga0207690_10223311 3300025932 Bacteria 1442
224 Ga0207690_10733917 3300025932 Bacteria 813
225 Ga0207706_10246089 3300025933 Bacteria 1563
226 Ga0207706_10298442 3300025933 Bacteria 1404
227 Ga0207686_10004713 3300025934 Bacteria 7315
228 Ga0207670_10194496 3300025936 Bacteria 1537
229 Ga0207704_10007796 3300025938 Bacteria 5080
230 Ga0207665_10012916 3300025939 Bacteria 5493
231 Ga0207665_10085675 3300025939 Bacteria 2175
232 Ga0207665_10150030 3300025939 Bacteria 1669
233 Ga0207665_10274208 3300025939 Unclassified 1253
234 Ga0207711_10269068 3300025941 Bacteria 1568
235 Ga0207711_10368461 3300025941 Bacteria 1332
236 Ga0207679_10293359 3300025945 Bacteria 1399
237 Ga0207667_10081839 3300025949 Bacteria 3345
238 Ga0207667_10166404 3300025949 Bacteria 2267
239 Ga0207667_10707072 3300025949 Bacteria 1010
240 Ga0207668_10263740 3300025972 Bacteria 1405
241 Ga0207640_10200132 3300025981 Bacteria 1513
242 Ga0207677_10034899 3300026023 Bacteria 3261
243 Ga0207639_10217958 3300026041 Bacteria 1647
244 Ga0207702_10038649 3300026078 Bacteria 3997
245 Ga0207702_10056445 3300026078 Bacteria 3334
246 Ga0207702_10211503 3300026078 Bacteria 1803
247 Ga0207702_10252963 3300026078 Unclassified 1655
248 Ga0207702_10761169 3300026078 Unclassified 956
249 Ga0207648_10022856 3300026089 Bacteria 5609
250 Ga0207674_10003310 3300026116 Bacteria 19811
251 Ga0207674_10119626 3300026116 Bacteria 2603
252 Ga0207674_10224219 3300026116 Bacteria 1828
253 Ga0207674_10841708 3300026116 Bacteria 885
254 Ga0207675_100219094 3300026118 Bacteria 1833
255 Ga0207675_101038734 3300026118 Unclassified 838
256 Ga0207675_101173275 3300026118 Bacteria 788
257 Ga0207698_10483674 3300026142 Bacteria 1201
258 Ga0209588_1084972 3300027671 Bacteria 1021
259 Ga0268266_10005911 3300028379 Bacteria 11320
260 Ga0268266_10013852 3300028379 Bacteria 6942
261 Ga0268266_10908122 3300028379 Unclassified 852
262 Ga0265338_10000782 3300028800 Bacteria 53947
263 Ga0265325_10000090 3300031241 Bacteria 64219
264 Ga0265331_10037642 3300031250 Bacteria 2368
265 Ga0265327_10020015 3300031251 Bacteria 4095
266 Ga0265316_10021635 3300031344 Bacteria 5441
267 Ga0265313_10000297 3300031595 Bacteria 53741
268 Ga0265342_10013902 3300031712 Bacteria 5370
269 Ga0307406_10018022 3300031901 Bacteria 4119
270 Ga0307409_100450778 3300031995 Bacteria 1242
271 Ga0307411_11472562 3300032005 Bacteria 625
272 Ga0373926_0095719 3300035083 Bacteria 1107
273 Ga0373934_0080632 3300035086 Bacteria 1307
274 Ga0373934_0131786 3300035086 Bacteria 1020
275 Ga0373923_0006169 3300035111 Bacteria 4124
276 Ga0373923_0007456 3300035111 Bacteria 3848
277 Ga0373923_0113410 3300035111 Unclassified 1206
278 Ga0373923_0153063 3300035111 Bacteria 1048
279 Ga0373936_0151614 3300035113 Bacteria 1005
280 Ga0373939_0114546 3300035114 Bacteria 944
281 Ga0373945_0048777 3300035116 Bacteria 1552
282 Ga0373953_0009804 3300035117 Bacteria 3312
283 Ga0373953_0217144 3300035117 Bacteria 828
284 Ga0373954_0065926 3300035118 Bacteria 1714
285 Ga0373954_0077203 3300035118 Bacteria 1588
286 Ga0373954_0236283 3300035118 Bacteria 899
287 Ga0373954_0365771 3300035118 Bacteria 712
288 Ga0373956_0016031 3300035119 Bacteria 3142
289 Ga0373957_0096568 3300035120 Unclassified 1180
290 Ga0373943_0044692 3300035170 Bacteria 2156
291 Ga0373943_0722440 3300035170 Bacteria 591
292 Ga0373946_0049181 3300035171 Bacteria 1758
293 Ga0373946_0133333 3300035171 Bacteria 1145
294 Ga0373955_0021215 3300035172 Bacteria 3275
295 Ga0373955_0022952 3300035172 Bacteria 3173
296 Ga0373955_0105248 3300035172 Unclassified 1625
297 Ga0373955_0195921 3300035172 Bacteria 1202
298 Ga0373935_0195956 3300035692 Bacteria 1394
299 Ga0373935_0495512 3300035692 Bacteria 886
300 Ga0373935_0608920 3300035692 Bacteria 799
301 Ga0373927_0005802 3300035695 Bacteria 8471
302 Ga0373927_0132695 3300035695 Bacteria 1627
303 Ga0373927_0424531 3300035695 Bacteria 878
304 Ga0373933_0027816 3300035724 Bacteria 3259
305 Ga0373933_0032939 3300035724 Bacteria 3012
306 Ga0373933_0261213 3300035724 Bacteria 1116
307 Ga0373933_0637554 3300035724 Bacteria 700
308 Ga0373947_0000111 3300035725 Bacteria 40876
309 Ga0373947_0032994 3300035725 Bacteria 3054
310 Ga0373947_0069191 3300035725 Bacteria 2160
311 Ga0373947_0108593 3300035725 Bacteria 1751
312 Ga0373937_0023002 3300036401 Bacteria 5605
313 Ga0373937_0029284 3300036401 Bacteria 4986
314 Ga0373937_0037920 3300036401 Bacteria 4392
315 Ga0373937_0051512 3300036401 Bacteria 3773
316 Ga0373937_0081166 3300036401 Bacteria 3000
317 Ga0373937_0097354 3300036401 Bacteria 2729
318 Ga0373937_0100797 3300036401 Bacteria 2680
319 Ga0373937_0461337 3300036401 Bacteria 1207
320 Ga0373937_0945439 3300036401 Bacteria 810
321 Ga0373925_0000318 3300037068 Bacteria 50259
322 Ga0373925_0218711 3300037068 Bacteria 1520
323 Ga0373925_0286563 3300037068 Bacteria 1327
324 Ga0373925_0296673 3300037068 Bacteria 1304
325 Ga0373925_0323504 3300037068 Bacteria 1248
326 Ga0373925_0627171 3300037068 Bacteria 886
327 Ga0395905_0174669 3300037471 Bacteria 2017
328 Ga0436360_0145431 3300039438 Bacteria 1030
329 Ga0436360_0460117 3300039438 Bacteria 3087
330 Ga0436360_0730264 3300039438 Bacteria 633
331 Ga0436361_0193924 3300039447 Bacteria 5385
332 Ga0436361_0292260 3300039447 Bacteria 864
333 Ga0436361_1159159 3300039447 Bacteria 1505
334 Ga0436362_0483687 3300039453 Bacteria 1275
335 Ga0436362_0549784 3300039453 Bacteria 1970
336 Ga0436362_0946920 3300039453 Bacteria 12710
337 Ga0451807_1919852 3300041486 Bacteria 824
338 Ga0453683_0332718 3300044673 Bacteria 974
339 Ga0451576_0042802 3300045051 Bacteria 4781
340 Ga0466967_0310773 3300045976 Bacteria 1518
341 Ga0495592_0031218 3300046454 Unclassified 4027
342 Ga0495592_0315277 3300046454 Bacteria 1012
343 Ga0495651_0035492 3300046462 Bacteria 3881
344 Ga0495651_0045722 3300046462 Bacteria 3391
345 Ga0495651_0048032 3300046462 Bacteria 3297
346 Ga0495651_0196744 3300046462 Bacteria 1414
347 Ga0495653_0040188 3300046463 Bacteria 3658
348 Ga0495653_0128759 3300046463 Bacteria 1794
349 Ga0495580_0110595 3300046472 Bacteria 1908
350 Ga0495580_0131790 3300046472 Bacteria 1734
351 Ga0495580_0364089 3300046472 Bacteria 978
352 Ga0495582_0370444 3300046473 Bacteria 825
353 Ga0495582_0474155 3300046473 Bacteria 723
354 Ga0495605_0155266 3300046474 Bacteria 1019
355 Ga0495662_0330215 3300046476 Bacteria 750
356 Ga0495664_0022308 3300046477 Bacteria 3668
357 Ga0495664_0152056 3300046477 Bacteria 1404
358 Ga0495664_0243215 3300046477 Bacteria 1088
359 Ga0495664_0260922 3300046477 Bacteria 1047
360 Ga0495664_0271701 3300046477 Bacteria 1024
361 Ga0495594_0048184 3300046499 Unclassified 2341
362 Ga0495608_0021703 3300046511 Bacteria 4406
363 Ga0495608_0062447 3300046511 Bacteria 2448
364 Ga0495608_0399513 3300046511 Bacteria 841
365 Ga0495618_0032163 3300046514 Bacteria 3286
366 Ga0495618_0419406 3300046514 Bacteria 816
367 Ga0495620_0134286 3300046515 Bacteria 970
368 Ga0495628_0014169 3300046516 Bacteria 6691
369 Ga0495628_0028779 3300046516 Bacteria 4512
370 Ga0495628_0129755 3300046516 Bacteria 1929
371 Ga0495628_0384547 3300046516 Bacteria 1027
372 Ga0495628_0504519 3300046516 Bacteria 873
373 Ga0495630_0005373 3300046517 Bacteria 9039
374 Ga0495630_0036719 3300046517 Bacteria 3662
375 Ga0495630_0082664 3300046517 Bacteria 2424
376 Ga0495630_0560609 3300046517 Bacteria 876
377 Ga0495663_0049505 3300046525 Bacteria 1298
378 Ga0495652_0007216 3300046529 Bacteria 10260
379 Ga0495652_0125421 3300046529 Bacteria 2040
380 Ga0495652_0270936 3300046529 Bacteria 1248
381 Ga0495652_0595089 3300046529 Bacteria 755
382 Ga0495665_0101997 3300046531 Unclassified 1506
383 Ga0495665_0160048 3300046531 Bacteria 1174
384 Ga0495665_0161578 3300046531 Bacteria 1167
385 Ga0495665_0230528 3300046531 Bacteria 956
386 Ga0495640_0079969 3300046533 Bacteria 2175
387 Ga0495640_0305487 3300046533 Bacteria 987
388 Ga0495586_0052482 3300046535 Bacteria 2208
389 Ga0495586_0056154 3300046535 Bacteria 2135
390 Ga0495587_0004021 3300046536 Bacteria 9745
391 Ga0495587_0011551 3300046536 Bacteria 5591
392 Ga0495587_0042878 3300046536 Unclassified 2696
393 Ga0495587_0090856 3300046536 Bacteria 1764
394 Ga0495587_0154342 3300046536 Bacteria 1308
395 Ga0495645_0003217 3300046543 Bacteria 11082
396 Ga0495645_0037763 3300046543 Bacteria 3522
397 Ga0495645_0207552 3300046543 Bacteria 1325
398 Ga0495645_0596139 3300046543 Bacteria 680
399 Ga0495667_0004894 3300046559 Bacteria 9057
400 Ga0495667_0012535 3300046559 Bacteria 5748
401 Ga0495667_0020942 3300046559 Bacteria 4412
402 Ga0495667_0028255 3300046559 Bacteria 3776
403 Ga0495667_0108742 3300046559 Bacteria 1791
404 Ga0495667_0188022 3300046559 Unclassified 1324
405 Ga0495667_0282868 3300046559 Unclassified 1053
406 Ga0495656_0064211 3300046615 Bacteria 1612
407 Ga0495625_0000033 3300046660 Bacteria 228108
408 Ga0495635_0021526 3300046663 Bacteria 4495
409 Ga0495635_0101139 3300046663 Bacteria 1970
410 Ga0495635_0144529 3300046663 Bacteria 1620
411 Ga0495635_0184390 3300046663 Bacteria 1418
412 Ga0495635_0461692 3300046663 Bacteria 839
413 Ga0495659_0045818 3300046664 Bacteria 1577
414 Ga0495659_0067976 3300046664 Bacteria 1330
415 Ga0495657_0031051 3300046675 Bacteria 3737
416 Ga0495657_0275616 3300046675 Bacteria 1008
417 Ga0495599_0006203 3300046678 Bacteria 7207
418 Ga0495599_0009710 3300046678 Bacteria 5887
419 Ga0495599_0132864 3300046678 Bacteria 1545
420 Ga0495599_0155492 3300046678 Unclassified 1415
421 Ga0495623_0087511 3300046679 Bacteria 1919
422 Ga0495623_0186774 3300046679 Bacteria 1200
423 Ga0495623_0307917 3300046679 Unclassified 873
424 Ga0495623_0465797 3300046679 Bacteria 671
425 Ga0495646_0135174 3300046680 Bacteria 1384
426 Ga0495646_0374852 3300046680 Bacteria 743
427 Ga0495658_0145962 3300046683 Bacteria 1450
428 Ga0495669_0001440 3300046684 Bacteria 9819
429 Ga0495613_0083291 3300046689 Bacteria 2323
430 Ga0495613_0192709 3300046689 Bacteria 1440
431 Ga0495624_0154147 3300046690 Bacteria 1405
432 Ga0495624_0616871 3300046690 Bacteria 646
433 Ga0495600_0037186 3300046809 Bacteria 3164
434 Ga0495600_0132462 3300046809 Bacteria 1620
435 Ga0495600_0269714 3300046809 Bacteria 1080
436 Ga0495600_0349935 3300046809 Unclassified 926
437 Ga0495600_0420475 3300046809 Bacteria 829
438 Ga0495581_0299404 3300047315 Bacteria 940
439 Ga0495604_0010706 3300047317 Bacteria 7279
440 Ga0495604_0058226 3300047317 Bacteria 2968
441 Ga0495604_0202937 3300047317 Unclassified 1374
442 Ga0495604_0228020 3300047317 Bacteria 1279
443 Ga0495604_0550666 3300047317 Bacteria 744
444 Ga0495674_0011837 3300047319 Bacteria 8224
445 Ga0495674_0012387 3300047319 Bacteria 8035
446 Ga0495674_0027604 3300047319 Bacteria 5185
447 Ga0495674_0440251 3300047319 Unclassified 1048
448 Ga0495674_0444595 3300047319 Bacteria 1042
449 Ga0495674_0482907 3300047319 Bacteria 993
450 Ga0495680_0029546 3300047322 Bacteria 4488
451 Ga0495680_0031601 3300047322 Bacteria 4306
452 Ga0495675_0000084 3300047444 Bacteria 66406
453 Ga0495675_0002426 3300047444 Bacteria 11145
454 Ga0495675_0033531 3300047444 Bacteria 3277
455 Ga0495675_0039353 3300047444 Bacteria 3011
456 Ga0495677_0299841 3300047445 Bacteria 632
457 Ga0495684_0012562 3300047471 Bacteria 6529
458 Ga0495684_0017039 3300047471 Bacteria 5597
459 Ga0495684_0019535 3300047471 Bacteria 5219
460 Ga0495684_0031285 3300047471 Bacteria 4086
461 Ga0495684_0073388 3300047471 Bacteria 2599
462 Ga0495684_0318211 3300047471 Bacteria 1113
463 Ga0495684_0428583 3300047471 Bacteria 923
464 Ga0495593_0094949 3300047673 Bacteria 1534
465 Ga0495593_0182459 3300047673 Bacteria 1057
466 Ga0495602_0026345 3300048088 Bacteria 5608
467 Ga0495602_0033349 3300048088 Bacteria 4831
468 Ga0495602_0038849 3300048088 Bacteria 4392
469 Ga0495602_0048927 3300048088 Bacteria 3793
470 Ga0495602_0133345 3300048088 Bacteria 1977
471 Ga0495602_0251948 3300048088 Bacteria 1315
472 Ga0495602_0269932 3300048088 Bacteria 1258
473 Ga0496100_0360488 3300048903 Bacteria 1100
474 Ga0496102_0141448 3300048905 Bacteria 2256
475 Ga0496102_0571893 3300048905 Unclassified 1053
476 Ga0496103_0018631 3300048906 Bacteria 4165
477 Ga0496104_0332934 3300048907 Bacteria 1431
478 Ga0496104_0665050 3300048907 Unclassified 950
479 Ga0496106_0152576 3300048909 Bacteria 1823
480 Ga0496106_0330716 3300048909 Bacteria 1223
481 Ga0496106_0346090 3300048909 Bacteria 1194
482 Ga0496108_0050780 3300048911 Bacteria 3473
483 Ga0496109_0030107 3300048912 Bacteria 4865
484 Ga0496110_0041859 3300048913 Bacteria 3999
485 Ga0496111_0051835 3300048914 Bacteria 2963
486 Ga0496112_0786349 3300048915 Bacteria 877
487 Ga0496114_0433825 3300048917 Bacteria 1164
488 Ga0496114_0442556 3300048917 Bacteria 1151
489 Ga0496114_0464653 3300048917 Bacteria 1120
490 Ga0496115_0046507 3300048918 Plasmid 3469
491 Ga0496115_0275959 3300048918 Bacteria 1380
492 Ga0501292_041751 3300049515 Bacteria 794
493 Ga0501038_0370801 3300049574 Bacteria 1112
494 Ga0501039_0144823 3300049575 Bacteria 1867
495 Ga0501041_0613893 3300049577 Bacteria 694
496 Ga0501048_0043324 3300049582 Bacteria 3222
497 Ga0501071_0015089 3300049587 Bacteria 5297
498 Ga0501072_0103742 3300049588 Bacteria 2260
499 Ga0501074_0033003 3300049590 Bacteria 3752
500 Ga0501076_0006005 3300049592 Bacteria 8774
501 Ga0501077_0001052 3300049593 Bacteria 16652
502 Ga0501079_0034467 3300049741 Bacteria 3895
503 Ga0501080_0358314 3300049742 Bacteria 1316
504 Ga0501080_0879544 3300049742 Bacteria 782
505 Ga0501081_0322519 3300049743 Bacteria 1135
506 nmdc:mga05p37_533846_c1 3300050507 Bacteria 1339
507 nmdc:mga05p37_55929_c1 3300050507 Bacteria 4857
508 nmdc:mga0n895_206028_c1 3300050512 Bacteria 1997
509 nmdc:mga0n895_300611_c1 3300050512 Bacteria 1627
510 nmdc:mga0n895_566071_c1 3300050512 Bacteria 1141
511 nmdc:mga0rr50_126230_c1 3300050513 Bacteria 2043
512 nmdc:mga08x19_806181_c1 3300050514 Bacteria 667
513 Ga0501084_0020185 3300054114 Bacteria 5554
514 Ga0587073_0065207 3300059492 Bacteria 866
515 Ga0587071_026479 3300060344 Bacteria 1094
516 2644485350 2643221687 Bacteria 6500351
517 2644634901 2643221715 Bacteria 6671032
518 2902817045 2902810491 Bacteria 6794147
519 Ga0373927_0143034
520 ARCol0yngRDRAFT_1004387
521 Ga0058861_10086937
522 Ga0058861_11591617
523 Ga0058862_12743767
524 Ga0065704_10013021
525 Ga0065704_10047804
526 Ga0065712_10321071
527 Ga0065715_10190665
528 Ga0065707_10014982
529 Ga0065707_10334152
530 Ga0070683_100002410
531 Ga0070683_100224109
532 Ga0070690_100000451
533 Ga0070666_10117664
534 Ga0068868_100027638
535 Ga0068868_100470471
536 Ga0070687_100052037
537 Ga0070668_100246381
538 Ga0070675_100513238
539 Ga0070671_100190776
540 Ga0070671_101407799
541 Ga0070673_100844663
542 Ga0070659_100021245
543 Ga0070709_10000266
544 Ga0070714_100014218
545 Ga0070714_100300115
546 Ga0070714_100525987
547 Ga0070713_100000756
548 Ga0070713_100002186
549 Ga0070713_100170461
550 Ga0070713_100229648
551 Ga0070713_100984023
552 Ga0070713_101554838
553 Ga0070710_10001776
554 Ga0070710_10026382
555 Ga0070710_10030716
556 Ga0070711_100003038
557 Ga0070711_100005393
558 Ga0070711_100324673
559 Ga0070711_100642231
560 Ga0070705_100298831
561 Ga0070700_100512044
562 Ga0070694_100279298
563 Ga0070708_100315806
564 Ga0070678_100118239
565 Ga0070681_10242076
566 Ga0070681_10405076
567 Ga0068867_100197404
568 Ga0070706_100328144
569 Ga0070706_100539208
570 Ga0070699_100645966
571 Ga0070679_100082258
572 Ga0070679_100474916
573 Ga0070684_100189142
574 Ga0070684_100249320
575 Ga0070684_100334811
576 Ga0070697_100252401
577 Ga0070697_100609597
578 Ga0070697_100885392
579 Ga0068853_100251751
580 Ga0070686_100007888
581 Ga0070696_100175052
582 Ga0070693_100523051
583 Ga0070693_100998053
584 Ga0070665_100035911
585 Ga0070665_100312620
586 Ga0070704_100049540
587 Ga0068855_100087253
588 Ga0068855_100860588
589 Ga0070664_100150100
590 Ga0068857_100021188
591 Ga0068857_100121089
592 Ga0068857_100126482
593 Ga0068854_100008860
594 Ga0068854_100778258
595 Ga0068856_100211868
596 Ga0068856_100410637
597 Ga0068856_100595982
598 Ga0068859_100478469
599 Ga0068866_10115164
600 Ga0068860_100495045
601 Ga0081455_10098758
602 Ga0081538_10011926
603 Ga0070717_10003407
604 Ga0070717_10010220
605 Ga0070717_10023116
606 Ga0075432_10076366
607 Ga0070715_10008716
608 Ga0070715_10123999
609 Ga0070715_10204182
610 Ga0070716_100002056
611 Ga0070716_100022765
612 Ga0070716_100144708
613 Ga0070716_100160540
614 Ga0070712_100000168
615 Ga0070712_100001751
616 Ga0070712_100077808
617 Ga0070712_100214171
618 Ga0070712_100383015
619 Ga0097621_100012103
620 Ga0097621_100067430
621 Ga0068871_100006792
622 Ga0068871_100664594
623 Ga0075434_100205629
624 Ga0075434_100206662
625 Ga0075434_100627878
626 Ga0068865_100073632
627 Ga0068865_101329312
628 Ga0097620_100478436
629 Ga0099794_10010698
630 Ga0099794_10071670
631 Ga0099794_10102245
632 Ga0099795_10073832
633 Ga0099795_10299894
634 Ga0105240_10469076
635 Ga0105240_10887711
636 Ga0105245_10014252
637 Ga0105247_10234687
638 Ga0114129_10053787
639 Ga0114129_10253791
640 Ga0114129_10790797
641 Ga0105243_11187283
642 Ga0105241_10009797
643 Ga0105241_10092738
644 Ga0105241_10640717
645 Ga0105242_10012110
646 Ga0105242_10574462
647 Ga0105248_10118400
648 Ga0105248_10150310
649 Ga0105248_10698201
650 Ga0105248_10913951
651 Ga0105237_10152841
652 Ga0105237_10291452
653 Ga0105237_10355037
654 Ga0105238_10093297
655 Ga0105238_10274454
656 Ga0105238_10477583
657 Ga0105238_10758321
658 Ga0105238_11113525
659 Ga0105030_102389
660 Ga0099796_10043079
661 Ga0099796_10193076
662 Ga0105239_10037460
663 Ga0105239_10563409
664 Ga0105246_10063718
665 Ga0157371_10783137
666 Ga0157369_10051130
667 Ga0157369_10216220
668 Ga0157374_10004757
669 Ga0157374_10015273
670 Ga0157374_10037147
671 Ga0157374_10851020
672 Ga0157374_10895630
673 Ga0157378_10051324
674 Ga0157378_10070678
675 Ga0157378_10076568
676 Ga0163162_10102528
677 Ga0157372_10519481
678 Ga0157372_10547816
679 Ga0157372_10686692
680 Ga0157375_10254380
681 Ga0157375_10299400
682 Ga0163163_10031445
683 Ga0163163_10041954
684 Ga0163163_10159496
685 Ga0163163_10719279
686 Ga0163163_10947264
687 Ga0157380_11874584
688 Ga0157379_10216292
689 Ga0157376_10090011
690 Ga0157376_10151441
691 Ga0157376_10341580
692 Ga0157376_10631189
693 Ga0206356_10667603
694 Ga0206349_1215275
695 Ga0206350_10285949
696 Ga0213873_10001134
697 Ga0213872_10018689
698 Ga0213872_10030508
699 Ga0213871_10125595
700 Ga0224712_10065982
701 Ga0207692_10001035
702 Ga0207692_10034473
703 Ga0207692_10040892
704 Ga0207680_10058432
705 Ga0207685_10082297
706 Ga0207699_10000153
707 Ga0207654_10020747
708 Ga0207654_10027364
709 Ga0207654_10092206
710 Ga0207707_10089756
711 Ga0207695_10212330
712 Ga0207671_10239283
713 Ga0207693_10000033
714 Ga0207693_10000344
715 Ga0207693_10008719
716 Ga0207693_10194197
717 Ga0207663_10003406
718 Ga0207663_10008362
719 Ga0207663_10008395
720 Ga0207663_10018021
721 Ga0207663_10164177
722 Ga0207649_10788058
723 Ga0207652_10404634
724 Ga0207694_10034693
725 Ga0207694_10179767
726 Ga0207694_10364617
727 Ga0207694_10617740
728 Ga0207687_10054357
729 Ga0207700_10000315
730 Ga0207700_10071762
731 Ga0207700_10123521
732 Ga0207700_10196698
733 Ga0207700_10647660
734 Ga0207700_10778039
735 Ga0207700_10980049
736 Ga0207664_10006743
737 Ga0207664_10038445
738 Ga0207664_10311961
739 Ga0207664_10389339
740 Ga0207644_10153833
741 Ga0207690_10223311
742 Ga0207690_10733917
743 Ga0207706_10246089
744 Ga0207706_10298442
745 Ga0207686_10004713
746 Ga0207670_10194496
747 Ga0207704_10007796
748 Ga0207665_10012916
749 Ga0207665_10085675
750 Ga0207665_10150030
751 Ga0207665_10274208
752 Ga0207711_10269068
753 Ga0207711_10368461
754 Ga0207679_10293359
755 Ga0207667_10081839
756 Ga0207667_10166404
757 Ga0207667_10707072
758 Ga0207668_10263740
759 Ga0207640_10200132
760 Ga0207677_10034899
761 Ga0207639_10217958
762 Ga0207702_10038649
763 Ga0207702_10056445
764 Ga0207702_10211503
765 Ga0207702_10252963
766 Ga0207702_10761169
767 Ga0207648_10022856
768 Ga0207674_10003310
769 Ga0207674_10119626
770 Ga0207674_10224219
771 Ga0207674_10841708
772 Ga0207675_100219094
773 Ga0207675_101038734
774 Ga0207675_101173275
775 Ga0207698_10483674
776 Ga0209588_1084972
777 Ga0268266_10005911
778 Ga0268266_10013852
779 Ga0268266_10908122
780 Ga0265338_10000782
781 Ga0265325_10000090
782 Ga0265331_10037642
783 Ga0265327_10020015
784 Ga0265316_10021635
785 Ga0265313_10000297
786 Ga0265342_10013902
787 Ga0307406_10018022
788 Ga0307409_100450778
789 Ga0307411_11472562
790 Ga0373926_0095719
791 Ga0373934_0080632
792 Ga0373934_0131786
793 Ga0373923_0006169
794 Ga0373923_0007456
795 Ga0373923_0113410
796 Ga0373923_0153063
797 Ga0373936_0151614
798 Ga0373939_0114546
799 Ga0373945_0048777
800 Ga0373953_0009804
801 Ga0373953_0217144
802 Ga0373954_0065926
803 Ga0373954_0077203
804 Ga0373954_0236283
805 Ga0373954_0365771
806 Ga0373956_0016031
807 Ga0373957_0096568
808 Ga0373943_0044692
809 Ga0373943_0722440
810 Ga0373946_0049181
811 Ga0373946_0133333
812 Ga0373955_0021215
813 Ga0373955_0022952
814 Ga0373955_0105248
815 Ga0373955_0195921
816 Ga0373935_0195956
817 Ga0373935_0495512
818 Ga0373935_0608920
819 Ga0373927_0005802
820 Ga0373927_0132695
821 Ga0373927_0424531
822 Ga0373933_0027816
823 Ga0373933_0032939
824 Ga0373933_0261213
825 Ga0373933_0637554
826 Ga0373947_0000111
827 Ga0373947_0032994
828 Ga0373947_0069191
829 Ga0373947_0108593
830 Ga0373937_0023002
831 Ga0373937_0029284
832 Ga0373937_0037920
833 Ga0373937_0051512
834 Ga0373937_0081166
835 Ga0373937_0097354
836 Ga0373937_0100797
837 Ga0373937_0461337
838 Ga0373937_0945439
839 Ga0373925_0000318
840 Ga0373925_0218711
841 Ga0373925_0286563
842 Ga0373925_0296673
843 Ga0373925_0323504
844 Ga0373925_0627171
845 Ga0395905_0174669
846 Ga0436360_0145431
847 Ga0436360_0460117
848 Ga0436360_0730264
849 Ga0436361_0193924
850 Ga0436361_0292260
851 Ga0436361_1159159
852 Ga0436362_0483687
853 Ga0436362_0549784
854 Ga0436362_0946920
855 Ga0451807_1919852
856 Ga0453683_0332718
857 Ga0451576_0042802
858 Ga0466967_0310773
859 Ga0495592_0031218
860 Ga0495592_0315277
861 Ga0495651_0035492
862 Ga0495651_0045722
863 Ga0495651_0048032
864 Ga0495651_0196744
865 Ga0495653_0040188
866 Ga0495653_0128759
867 Ga0495580_0110595
868 Ga0495580_0131790
869 Ga0495580_0364089
870 Ga0495582_0370444
871 Ga0495582_0474155
872 Ga0495605_0155266
873 Ga0495662_0330215
874 Ga0495664_0022308
875 Ga0495664_0152056
876 Ga0495664_0243215
877 Ga0495664_0260922
878 Ga0495664_0271701
879 Ga0495594_0048184
880 Ga0495608_0021703
881 Ga0495608_0062447
882 Ga0495608_0399513
883 Ga0495618_0032163
884 Ga0495618_0419406
885 Ga0495620_0134286
886 Ga0495628_0014169
887 Ga0495628_0028779
888 Ga0495628_0129755
889 Ga0495628_0384547
890 Ga0495628_0504519
891 Ga0495630_0005373
892 Ga0495630_0036719
893 Ga0495630_0082664
894 Ga0495630_0560609
895 Ga0495663_0049505
896 Ga0495652_0007216
897 Ga0495652_0125421
898 Ga0495652_0270936
899 Ga0495652_0595089
900 Ga0495665_0101997
901 Ga0495665_0160048
902 Ga0495665_0161578
903 Ga0495665_0230528
904 Ga0495640_0079969
905 Ga0495640_0305487
906 Ga0495586_0052482
907 Ga0495586_0056154
908 Ga0495587_0004021
909 Ga0495587_0011551
910 Ga0495587_0042878
911 Ga0495587_0090856
912 Ga0495587_0154342
913 Ga0495645_0003217
914 Ga0495645_0037763
915 Ga0495645_0207552
916 Ga0495645_0596139
917 Ga0495667_0004894
918 Ga0495667_0012535
919 Ga0495667_0020942
920 Ga0495667_0028255
921 Ga0495667_0108742
922 Ga0495667_0188022
923 Ga0495667_0282868
924 Ga0495656_0064211
925 Ga0495625_0000033
926 Ga0495635_0021526
927 Ga0495635_0101139
928 Ga0495635_0144529
929 Ga0495635_0184390
930 Ga0495635_0461692
931 Ga0495659_0045818
932 Ga0495659_0067976
933 Ga0495657_0031051
934 Ga0495657_0275616
935 Ga0495599_0006203
936 Ga0495599_0009710
937 Ga0495599_0132864
938 Ga0495599_0155492
939 Ga0495623_0087511
940 Ga0495623_0186774
941 Ga0495623_0307917
942 Ga0495623_0465797
943 Ga0495646_0135174
944 Ga0495646_0374852
945 Ga0495658_0145962
946 Ga0495669_0001440
947 Ga0495613_0083291
948 Ga0495613_0192709
949 Ga0495624_0154147
950 Ga0495624_0616871
951 Ga0495600_0037186
952 Ga0495600_0132462
953 Ga0495600_0269714
954 Ga0495600_0349935
955 Ga0495600_0420475
956 Ga0495581_0299404
957 Ga0495604_0010706
958 Ga0495604_0058226
959 Ga0495604_0202937
960 Ga0495604_0228020
961 Ga0495604_0550666
962 Ga0495674_0011837
963 Ga0495674_0012387
964 Ga0495674_0027604
965 Ga0495674_0440251
966 Ga0495674_0444595
967 Ga0495674_0482907
968 Ga0495680_0029546
969 Ga0495680_0031601
970 Ga0495675_0000084
971 Ga0495675_0002426
972 Ga0495675_0033531
973 Ga0495675_0039353
974 Ga0495677_0299841
975 Ga0495684_0012562
976 Ga0495684_0017039
977 Ga0495684_0019535
978 Ga0495684_0031285
979 Ga0495684_0073388
980 Ga0495684_0318211
981 Ga0495684_0428583
982 Ga0495593_0094949
983 Ga0495593_0182459
984 Ga0495602_0026345
985 Ga0495602_0033349
986 Ga0495602_0038849
987 Ga0495602_0048927
988 Ga0495602_0133345
989 Ga0495602_0251948
990 Ga0495602_0269932
991 Ga0496100_0360488
992 Ga0496102_0141448
993 Ga0496102_0571893
994 Ga0496103_0018631
995 Ga0496104_0332934
996 Ga0496104_0665050
997 Ga0496106_0152576
998 Ga0496106_0330716
999 Ga0496106_0346090
1000 Ga0496108_0050780
1001 Ga0496109_0030107
1002 Ga0496110_0041859
1003 Ga0496111_0051835
1004 Ga0496112_0786349
1005 Ga0496114_0433825
1006 Ga0496114_0442556
1007 Ga0496114_0464653
1008 Ga0496115_0046507
1009 Ga0496115_0275959
1010 Ga0501292_041751
1011 Ga0501038_0370801
1012 Ga0501039_0144823
1013 Ga0501041_0613893
1014 Ga0501048_0043324
1015 Ga0501071_0015089
1016 Ga0501072_0103742
1017 Ga0501074_0033003
1018 Ga0501076_0006005
1019 Ga0501077_0001052
1020 Ga0501079_0034467
1021 Ga0501080_0358314
1022 Ga0501080_0879544
1023 Ga0501081_0322519
1024 nmdc:mga05p37_533846_c1
1025 nmdc:mga05p37_55929_c1
1026 nmdc:mga0n895_206028_c1
1027 nmdc:mga0n895_300611_c1
1028 nmdc:mga0n895_566071_c1
1029 nmdc:mga0rr50_126230_c1
1030 nmdc:mga08x19_806181_c1
1031 Ga0501084_0020185
1032 Ga0587073_0065207
1033 Ga0587071_026479
1034 2644485350
1035 2644634901
1036 2902817045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v9y-assembly1.cif.gz_B crystal structure of the heme pas sensor domain of ec dos (ferric form) 0.7942 83 101
8j07-assembly1.cif.gz_n8 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.6782 83 105
4za1-assembly1.cif.gz_C crystal structure of nosa involved in nosiheptide biosynthesis 0.6702 43 105
6rbd-assembly1.cif.gz_D state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles 0.6504 76 105
7pqs-assembly2.cif.gz_B srpk1 in complex with msc2711186 0.6274 43 101
ID Description Score Start End Superfamily
1v9yB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7942 83 101 3.30.450.20
af_A0A1D8PGQ1_72_162_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.7209 83 104 3.30.1140.40
af_V6CJ96_17_233_2.70.170.10 Mainly Beta;Distorted Sandwich;Acetylcholine Binding Protein; Chain: A,;Neurotransmitter-gated ion-channel ligand-binding domain 0.709 83 103 2.70.170.10
af_F1QSA4_140_244_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6876 83 105 2.60.40.10
af_O62446_513_619_2.30.34.10 Mainly Beta;Roll;Leishmanolysin; domain 4;Leishmanolysin domain 4 0.6634 81 104 2.30.34.10
ID Description Score Start End GO Terms
AF-A0A2S8MZH3-F1-model_v4 deleted 0.9645 49 134
AF-A0A2S8MZH3-F1-model_v4 deleted 0.9538 49 134
AF-A9G1P7-F1-model_v4 ABM domain-containing protein 0.9111 38 188
AF-A9G1P7-F1-model_v4 ABM domain-containing protein 0.9 38 188
AF-A0A4Y4KJW0-F1-model_v4 Uncharacterized protein 0.8871 18 188

Map