F458276

General Info

Members Datasets Scaffolds Average Seq Length
518 239 1036 468

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100000178|Ga0307415_1000001784
Length 518
Sequence MRTIADGSFHRMRRMSSGHSAARTLGGRPPQRHAAGTMTNRLVTAENRKWWTLAAVGFGLFMIMLDNTVVNVALPTIQRELGAGLSELEWIVSGYALTFAALMLTGGKLADLFGRRRIFVIGLAMFSGSSLACALAPSAGFLIGARVAQGAGAALMNPATLSIITATFPPRQRGTAIGIWAGVSALALAIGPLVGGLLTEHVGWSAIFYINVPIGLVAIAASFLLIDESKDTTQDQRPDVPGLLSSAVGLFALTYGLIEANGYGWASGRILGAFALAAAALAAFVVLERQQRAPMVDLGLFRDGTFAGANLLLLLVALAMFGVFFFLSLYLQNVLGYSPVKAGAAFLPMTGLIMAVAPLAGRLSDRRGSRWLLTGGMALLAAQLLYFSRLGVHEGFWSLVPGMLLGGAGMGAAMAPATAAGLSGVPVDKAGVGSAVLNSSRQLGGSIGIALIGAIMAHEIGGRSTPVAFVHGLSVALEVRPHVDRDAPNAHSPGRASGRPAGERGPTSGLPAEAEAQA

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
154 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
155 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
158 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 6.56
Rhizosphere 93.24
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100000178 3300032126 Bacteria 28406
2 JGI24743J22301_10003054 3300001991 Bacteria 2604
3 JGI24738J21930_10004411 3300002075 Bacteria 3450
4 JGI25407J50210_10001197 3300003373 Bacteria 5780
5 JGI25407J50210_10006429 3300003373 Bacteria 2926
6 Ga0070658_10015736 3300005327 Bacteria 6048
7 Ga0070658_10051018 3300005327 Bacteria 3353
8 Ga0070690_100030445 3300005330 Bacteria 3354
9 Ga0070670_100000812 3300005331 Bacteria 24328
10 Ga0070680_100005260 3300005336 Bacteria 9791
11 Ga0070680_100010865 3300005336 Bacteria 7034
12 Ga0070682_100004723 3300005337 Bacteria 7569
13 Ga0070682_100004730 3300005337 Bacteria 7564
14 Ga0070682_100006396 3300005337 Bacteria 6614
15 Ga0068868_100007477 3300005338 Bacteria 7780
16 Ga0068868_100034259 3300005338 Bacteria 3919
17 Ga0070660_100002458 3300005339 Bacteria 12706
18 Ga0070660_100019362 3300005339 Bacteria 4986
19 Ga0070660_100164648 3300005339 Bacteria 1788
20 Ga0070689_100010798 3300005340 Bacteria 6525
21 Ga0070691_10002408 3300005341 Bacteria 8296
22 Ga0070691_10017460 3300005341 Bacteria 3301
23 Ga0070692_10101848 3300005345 Bacteria 1575
24 Ga0070668_100163584 3300005347 Bacteria 1807
25 Ga0070669_100073579 3300005353 Bacteria 2532
26 Ga0070671_100012207 3300005355 Bacteria 6912
27 Ga0070671_100014611 3300005355 Bacteria 6348
28 Ga0070671_100079161 3300005355 Bacteria 2747
29 Ga0070674_100004968 3300005356 Bacteria 7622
30 Ga0070674_100018143 3300005356 Bacteria 4442
31 Ga0070659_100006017 3300005366 Bacteria 8749
32 Ga0070659_100124838 3300005366 Bacteria 2088
33 Ga0070667_100130357 3300005367 Bacteria 2194
34 Ga0070713_100011977 3300005436 Bacteria 6345
35 Ga0070710_10006306 3300005437 Bacteria 5688
36 Ga0070710_10020053 3300005437 Bacteria 3464
37 Ga0070701_10010394 3300005438 Bacteria 4114
38 Ga0070701_10019381 3300005438 Bacteria 3212
39 Ga0070711_100004428 3300005439 Bacteria 8290
40 Ga0070700_100002719 3300005441 Bacteria 9037
41 Ga0070700_100022857 3300005441 Bacteria 3652
42 Ga0070700_100046305 3300005441 Bacteria 2686
43 Ga0070694_100027400 3300005444 Bacteria 3700
44 Ga0070708_100188889 3300005445 Bacteria 1927
45 Ga0070663_100082548 3300005455 Bacteria 2364
46 Ga0070678_100006896 3300005456 Bacteria 6699
47 Ga0070678_100011752 3300005456 Bacteria 5415
48 Ga0070678_100049517 3300005456 Bacteria 3033
49 Ga0070662_100010040 3300005457 Bacteria 6203
50 Ga0070681_10079907 3300005458 Bacteria 3226
51 Ga0068867_100037172 3300005459 Bacteria 3538
52 Ga0070685_10012672 3300005466 Bacteria 4434
53 Ga0070698_100021704 3300005471 Bacteria 6722
54 Ga0070698_100099469 3300005471 Bacteria 2882
55 Ga0070698_100118307 3300005471 Bacteria 2611
56 Ga0070679_100024335 3300005530 Bacteria 5934
57 Ga0070679_100168986 3300005530 Bacteria 2159
58 Ga0068853_100006599 3300005539 Bacteria 9240
59 Ga0068853_100011088 3300005539 Bacteria 7310
60 Ga0068853_100133663 3300005539 Bacteria 2223
61 Ga0070672_100008063 3300005543 Bacteria 7198
62 Ga0070686_100000943 3300005544 Bacteria 16754
63 Ga0070695_100013789 3300005545 Bacteria 4860
64 Ga0070704_100061339 3300005549 Bacteria 2691
65 Ga0068855_100105907 3300005563 Bacteria 3233
66 Ga0068857_100002049 3300005577 Bacteria 16363
67 Ga0068854_100009559 3300005578 Bacteria 6258
68 Ga0068854_100013972 3300005578 Bacteria 5282
69 Ga0068854_100054754 3300005578 Bacteria 2870
70 Ga0068856_100044136 3300005614 Bacteria 4386
71 Ga0070702_100022749 3300005615 Bacteria 3320
72 Ga0068852_100001675 3300005616 Bacteria 15093
73 Ga0068852_100049273 3300005616 Bacteria 3603
74 Ga0068859_100109580 3300005617 Bacteria 2822
75 Ga0068861_100004853 3300005719 Bacteria 9046
76 Ga0068851_10004635 3300005834 Bacteria 6206
77 Ga0068870_10000660 3300005840 Bacteria 13161
78 Ga0068863_100181444 3300005841 Bacteria 2020
79 Ga0081455_10001632 3300005937 Bacteria 27349
80 Ga0081455_10061732 3300005937 Bacteria 3153
81 Ga0081455_10113783 3300005937 Bacteria 2145
82 Ga0081538_10000232 3300005981 Bacteria 62755
83 Ga0081538_10001314 3300005981 Bacteria 25660
84 Ga0081538_10003640 3300005981 Bacteria 14490
85 Ga0081538_10004394 3300005981 Bacteria 13016
86 Ga0081538_10012502 3300005981 Bacteria 6801
87 Ga0081539_10001603 3300005985 Bacteria 37270
88 Ga0081539_10001744 3300005985 Bacteria 34702
89 Ga0070717_10059155 3300006028 Bacteria 3170
90 Ga0070715_10003965 3300006163 Bacteria 4792
91 Ga0070715_10039635 3300006163 Bacteria 1964
92 Ga0070716_100000830 3300006173 Bacteria 13319
93 Ga0070712_100025137 3300006175 Bacteria 3955
94 Ga0075362_10001308 3300006177 Bacteria 7895
95 Ga0068871_100008129 3300006358 Bacteria 7532
96 Ga0068871_100042795 3300006358 Bacteria 3638
97 Ga0075428_100031527 3300006844 Bacteria 5857
98 Ga0075428_100152998 3300006844 Bacteria 2506
99 Ga0075430_100000493 3300006846 Bacteria 29659
100 Ga0075431_100131700 3300006847 Bacteria 2579
101 Ga0075433_10006740 3300006852 Bacteria 9101
102 Ga0075434_100021014 3300006871 Bacteria 6341
103 Ga0075429_100022644 3300006880 Bacteria 5447
104 Ga0075429_100023334 3300006880 Bacteria 5367
105 Ga0068865_100001504 3300006881 Bacteria 13602
106 Ga0068865_100038194 3300006881 Bacteria 3248
107 Ga0075436_100033015 3300006914 Bacteria 3566
108 Ga0097620_100109584 3300006931 Bacteria 2822
109 Ga0075435_100008499 3300007076 Bacteria 7371
110 Ga0075435_100106045 3300007076 Bacteria 2333
111 Ga0111539_10027004 3300009094 Bacteria 7012
112 Ga0111539_10067594 3300009094 Bacteria 4220
113 Ga0111539_10137341 3300009094 Bacteria 2863
114 Ga0111539_10293066 3300009094 Bacteria 1893
115 Ga0105245_10010008 3300009098 Bacteria 8256
116 Ga0105245_10046116 3300009098 Bacteria 3894
117 Ga0105245_10143306 3300009098 Bacteria 2252
118 Ga0105247_10015709 3300009101 Bacteria 4533
119 Ga0105247_10043440 3300009101 Bacteria 2753
120 Ga0105247_10055101 3300009101 Bacteria 2454
121 Ga0114129_10003564 3300009147 Bacteria 21912
122 Ga0114129_10003593 3300009147 Bacteria 21816
123 Ga0114129_10007461 3300009147 Bacteria 15578
124 Ga0114129_10033600 3300009147 Bacteria 7247
125 Ga0114129_10068366 3300009147 Bacteria 4953
126 Ga0114129_10088310 3300009147 Bacteria 4298
127 Ga0114129_10091595 3300009147 Bacteria 4212
128 Ga0114129_10099408 3300009147 Bacteria 4027
129 Ga0114129_10372301 3300009147 Bacteria 1888
130 Ga0114129_10413095 3300009147 Bacteria 1777
131 Ga0105243_10012062 3300009148 Bacteria 6534
132 Ga0105243_10029360 3300009148 Bacteria 4228
133 Ga0105243_10060721 3300009148 Bacteria 3020
134 Ga0105241_10032526 3300009174 Bacteria 3911
135 Ga0105248_10018672 3300009177 Bacteria 7666
136 Ga0105248_10071509 3300009177 Bacteria 3897
137 Ga0105248_10209179 3300009177 Bacteria 2198
138 Ga0105249_10000587 3300009553 Bacteria 33206
139 Ga0105249_10003122 3300009553 Bacteria 14318
140 Ga0105249_10028845 3300009553 Bacteria 5009
141 Ga0105239_10006265 3300010375 Bacteria 13837
142 Ga0105239_10031155 3300010375 Bacteria 5868
143 Ga0105246_10020692 3300011119 Bacteria 4223
144 Ga0157371_10020653 3300013102 Bacteria 4845
145 Ga0157374_10100881 3300013296 Bacteria 2767
146 Ga0163162_10001280 3300013306 Bacteria 23542
147 Ga0163162_10029690 3300013306 Bacteria 5412
148 Ga0163162_10083531 3300013306 Bacteria 3268
149 Ga0157372_10042425 3300013307 Bacteria 5032
150 Ga0157372_10083744 3300013307 Bacteria 3613
151 Ga0157372_10220782 3300013307 Bacteria 2197
152 Ga0157372_10298273 3300013307 Bacteria 1875
153 Ga0157375_10017667 3300013308 Bacteria 6444
154 Ga0157375_10021373 3300013308 Bacteria 5932
155 Ga0163163_10276994 3300014325 Unclassified 1729
156 Ga0157380_10003890 3300014326 Bacteria 10299
157 Ga0157377_10000519 3300014745 Bacteria 16326
158 Ga0157377_10028742 3300014745 Bacteria 2995
159 Ga0207692_10006009 3300025898 Bacteria 4908
160 Ga0207710_10033613 3300025900 Bacteria 2250
161 Ga0207688_10010219 3300025901 Bacteria 5109
162 Ga0207685_10018560 3300025905 Bacteria 2273
163 Ga0207699_10007757 3300025906 Bacteria 5255
164 Ga0207643_10009316 3300025908 Bacteria 5276
165 Ga0207684_10069101 3300025910 Bacteria 3002
166 Ga0207654_10037679 3300025911 Bacteria 2708
167 Ga0207707_10004389 3300025912 Bacteria 12455
168 Ga0207693_10001256 3300025915 Bacteria 22567
169 Ga0207693_10001266 3300025915 Bacteria 22523
170 Ga0207663_10016425 3300025916 Bacteria 4104
171 Ga0207660_10008331 3300025917 Bacteria 6702
172 Ga0207662_10011287 3300025918 Bacteria 4947
173 Ga0207662_10045762 3300025918 Bacteria 2587
174 Ga0207657_10002174 3300025919 Bacteria 21240
175 Ga0207657_10003932 3300025919 Bacteria 15776
176 Ga0207657_10084303 3300025919 Bacteria 2664
177 Ga0207652_10014630 3300025921 Bacteria 6359
178 Ga0207652_10087669 3300025921 Bacteria 2729
179 Ga0207694_10054018 3300025924 Bacteria 3116
180 Ga0207650_10009458 3300025925 Bacteria 6659
181 Ga0207687_10006514 3300025927 Bacteria 7712
182 Ga0207664_10013433 3300025929 Bacteria 5878
183 Ga0207664_10206548 3300025929 Bacteria 1698
184 Ga0207644_10151653 3300025931 Bacteria 1794
185 Ga0207690_10036950 3300025932 Bacteria 3167
186 Ga0207706_10015869 3300025933 Bacteria 6809
187 Ga0207706_10016919 3300025933 Bacteria 6577
188 Ga0207706_10069116 3300025933 Bacteria 3106
189 Ga0207686_10053495 3300025934 Bacteria 2524
190 Ga0207709_10000790 3300025935 Bacteria 24700
191 Ga0207670_10011598 3300025936 Bacteria 5123
192 Ga0207669_10031489 3300025937 Bacteria 2964
193 Ga0207704_10001817 3300025938 Bacteria 9562
194 Ga0207665_10000793 3300025939 Bacteria 21330
195 Ga0207691_10012484 3300025940 Bacteria 8145
196 Ga0207661_10026388 3300025944 Bacteria 4426
197 Ga0207661_10040627 3300025944 Bacteria 3658
198 Ga0207712_10092843 3300025961 Bacteria 2226
199 Ga0207712_10100935 3300025961 Bacteria 2145
200 Ga0207668_10017852 3300025972 Bacteria 4454
201 Ga0207639_10028328 3300026041 Bacteria 4088
202 Ga0207639_10062607 3300026041 Bacteria 2878
203 Ga0207678_10006147 3300026067 Bacteria 10682
204 Ga0207678_10055477 3300026067 Bacteria 3413
205 Ga0207708_10000415 3300026075 Bacteria 33470
206 Ga0207708_10010983 3300026075 Bacteria 6736
207 Ga0207641_10033544 3300026088 Bacteria 4265
208 Ga0207648_10000705 3300026089 Bacteria 37489
209 Ga0207648_10003750 3300026089 Bacteria 15885
210 Ga0207676_10041064 3300026095 Bacteria 3548
211 Ga0207675_100001825 3300026118 Bacteria 21355
212 Ga0207675_100028570 3300026118 Bacteria 5193
213 Ga0207675_100040401 3300026118 Bacteria 4356
214 Ga0207683_10001271 3300026121 Bacteria 22865
215 Ga0207683_10031119 3300026121 Bacteria 4630
216 Ga0207683_10081888 3300026121 Bacteria 2866
217 Ga0207683_10258832 3300026121 Bacteria 1589
218 Ga0207698_10055825 3300026142 Bacteria 3046
219 Ga0207428_10012856 3300027907 Bacteria 7339
220 Ga0207428_10037934 3300027907 Bacteria 3920
221 Ga0207428_10106561 3300027907 Bacteria 2161
222 Ga0268264_10057802 3300028381 Bacteria 3245
223 Ga0265319_1010684 3300028563 Bacteria 3816
224 Ga0265318_10003338 3300028577 Bacteria 8117
225 Ga0265322_10008143 3300028654 Bacteria 3055
226 Ga0265338_10063591 3300028800 Bacteria 3216
227 Ga0265320_10024962 3300031240 Bacteria 3149
228 Ga0265327_10005584 3300031251 Bacteria 10432
229 Ga0307413_10041197 3300031824 Bacteria 2702
230 Ga0307410_10027759 3300031852 Bacteria 3580
231 Ga0307407_10034843 3300031903 Bacteria 2760
232 Ga0307409_100030623 3300031995 Bacteria 3869
233 Ga0307409_100040932 3300031995 Bacteria 3456
234 Ga0307416_100023040 3300032002 Bacteria 4510
235 Ga0307416_100102584 3300032002 Bacteria 2495
236 Ga0307416_100192922 3300032002 Bacteria 1923
237 Ga0373958_0007036 3300034819 Bacteria 1777
238 Ga0373962_0005855 3300035242 Bacteria 2966
239 Ga0373933_0027495 3300035724 Bacteria 3276
240 Ga0373937_0009529 3300036401 Bacteria 8445
241 Ga0395899_0002275 3300037312 Bacteria 15690
242 Ga0395899_0032386 3300037312 Bacteria 3926
243 Ga0395899_0075091 3300037312 Bacteria 2469
244 Ga0395899_0075811 3300037312 Bacteria 2456
245 Ga0395899_0123973 3300037312 Bacteria 1848
246 Ga0395900_0001501 3300037418 Bacteria 27705
247 Ga0395900_0004234 3300037418 Bacteria 15230
248 Ga0395900_0011210 3300037418 Bacteria 9167
249 Ga0395900_0013079 3300037418 Bacteria 8477
250 Ga0395900_0013923 3300037418 Bacteria 8209
251 Ga0395900_0016217 3300037418 Bacteria 7590
252 Ga0395900_0018047 3300037418 Bacteria 7202
253 Ga0395900_0018276 3300037418 Bacteria 7152
254 Ga0395900_0021305 3300037418 Bacteria 6626
255 Ga0395900_0028702 3300037418 Bacteria 5703
256 Ga0395900_0044391 3300037418 Bacteria 4580
257 Ga0395900_0072693 3300037418 Bacteria 3535
258 Ga0395900_0086455 3300037418 Bacteria 3222
259 Ga0395900_0093188 3300037418 Bacteria 3094
260 Ga0395900_0101217 3300037418 Bacteria 2959
261 Ga0395900_0166222 3300037418 Bacteria 2248
262 Ga0395900_0180054 3300037418 Bacteria 2148
263 Ga0395900_0272061 3300037418 Bacteria 1688
264 Ga0395898_0022299 3300037466 Bacteria 6413
265 Ga0395898_0037542 3300037466 Bacteria 4804
266 Ga0395898_0077072 3300037466 Bacteria 3218
267 Ga0395898_0078127 3300037466 Bacteria 3194
268 Ga0395898_0089269 3300037466 Bacteria 2966
269 Ga0395898_0111637 3300037466 Bacteria 2620
270 Ga0395898_0160871 3300037466 Bacteria 2147
271 Ga0395898_0204115 3300037466 Bacteria 1886
272 Ga0395905_0005632 3300037471 Bacteria 12741
273 Ga0395905_0006070 3300037471 Bacteria 12223
274 Ga0395905_0010485 3300037471 Bacteria 9012
275 Ga0395905_0010561 3300037471 Bacteria 8968
276 Ga0395905_0023118 3300037471 Bacteria 5877
277 Ga0395905_0028362 3300037471 Bacteria 5278
278 Ga0395905_0028725 3300037471 Bacteria 5241
279 Ga0395905_0033019 3300037471 Bacteria 4865
280 Ga0395905_0048420 3300037471 Bacteria 3983
281 Ga0395905_0095382 3300037471 Bacteria 2792
282 Ga0395901_0001042 3300038443 Bacteria 29911
283 Ga0395901_0005040 3300038443 Bacteria 13338
284 Ga0395901_0005491 3300038443 Bacteria 12845
285 Ga0395901_0010102 3300038443 Bacteria 9564
286 Ga0395901_0010892 3300038443 Bacteria 9216
287 Ga0395901_0012688 3300038443 Bacteria 8548
288 Ga0395901_0021825 3300038443 Bacteria 6562
289 Ga0395901_0041297 3300038443 Bacteria 4780
290 Ga0395901_0048996 3300038443 Bacteria 4388
291 Ga0395901_0065404 3300038443 Bacteria 3786
292 Ga0395901_0068461 3300038443 Bacteria 3697
293 Ga0395901_0070569 3300038443 Bacteria 3640
294 Ga0395901_0110011 3300038443 Bacteria 2893
295 Ga0395901_0117099 3300038443 Bacteria 2799
296 Ga0395901_0159934 3300038443 Bacteria 2365
297 Ga0395901_0171978 3300038443 Bacteria 2273
298 Ga0395901_0253364 3300038443 Bacteria 1834
299 Ga0439431_0003705 3300041997 Bacteria 3378
300 Ga0439433_0002047 3300041999 Bacteria 4242
301 Ga0439462_0000209 3300042015 Bacteria 10242
302 Ga0450920_004150 3300042122 Bacteria 2537
303 Ga0439446_0000387 3300042156 Bacteria 8478
304 Ga0439446_0002326 3300042156 Bacteria 4548
305 Ga0450909_005133 3300042185 Bacteria 1883
306 Ga0450918_005053 3300042531 Bacteria 2375
307 Ga0466965_0010362 3300044683 Bacteria 4346
308 Ga0466966_0026759 3300044684 Bacteria 3764
309 Ga0466961_0007880 3300044693 Bacteria 6784
310 Ga0466971_0001600 3300044719 Bacteria 9559
311 Ga0466971_0003085 3300044719 Bacteria 7080
312 Ga0466957_0020466 3300044842 Bacteria 3893
313 Ga0466958_0023051 3300045836 Bacteria 3650
314 Ga0466967_0101006 3300045976 Bacteria 2636
315 Ga0495603_0051284 3300046455 Bacteria 2452
316 Ga0495603_0055568 3300046455 Bacteria 2346
317 Ga0495653_0032442 3300046463 Bacteria 4146
318 Ga0495584_0064140 3300046491 Bacteria 1847
319 Ga0495608_0002720 3300046511 Bacteria 12708
320 Ga0495630_0008222 3300046517 Bacteria 7493
321 Ga0495630_0062146 3300046517 Bacteria 2805
322 Ga0495665_0077673 3300046531 Bacteria 1747
323 Ga0495634_0075759 3300046642 Bacteria 2209
324 Ga0495657_0033392 3300046675 Bacteria 3583
325 Ga0495657_0075398 3300046675 Bacteria 2193
326 Ga0495599_0129085 3300046678 Bacteria 1570
327 Ga0495581_0004207 3300047315 Bacteria 8298
328 Ga0495680_0002766 3300047322 Bacteria 17688
329 Ga0495680_0050390 3300047322 Bacteria 3256
330 Ga0495684_0089838 3300047471 Bacteria 2327
331 Ga0495684_0153487 3300047471 Bacteria 1721
332 Ga0496100_0082175 3300048903 Bacteria 2178
333 Ga0496100_0146313 3300048903 Bacteria 1680
334 Ga0496101_0071808 3300048904 Bacteria 2538
335 Ga0496102_0022269 3300048905 Bacteria 5614
336 Ga0496102_0027686 3300048905 Bacteria 5061
337 Ga0496102_0040157 3300048905 Bacteria 4231
338 Ga0496102_0150559 3300048905 Bacteria 2186
339 Ga0496103_0149291 3300048906 Bacteria 1497
340 Ga0496104_0030514 3300048907 Bacteria 5010
341 Ga0496104_0125703 3300048907 Bacteria 2462
342 Ga0496105_0036956 3300048908 Bacteria 4023
343 Ga0496106_0004202 3300048909 Bacteria 10732
344 Ga0496106_0018415 3300048909 Bacteria 5162
345 Ga0496106_0022893 3300048909 Bacteria 4640
346 Ga0496106_0132789 3300048909 Bacteria 1953
347 Ga0496107_0008003 3300048910 Bacteria 7297
348 Ga0496107_0014550 3300048910 Bacteria 5506
349 Ga0496108_0011238 3300048911 Bacteria 7273
350 Ga0496108_0118796 3300048911 Bacteria 2266
351 Ga0496109_0012018 3300048912 Bacteria 7456
352 Ga0496109_0016106 3300048912 Bacteria 6533
353 Ga0496110_0009837 3300048913 Bacteria 7747
354 Ga0496110_0038523 3300048913 Bacteria 4160
355 Ga0496111_0007880 3300048914 Bacteria 7021
356 Ga0496111_0012139 3300048914 Bacteria 5826
357 Ga0496111_0013313 3300048914 Bacteria 5594
358 Ga0496112_0026230 3300048915 Bacteria 5604
359 Ga0496112_0064732 3300048915 Bacteria 3608
360 Ga0496113_0014863 3300048916 Bacteria 5328
361 Ga0496114_0006533 3300048917 Bacteria 9188
362 Ga0496114_0008480 3300048917 Bacteria 8145
363 Ga0496115_0022429 3300048918 Bacteria 4891
364 Ga0496115_0105628 3300048918 Bacteria 2311
365 Ga0496115_0137178 3300048918 Bacteria 2017
366 Ga0501031_0002040 3300049568 Bacteria 12709
367 Ga0501031_0009117 3300049568 Bacteria 6454
368 Ga0501031_0013865 3300049568 Bacteria 5253
369 Ga0501032_0055733 3300049569 Bacteria 2659
370 Ga0501032_0062933 3300049569 Bacteria 2485
371 Ga0501032_0073166 3300049569 Bacteria 2283
372 Ga0501034_0086523 3300049571 Bacteria 3135
373 Ga0501036_0000292 3300049572 Bacteria 34675
374 Ga0501036_0012167 3300049572 Bacteria 7129
375 Ga0501036_0020277 3300049572 Bacteria 5584
376 Ga0501036_0030512 3300049572 Bacteria 4553
377 Ga0501037_0085872 3300049573 Bacteria 2278
378 Ga0501037_0115367 3300049573 Bacteria 1933
379 Ga0501038_0015520 3300049574 Bacteria 6923
380 Ga0501038_0037084 3300049574 Bacteria 4277
381 Ga0501039_0007993 3300049575 Bacteria 8060
382 Ga0501039_0013507 3300049575 Bacteria 6245
383 Ga0501039_0018605 3300049575 Bacteria 5332
384 Ga0501039_0091895 3300049575 Bacteria 2365
385 Ga0501039_0094484 3300049575 Bacteria 2331
386 Ga0501039_0177099 3300049575 Bacteria 1677
387 Ga0501040_0004312 3300049576 Bacteria 9241
388 Ga0501040_0016612 3300049576 Bacteria 4876
389 Ga0501040_0110571 3300049576 Bacteria 1921
390 Ga0501040_0159687 3300049576 Bacteria 1593
391 Ga0501041_0003770 3300049577 Bacteria 8716
392 Ga0501041_0010801 3300049577 Bacteria 5386
393 Ga0501041_0027264 3300049577 Bacteria 3442
394 Ga0501041_0037094 3300049577 Bacteria 2952
395 Ga0501041_0042058 3300049577 Bacteria 2775
396 Ga0501042_0002209 3300049578 Bacteria 11869
397 Ga0501042_0006417 3300049578 Bacteria 7629
398 Ga0501042_0013388 3300049578 Bacteria 5580
399 Ga0501042_0017877 3300049578 Bacteria 4899
400 Ga0501042_0031104 3300049578 Bacteria 3776
401 Ga0501042_0039184 3300049578 Bacteria 3366
402 Ga0501043_0063990 3300049579 Bacteria 2888
403 Ga0501046_0009805 3300049580 Bacteria 8257
404 Ga0501046_0049002 3300049580 Bacteria 3343
405 Ga0501046_0062361 3300049580 Bacteria 2913
406 Ga0501046_0196122 3300049580 Bacteria 1504
407 Ga0501048_0038922 3300049582 Bacteria 3412
408 Ga0501048_0042861 3300049582 Bacteria 3239
409 Ga0501048_0120776 3300049582 Bacteria 1851
410 Ga0501067_0021491 3300049583 Bacteria 3571
411 Ga0501067_0029218 3300049583 Bacteria 3055
412 Ga0501067_0046404 3300049583 Bacteria 2411
413 Ga0501068_0010551 3300049584 Bacteria 5192
414 Ga0501068_0023059 3300049584 Bacteria 3646
415 Ga0501068_0104414 3300049584 Bacteria 1758
416 Ga0501069_0014011 3300049585 Bacteria 4283
417 Ga0501069_0014571 3300049585 Bacteria 4204
418 Ga0501069_0129875 3300049585 Bacteria 1442
419 Ga0501070_0016178 3300049586 Bacteria 6268
420 Ga0501070_0043801 3300049586 Bacteria 3724
421 Ga0501070_0127937 3300049586 Bacteria 2099
422 Ga0501071_0002185 3300049587 Bacteria 11766
423 Ga0501071_0004946 3300049587 Bacteria 8513
424 Ga0501071_0033009 3300049587 Bacteria 3678
425 Ga0501072_0004023 3300049588 Bacteria 11121
426 Ga0501072_0012219 3300049588 Bacteria 6562
427 Ga0501072_0018829 3300049588 Bacteria 5326
428 Ga0501072_0048958 3300049588 Bacteria 3326
429 Ga0501072_0067088 3300049588 Bacteria 2831
430 Ga0501072_0165901 3300049588 Bacteria 1762
431 Ga0501073_0023097 3300049589 Bacteria 4471
432 Ga0501073_0062133 3300049589 Bacteria 2605
433 Ga0501073_0063875 3300049589 Bacteria 2567
434 Ga0501074_0016904 3300049590 Bacteria 5293
435 Ga0501074_0035171 3300049590 Bacteria 3629
436 Ga0501075_0000166 3300049591 Bacteria 34245
437 Ga0501075_0034175 3300049591 Bacteria 3784
438 Ga0501075_0050788 3300049591 Bacteria 3118
439 Ga0501075_0078449 3300049591 Bacteria 2499
440 Ga0501075_0114819 3300049591 Bacteria 2047
441 Ga0501076_0001762 3300049592 Bacteria 14639
442 Ga0501076_0005520 3300049592 Bacteria 9109
443 Ga0501076_0007689 3300049592 Bacteria 7850
444 Ga0501076_0022385 3300049592 Bacteria 4858
445 Ga0501076_0031663 3300049592 Bacteria 4127
446 Ga0501076_0065513 3300049592 Bacteria 2897
447 Ga0501077_0000708 3300049593 Bacteria 20146
448 Ga0501077_0001259 3300049593 Bacteria 15274
449 Ga0501077_0004809 3300049593 Bacteria 8211
450 Ga0501077_0012645 3300049593 Bacteria 5284
451 Ga0501077_0015431 3300049593 Bacteria 4810
452 Ga0501077_0070895 3300049593 Bacteria 2208
453 Ga0501079_0014129 3300049741 Bacteria 6086
454 Ga0501079_0108479 3300049741 Bacteria 2155
455 Ga0501080_0033101 3300049742 Bacteria 4824
456 Ga0501080_0087965 3300049742 Bacteria 2886
457 Ga0501080_0107633 3300049742 Bacteria 2584
458 Ga0501081_0000280 3300049743 Bacteria 26904
459 Ga0501081_0016814 3300049743 Bacteria 4836
460 Ga0501081_0017596 3300049743 Bacteria 4735
461 Ga0501081_0038880 3300049743 Bacteria 3253
462 Ga0501081_0046114 3300049743 Bacteria 2995
463 Ga0501083_0009664 3300049744 Bacteria 6813
464 Ga0501083_0017165 3300049744 Bacteria 5048
465 Ga0501083_0071485 3300049744 Bacteria 2307
466 Ga0501035_0040865 3300049822 Bacteria 4189
467 Ga0501035_0059941 3300049822 Bacteria 3389
468 Ga0501035_0086268 3300049822 Bacteria 2766
469 Ga0501044_0075258 3300049823 Bacteria 3428
470 Ga0501045_0006176 3300049824 Bacteria 8295
471 Ga0501045_0007988 3300049824 Bacteria 7369
472 Ga0501045_0008287 3300049824 Bacteria 7235
473 Ga0501045_0014609 3300049824 Bacteria 5567
474 Ga0501045_0051471 3300049824 Bacteria 3005
475 Ga0501045_0062675 3300049824 Bacteria 2728
476 Ga0501045_0170778 3300049824 Bacteria 1619
477 nmdc:mga05p37_137600_c1 3300050507 Bacteria 2994
478 nmdc:mga05p37_28659_c1 3300050507 Bacteria 6792
479 nmdc:mga05p37_30772_c1 3300050507 Bacteria 6551
480 nmdc:mga05p37_424332_c1 3300050507 Bacteria 1547
481 nmdc:mga05p37_82047_c1 3300050507 Bacteria 3972
482 nmdc:mga09592_17549_c1 3300050508 Bacteria 5864
483 nmdc:mga09592_20856_c1 3300050508 Bacteria 5394
484 nmdc:mga09592_29172_c1 3300050508 Bacteria 4589
485 nmdc:mga06r32_6991_c1 3300050510 Bacteria 10157
486 nmdc:mga08y16_182478_c1 3300050511 Bacteria 2179
487 nmdc:mga08y16_19545_c1 3300050511 Bacteria 7142
488 nmdc:mga08y16_62212_c1 3300050511 Bacteria 3898
489 nmdc:mga08y16_79518_c1 3300050511 Bacteria 3417
490 nmdc:mga0n895_42104_c1 3300050512 Bacteria 4443
491 nmdc:mga0rr50_132646_c1 3300050513 Bacteria 1996
492 nmdc:mga0rr50_15395_c1 3300050513 Bacteria 5048
493 nmdc:mga0rr50_84821_c1 3300050513 Bacteria 2453
494 nmdc:mga08x19_16011_c1 3300050514 Bacteria 4569
495 nmdc:mga0a205_29222_c1 3300050515 Bacteria 5275
496 nmdc:mga0a205_6925_c1 3300050515 Bacteria 10250
497 Ga0495601_0114027 3300053077 Bacteria 1752
498 Ga0495612_0020666 3300053078 Bacteria 2639
499 Ga0495619_0034031 3300053085 Bacteria 3311
500 Ga0501084_0000470 3300054114 Bacteria 31185
501 Ga0501084_0005031 3300054114 Bacteria 10814
502 Ga0501084_0019042 3300054114 Bacteria 5717
503 Ga0501084_0029404 3300054114 Bacteria 4596
504 Ga0501084_0035345 3300054114 Bacteria 4177
505 Ga0501084_0068530 3300054114 Bacteria 2970
506 Ga0501084_0096448 3300054114 Bacteria 2483
507 Ga0501082_0010212 3300060353 Bacteria 8082
508 Ga0501082_0011585 3300060353 Bacteria 7585
509 Ga0501082_0012422 3300060353 Bacteria 7318
510 Ga0501082_0015763 3300060353 Bacteria 6501
511 Ga0501082_0023940 3300060353 Bacteria 5266
512 Ga0501082_0134810 3300060353 Bacteria 2142
513 Ga0466962_0014146 3300061719 Bacteria 3844
514 Ga0530510_0009791 3300061734 Bacteria 6726
515 Ga0530510_0012967 3300061734 Bacteria 5860
516 Ga0530510_0019242 3300061734 Bacteria 4846
517 Ga0530510_0089410 3300061734 Bacteria 2245
518 Ga0530510_0170520 3300061734 Bacteria 1612
519 Ga0307415_100000178
520 JGI24743J22301_10003054
521 JGI24738J21930_10004411
522 JGI25407J50210_10001197
523 JGI25407J50210_10006429
524 Ga0070658_10015736
525 Ga0070658_10051018
526 Ga0070690_100030445
527 Ga0070670_100000812
528 Ga0070680_100005260
529 Ga0070680_100010865
530 Ga0070682_100004723
531 Ga0070682_100004730
532 Ga0070682_100006396
533 Ga0068868_100007477
534 Ga0068868_100034259
535 Ga0070660_100002458
536 Ga0070660_100019362
537 Ga0070660_100164648
538 Ga0070689_100010798
539 Ga0070691_10002408
540 Ga0070691_10017460
541 Ga0070692_10101848
542 Ga0070668_100163584
543 Ga0070669_100073579
544 Ga0070671_100012207
545 Ga0070671_100014611
546 Ga0070671_100079161
547 Ga0070674_100004968
548 Ga0070674_100018143
549 Ga0070659_100006017
550 Ga0070659_100124838
551 Ga0070667_100130357
552 Ga0070713_100011977
553 Ga0070710_10006306
554 Ga0070710_10020053
555 Ga0070701_10010394
556 Ga0070701_10019381
557 Ga0070711_100004428
558 Ga0070700_100002719
559 Ga0070700_100022857
560 Ga0070700_100046305
561 Ga0070694_100027400
562 Ga0070708_100188889
563 Ga0070663_100082548
564 Ga0070678_100006896
565 Ga0070678_100011752
566 Ga0070678_100049517
567 Ga0070662_100010040
568 Ga0070681_10079907
569 Ga0068867_100037172
570 Ga0070685_10012672
571 Ga0070698_100021704
572 Ga0070698_100099469
573 Ga0070698_100118307
574 Ga0070679_100024335
575 Ga0070679_100168986
576 Ga0068853_100006599
577 Ga0068853_100011088
578 Ga0068853_100133663
579 Ga0070672_100008063
580 Ga0070686_100000943
581 Ga0070695_100013789
582 Ga0070704_100061339
583 Ga0068855_100105907
584 Ga0068857_100002049
585 Ga0068854_100009559
586 Ga0068854_100013972
587 Ga0068854_100054754
588 Ga0068856_100044136
589 Ga0070702_100022749
590 Ga0068852_100001675
591 Ga0068852_100049273
592 Ga0068859_100109580
593 Ga0068861_100004853
594 Ga0068851_10004635
595 Ga0068870_10000660
596 Ga0068863_100181444
597 Ga0081455_10001632
598 Ga0081455_10061732
599 Ga0081455_10113783
600 Ga0081538_10000232
601 Ga0081538_10001314
602 Ga0081538_10003640
603 Ga0081538_10004394
604 Ga0081538_10012502
605 Ga0081539_10001603
606 Ga0081539_10001744
607 Ga0070717_10059155
608 Ga0070715_10003965
609 Ga0070715_10039635
610 Ga0070716_100000830
611 Ga0070712_100025137
612 Ga0075362_10001308
613 Ga0068871_100008129
614 Ga0068871_100042795
615 Ga0075428_100031527
616 Ga0075428_100152998
617 Ga0075430_100000493
618 Ga0075431_100131700
619 Ga0075433_10006740
620 Ga0075434_100021014
621 Ga0075429_100022644
622 Ga0075429_100023334
623 Ga0068865_100001504
624 Ga0068865_100038194
625 Ga0075436_100033015
626 Ga0097620_100109584
627 Ga0075435_100008499
628 Ga0075435_100106045
629 Ga0111539_10027004
630 Ga0111539_10067594
631 Ga0111539_10137341
632 Ga0111539_10293066
633 Ga0105245_10010008
634 Ga0105245_10046116
635 Ga0105245_10143306
636 Ga0105247_10015709
637 Ga0105247_10043440
638 Ga0105247_10055101
639 Ga0114129_10003564
640 Ga0114129_10003593
641 Ga0114129_10007461
642 Ga0114129_10033600
643 Ga0114129_10068366
644 Ga0114129_10088310
645 Ga0114129_10091595
646 Ga0114129_10099408
647 Ga0114129_10372301
648 Ga0114129_10413095
649 Ga0105243_10012062
650 Ga0105243_10029360
651 Ga0105243_10060721
652 Ga0105241_10032526
653 Ga0105248_10018672
654 Ga0105248_10071509
655 Ga0105248_10209179
656 Ga0105249_10000587
657 Ga0105249_10003122
658 Ga0105249_10028845
659 Ga0105239_10006265
660 Ga0105239_10031155
661 Ga0105246_10020692
662 Ga0157371_10020653
663 Ga0157374_10100881
664 Ga0163162_10001280
665 Ga0163162_10029690
666 Ga0163162_10083531
667 Ga0157372_10042425
668 Ga0157372_10083744
669 Ga0157372_10220782
670 Ga0157372_10298273
671 Ga0157375_10017667
672 Ga0157375_10021373
673 Ga0163163_10276994
674 Ga0157380_10003890
675 Ga0157377_10000519
676 Ga0157377_10028742
677 Ga0207692_10006009
678 Ga0207710_10033613
679 Ga0207688_10010219
680 Ga0207685_10018560
681 Ga0207699_10007757
682 Ga0207643_10009316
683 Ga0207684_10069101
684 Ga0207654_10037679
685 Ga0207707_10004389
686 Ga0207693_10001256
687 Ga0207693_10001266
688 Ga0207663_10016425
689 Ga0207660_10008331
690 Ga0207662_10011287
691 Ga0207662_10045762
692 Ga0207657_10002174
693 Ga0207657_10003932
694 Ga0207657_10084303
695 Ga0207652_10014630
696 Ga0207652_10087669
697 Ga0207694_10054018
698 Ga0207650_10009458
699 Ga0207687_10006514
700 Ga0207664_10013433
701 Ga0207664_10206548
702 Ga0207644_10151653
703 Ga0207690_10036950
704 Ga0207706_10015869
705 Ga0207706_10016919
706 Ga0207706_10069116
707 Ga0207686_10053495
708 Ga0207709_10000790
709 Ga0207670_10011598
710 Ga0207669_10031489
711 Ga0207704_10001817
712 Ga0207665_10000793
713 Ga0207691_10012484
714 Ga0207661_10026388
715 Ga0207661_10040627
716 Ga0207712_10092843
717 Ga0207712_10100935
718 Ga0207668_10017852
719 Ga0207639_10028328
720 Ga0207639_10062607
721 Ga0207678_10006147
722 Ga0207678_10055477
723 Ga0207708_10000415
724 Ga0207708_10010983
725 Ga0207641_10033544
726 Ga0207648_10000705
727 Ga0207648_10003750
728 Ga0207676_10041064
729 Ga0207675_100001825
730 Ga0207675_100028570
731 Ga0207675_100040401
732 Ga0207683_10001271
733 Ga0207683_10031119
734 Ga0207683_10081888
735 Ga0207683_10258832
736 Ga0207698_10055825
737 Ga0207428_10012856
738 Ga0207428_10037934
739 Ga0207428_10106561
740 Ga0268264_10057802
741 Ga0265319_1010684
742 Ga0265318_10003338
743 Ga0265322_10008143
744 Ga0265338_10063591
745 Ga0265320_10024962
746 Ga0265327_10005584
747 Ga0307413_10041197
748 Ga0307410_10027759
749 Ga0307407_10034843
750 Ga0307409_100030623
751 Ga0307409_100040932
752 Ga0307416_100023040
753 Ga0307416_100102584
754 Ga0307416_100192922
755 Ga0373958_0007036
756 Ga0373962_0005855
757 Ga0373933_0027495
758 Ga0373937_0009529
759 Ga0395899_0002275
760 Ga0395899_0032386
761 Ga0395899_0075091
762 Ga0395899_0075811
763 Ga0395899_0123973
764 Ga0395900_0001501
765 Ga0395900_0004234
766 Ga0395900_0011210
767 Ga0395900_0013079
768 Ga0395900_0013923
769 Ga0395900_0016217
770 Ga0395900_0018047
771 Ga0395900_0018276
772 Ga0395900_0021305
773 Ga0395900_0028702
774 Ga0395900_0044391
775 Ga0395900_0072693
776 Ga0395900_0086455
777 Ga0395900_0093188
778 Ga0395900_0101217
779 Ga0395900_0166222
780 Ga0395900_0180054
781 Ga0395900_0272061
782 Ga0395898_0022299
783 Ga0395898_0037542
784 Ga0395898_0077072
785 Ga0395898_0078127
786 Ga0395898_0089269
787 Ga0395898_0111637
788 Ga0395898_0160871
789 Ga0395898_0204115
790 Ga0395905_0005632
791 Ga0395905_0006070
792 Ga0395905_0010485
793 Ga0395905_0010561
794 Ga0395905_0023118
795 Ga0395905_0028362
796 Ga0395905_0028725
797 Ga0395905_0033019
798 Ga0395905_0048420
799 Ga0395905_0095382
800 Ga0395901_0001042
801 Ga0395901_0005040
802 Ga0395901_0005491
803 Ga0395901_0010102
804 Ga0395901_0010892
805 Ga0395901_0012688
806 Ga0395901_0021825
807 Ga0395901_0041297
808 Ga0395901_0048996
809 Ga0395901_0065404
810 Ga0395901_0068461
811 Ga0395901_0070569
812 Ga0395901_0110011
813 Ga0395901_0117099
814 Ga0395901_0159934
815 Ga0395901_0171978
816 Ga0395901_0253364
817 Ga0439431_0003705
818 Ga0439433_0002047
819 Ga0439462_0000209
820 Ga0450920_004150
821 Ga0439446_0000387
822 Ga0439446_0002326
823 Ga0450909_005133
824 Ga0450918_005053
825 Ga0466965_0010362
826 Ga0466966_0026759
827 Ga0466961_0007880
828 Ga0466971_0001600
829 Ga0466971_0003085
830 Ga0466957_0020466
831 Ga0466958_0023051
832 Ga0466967_0101006
833 Ga0495603_0051284
834 Ga0495603_0055568
835 Ga0495653_0032442
836 Ga0495584_0064140
837 Ga0495608_0002720
838 Ga0495630_0008222
839 Ga0495630_0062146
840 Ga0495665_0077673
841 Ga0495634_0075759
842 Ga0495657_0033392
843 Ga0495657_0075398
844 Ga0495599_0129085
845 Ga0495581_0004207
846 Ga0495680_0002766
847 Ga0495680_0050390
848 Ga0495684_0089838
849 Ga0495684_0153487
850 Ga0496100_0082175
851 Ga0496100_0146313
852 Ga0496101_0071808
853 Ga0496102_0022269
854 Ga0496102_0027686
855 Ga0496102_0040157
856 Ga0496102_0150559
857 Ga0496103_0149291
858 Ga0496104_0030514
859 Ga0496104_0125703
860 Ga0496105_0036956
861 Ga0496106_0004202
862 Ga0496106_0018415
863 Ga0496106_0022893
864 Ga0496106_0132789
865 Ga0496107_0008003
866 Ga0496107_0014550
867 Ga0496108_0011238
868 Ga0496108_0118796
869 Ga0496109_0012018
870 Ga0496109_0016106
871 Ga0496110_0009837
872 Ga0496110_0038523
873 Ga0496111_0007880
874 Ga0496111_0012139
875 Ga0496111_0013313
876 Ga0496112_0026230
877 Ga0496112_0064732
878 Ga0496113_0014863
879 Ga0496114_0006533
880 Ga0496114_0008480
881 Ga0496115_0022429
882 Ga0496115_0105628
883 Ga0496115_0137178
884 Ga0501031_0002040
885 Ga0501031_0009117
886 Ga0501031_0013865
887 Ga0501032_0055733
888 Ga0501032_0062933
889 Ga0501032_0073166
890 Ga0501034_0086523
891 Ga0501036_0000292
892 Ga0501036_0012167
893 Ga0501036_0020277
894 Ga0501036_0030512
895 Ga0501037_0085872
896 Ga0501037_0115367
897 Ga0501038_0015520
898 Ga0501038_0037084
899 Ga0501039_0007993
900 Ga0501039_0013507
901 Ga0501039_0018605
902 Ga0501039_0091895
903 Ga0501039_0094484
904 Ga0501039_0177099
905 Ga0501040_0004312
906 Ga0501040_0016612
907 Ga0501040_0110571
908 Ga0501040_0159687
909 Ga0501041_0003770
910 Ga0501041_0010801
911 Ga0501041_0027264
912 Ga0501041_0037094
913 Ga0501041_0042058
914 Ga0501042_0002209
915 Ga0501042_0006417
916 Ga0501042_0013388
917 Ga0501042_0017877
918 Ga0501042_0031104
919 Ga0501042_0039184
920 Ga0501043_0063990
921 Ga0501046_0009805
922 Ga0501046_0049002
923 Ga0501046_0062361
924 Ga0501046_0196122
925 Ga0501048_0038922
926 Ga0501048_0042861
927 Ga0501048_0120776
928 Ga0501067_0021491
929 Ga0501067_0029218
930 Ga0501067_0046404
931 Ga0501068_0010551
932 Ga0501068_0023059
933 Ga0501068_0104414
934 Ga0501069_0014011
935 Ga0501069_0014571
936 Ga0501069_0129875
937 Ga0501070_0016178
938 Ga0501070_0043801
939 Ga0501070_0127937
940 Ga0501071_0002185
941 Ga0501071_0004946
942 Ga0501071_0033009
943 Ga0501072_0004023
944 Ga0501072_0012219
945 Ga0501072_0018829
946 Ga0501072_0048958
947 Ga0501072_0067088
948 Ga0501072_0165901
949 Ga0501073_0023097
950 Ga0501073_0062133
951 Ga0501073_0063875
952 Ga0501074_0016904
953 Ga0501074_0035171
954 Ga0501075_0000166
955 Ga0501075_0034175
956 Ga0501075_0050788
957 Ga0501075_0078449
958 Ga0501075_0114819
959 Ga0501076_0001762
960 Ga0501076_0005520
961 Ga0501076_0007689
962 Ga0501076_0022385
963 Ga0501076_0031663
964 Ga0501076_0065513
965 Ga0501077_0000708
966 Ga0501077_0001259
967 Ga0501077_0004809
968 Ga0501077_0012645
969 Ga0501077_0015431
970 Ga0501077_0070895
971 Ga0501079_0014129
972 Ga0501079_0108479
973 Ga0501080_0033101
974 Ga0501080_0087965
975 Ga0501080_0107633
976 Ga0501081_0000280
977 Ga0501081_0016814
978 Ga0501081_0017596
979 Ga0501081_0038880
980 Ga0501081_0046114
981 Ga0501083_0009664
982 Ga0501083_0017165
983 Ga0501083_0071485
984 Ga0501035_0040865
985 Ga0501035_0059941
986 Ga0501035_0086268
987 Ga0501044_0075258
988 Ga0501045_0006176
989 Ga0501045_0007988
990 Ga0501045_0008287
991 Ga0501045_0014609
992 Ga0501045_0051471
993 Ga0501045_0062675
994 Ga0501045_0170778
995 nmdc:mga05p37_137600_c1
996 nmdc:mga05p37_28659_c1
997 nmdc:mga05p37_30772_c1
998 nmdc:mga05p37_424332_c1
999 nmdc:mga05p37_82047_c1
1000 nmdc:mga09592_17549_c1
1001 nmdc:mga09592_20856_c1
1002 nmdc:mga09592_29172_c1
1003 nmdc:mga06r32_6991_c1
1004 nmdc:mga08y16_182478_c1
1005 nmdc:mga08y16_19545_c1
1006 nmdc:mga08y16_62212_c1
1007 nmdc:mga08y16_79518_c1
1008 nmdc:mga0n895_42104_c1
1009 nmdc:mga0rr50_132646_c1
1010 nmdc:mga0rr50_15395_c1
1011 nmdc:mga0rr50_84821_c1
1012 nmdc:mga08x19_16011_c1
1013 nmdc:mga0a205_29222_c1
1014 nmdc:mga0a205_6925_c1
1015 Ga0495601_0114027
1016 Ga0495612_0020666
1017 Ga0495619_0034031
1018 Ga0501084_0000470
1019 Ga0501084_0005031
1020 Ga0501084_0019042
1021 Ga0501084_0029404
1022 Ga0501084_0035345
1023 Ga0501084_0068530
1024 Ga0501084_0096448
1025 Ga0501082_0010212
1026 Ga0501082_0011585
1027 Ga0501082_0012422
1028 Ga0501082_0015763
1029 Ga0501082_0023940
1030 Ga0501082_0134810
1031 Ga0466962_0014146
1032 Ga0530510_0009791
1033 Ga0530510_0012967
1034 Ga0530510_0019242
1035 Ga0530510_0089410
1036 Ga0530510_0170520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

56

449

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8613 18 457
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8159 17 451
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8076 18 457
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.7948 21 453
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.7912 21 453
ID Description Score Start End Superfamily
af_O69695_290_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9164 253 457 1.20.1250.20
af_P9WJY5_299_520_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9123 252 454 1.20.1250.20
af_Q2FW85_259_476_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9094 250 453 1.20.1250.20
af_O69695_290_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9075 253 457 1.20.1250.20
af_P13090_265_521_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8865 190 448 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I3CSG7-F1-model_v4 deleted 0.9259 228 462
AF-A0A2V6J6L0-F1-model_v4 MFS transporter 0.9198 207 455 GO:0016020
GO:0022857
AF-A0A7V1P2Y4-F1-model_v4 deleted 0.9072 269 459
AF-A0A3B8NKJ6-F1-model_v4 MFS transporter 0.9049 33 460 GO:0005886
GO:0022857
AF-A0A7V3REI8-F1-model_v4 MFS transporter 0.9045 229 459 GO:0016020
GO:0022857

Map