F458238

General Info

Members Datasets Scaffolds Average Seq Length
518 261 1036 135

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10056684|Ga0099794_100566842
Length 147
Sequence MNEKLGMRDKLAFTRDYQRKIPFVTHLKILTETLGEGTARLSLPIEPHLTNSLGTAHGGVIVSLLDVALCTAARTLHPESMGVITIDLSTSFIGGAGGSKLIAEARVLRDGRSMSFVEAEAKNEDGSLVAKAIATVRVRHKKDGDNR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
215 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.58
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10056684 3300007265 Bacteria 1896
2 JGI25406J46586_10035146 3300003203 Bacteria 1832
3 Ga0065707_10261720 3300005295 Bacteria 1087
4 Ga0070690_100000214 3300005330 Bacteria 30128
5 Ga0070690_100025738 3300005330 Bacteria 3624
6 Ga0070690_100238507 3300005330 Bacteria 1281
7 Ga0070690_101120340 3300005330 Bacteria 625
8 Ga0070690_101409731 3300005330 Bacteria 561
9 Ga0068869_100000046 3300005334 Bacteria 51500
10 Ga0070666_10130798 3300005335 Unclassified 1744
11 Ga0070680_100001489 3300005336 Bacteria 17031
12 Ga0070680_100063916 3300005336 Bacteria 3016
13 Ga0068868_100859224 3300005338 Bacteria 822
14 Ga0068868_100905706 3300005338 Bacteria 802
15 Ga0070689_100005826 3300005340 Bacteria 8459
16 Ga0070689_100015280 3300005340 Bacteria 5594
17 Ga0070689_100085493 3300005340 Bacteria 2480
18 Ga0070691_10044562 3300005341 Bacteria 2104
19 Ga0070691_10057704 3300005341 Bacteria 1863
20 Ga0070687_100139980 3300005343 Bacteria 1408
21 Ga0070692_10331421 3300005345 Bacteria 939
22 Ga0070675_100470025 3300005354 Unclassified 1130
23 Ga0070675_100846156 3300005354 Bacteria 837
24 Ga0070674_100414094 3300005356 Bacteria 1104
25 Ga0070688_100094955 3300005365 Bacteria 1956
26 Ga0070709_11567432 3300005434 Unclassified 536
27 Ga0070710_10056914 3300005437 Bacteria 2214
28 Ga0070701_10000152 3300005438 Bacteria 21231
29 Ga0070701_10193645 3300005438 Bacteria 1198
30 Ga0070705_100000302 3300005440 Bacteria 29246
31 Ga0070700_100000276 3300005441 Bacteria 27414
32 Ga0070700_100165903 3300005441 Bacteria 1525
33 Ga0070700_100219682 3300005441 Bacteria 1346
34 Ga0070694_100000062 3300005444 Bacteria 51304
35 Ga0070694_100081443 3300005444 Unclassified 2252
36 Ga0070694_100119724 3300005444 Bacteria 1887
37 Ga0070694_100218434 3300005444 Bacteria 1429
38 Ga0070694_100599683 3300005444 Bacteria 887
39 Ga0070694_100730073 3300005444 Bacteria 807
40 Ga0070678_100404956 3300005456 Bacteria 1186
41 Ga0070681_10026128 3300005458 Bacteria 5871
42 Ga0070681_10366448 3300005458 Bacteria 1351
43 Ga0068867_100000649 3300005459 Bacteria 23047
44 Ga0068867_101166568 3300005459 Bacteria 706
45 Ga0070685_10192535 3300005466 Unclassified 1320
46 Ga0070699_100530289 3300005518 Unclassified 1071
47 Ga0070699_101183634 3300005518 Bacteria 701
48 Ga0070679_100001291 3300005530 Bacteria 22116
49 Ga0070679_100189262 3300005530 Bacteria 2028
50 Ga0070697_100042864 3300005536 Bacteria 3663
51 Ga0070697_101964042 3300005536 Unclassified 524
52 Ga0068853_100042330 3300005539 Bacteria 3894
53 Ga0070686_100000300 3300005544 Bacteria 33053
54 Ga0070686_100104030 3300005544 Bacteria 1923
55 Ga0070686_100570183 3300005544 Bacteria 888
56 Ga0070686_100698597 3300005544 Bacteria 809
57 Ga0070695_100008896 3300005545 Bacteria 5964
58 Ga0070695_100303116 3300005545 Bacteria 1182
59 Ga0070695_100343122 3300005545 Bacteria 1117
60 Ga0070695_100938943 3300005545 Bacteria 701
61 Ga0070696_100000702 3300005546 Bacteria 21382
62 Ga0070696_100020599 3300005546 Bacteria 4468
63 Ga0070696_100719960 3300005546 Bacteria 815
64 Ga0070696_101344139 3300005546 Bacteria 608
65 Ga0070696_101502299 3300005546 Bacteria 577
66 Ga0070693_100000129 3300005547 Bacteria 33789
67 Ga0068855_100011405 3300005563 Bacteria 10734
68 Ga0068855_100744226 3300005563 Bacteria 1046
69 Ga0068857_100383777 3300005577 Bacteria 1305
70 Ga0068856_100019730 3300005614 Bacteria 6542
71 Ga0070702_100000026 3300005615 Bacteria 42816
72 Ga0070702_100345685 3300005615 Bacteria 1046
73 Ga0068852_100082170 3300005616 Bacteria 2862
74 Ga0068859_100003492 3300005617 Bacteria 16005
75 Ga0068864_100020067 3300005618 Bacteria 5589
76 Ga0068866_10000142 3300005718 Bacteria 32302
77 Ga0068861_100000167 3300005719 Bacteria 34703
78 Ga0068870_10329300 3300005840 Unclassified 973
79 Ga0068858_100000538 3300005842 Bacteria 39473
80 Ga0068860_100000859 3300005843 Bacteria 33852
81 Ga0068860_100114179 3300005843 Bacteria 2583
82 Ga0068862_100002150 3300005844 Bacteria 17746
83 Ga0081539_10002623 3300005985 Bacteria 24577
84 Ga0097621_100004219 3300006237 Bacteria 9979
85 Ga0097621_100008072 3300006237 Bacteria 7562
86 Ga0068871_100000374 3300006358 Bacteria 31271
87 Ga0068871_100036866 3300006358 Bacteria 3895
88 Ga0075428_100002178 3300006844 Bacteria 21195
89 Ga0075428_100227661 3300006844 Bacteria 2012
90 Ga0075428_100293572 3300006844 Bacteria 1748
91 Ga0075428_100732791 3300006844 Bacteria 1052
92 Ga0075430_100003485 3300006846 Bacteria 13164
93 Ga0075430_100008481 3300006846 Bacteria 8682
94 Ga0075430_100050204 3300006846 Bacteria 3519
95 Ga0075430_100372212 3300006846 Bacteria 1179
96 Ga0075430_100410058 3300006846 Bacteria 1118
97 Ga0075430_100756868 3300006846 Bacteria 801
98 Ga0075431_100200922 3300006847 Bacteria 2039
99 Ga0075431_100210940 3300006847 Bacteria 1984
100 Ga0075431_100316659 3300006847 Bacteria 1574
101 Ga0075431_100463915 3300006847 Bacteria 1261
102 Ga0075433_10034283 3300006852 Bacteria 4358
103 Ga0075433_10155219 3300006852 Bacteria 2036
104 Ga0075433_11868028 3300006852 Bacteria 516
105 Ga0075434_100000065 3300006871 Bacteria 54115
106 Ga0075434_100002726 3300006871 Bacteria 15603
107 Ga0075434_100049777 3300006871 Bacteria 4161
108 Ga0075434_101710392 3300006871 Unclassified 637
109 Ga0075429_100000925 3300006880 Bacteria 23282
110 Ga0075429_100095840 3300006880 Bacteria 2588
111 Ga0075429_100553775 3300006880 Bacteria 1008
112 Ga0075436_100040959 3300006914 Bacteria 3196
113 Ga0075436_100066931 3300006914 Bacteria 2483
114 Ga0097620_100003492 3300006931 Bacteria 16005
115 Ga0075435_100000756 3300007076 Bacteria 20084
116 Ga0075435_100006010 3300007076 Bacteria 8544
117 Ga0075435_100012279 3300007076 Bacteria 6335
118 Ga0075435_100029871 3300007076 Bacteria 4281
119 Ga0075435_100236721 3300007076 Bacteria 1552
120 Ga0099794_10029463 3300007265 Bacteria 2558
121 Ga0099794_10228679 3300007265 Bacteria 957
122 Ga0105240_10659769 3300009093 Bacteria 1145
123 Ga0111539_10008103 3300009094 Bacteria 13388
124 Ga0111539_10087967 3300009094 Bacteria 3650
125 Ga0111539_10233272 3300009094 Bacteria 2142
126 Ga0111539_10738400 3300009094 Bacteria 1146
127 Ga0111539_12041710 3300009094 Bacteria 665
128 Ga0105245_10002231 3300009098 Bacteria 17548
129 Ga0114129_10001618 3300009147 Bacteria 30524
130 Ga0114129_10016784 3300009147 Bacteria 10423
131 Ga0114129_10582696 3300009147 Bacteria 1451
132 Ga0114129_12807536 3300009147 Unclassified 579
133 Ga0105243_10000641 3300009148 Bacteria 34668
134 Ga0105241_11284222 3300009174 Unclassified 696
135 Ga0105242_10000151 3300009176 Bacteria 51190
136 Ga0105237_11434686 3300009545 Unclassified 697
137 Ga0105249_10000850 3300009553 Bacteria 27279
138 Ga0099796_10184774 3300010159 Bacteria 838
139 Ga0105239_10824285 3300010375 Unclassified 1063
140 Ga0105246_10032893 3300011119 Bacteria 3442
141 Ga0157374_10435524 3300013296 Bacteria 1311
142 Ga0157378_10000657 3300013297 Bacteria 32543
143 Ga0157372_11976852 3300013307 Bacteria 670
144 Ga0157380_10031493 3300014326 Bacteria 4071
145 Ga0157380_11105871 3300014326 Unclassified 832
146 Ga0157376_10042009 3300014969 Bacteria 3746
147 Ga0157376_10057228 3300014969 Bacteria 3260
148 Ga0207692_10092551 3300025898 Bacteria 1643
149 Ga0207642_10000469 3300025899 Bacteria 12349
150 Ga0207647_10076239 3300025904 Bacteria 2017
151 Ga0207643_10042347 3300025908 Bacteria 2567
152 Ga0207654_10412555 3300025911 Unclassified 941
153 Ga0207707_10027621 3300025912 Bacteria 4961
154 Ga0207707_10061049 3300025912 Bacteria 3280
155 Ga0207707_10405644 3300025912 Bacteria 1170
156 Ga0207707_10794725 3300025912 Bacteria 789
157 Ga0207660_10006756 3300025917 Bacteria 7428
158 Ga0207660_10138116 3300025917 Bacteria 1861
159 Ga0207660_10403929 3300025917 Bacteria 1100
160 Ga0207662_10000141 3300025918 Bacteria 34713
161 Ga0207662_10293009 3300025918 Bacteria 1080
162 Ga0207652_10004259 3300025921 Bacteria 11678
163 Ga0207652_10152556 3300025921 Bacteria 2069
164 Ga0207652_10595339 3300025921 Bacteria 992
165 Ga0207659_10404361 3300025926 Unclassified 1143
166 Ga0207659_10793503 3300025926 Bacteria 813
167 Ga0207687_10007632 3300025927 Bacteria 7112
168 Ga0207709_10202137 3300025935 Bacteria 1420
169 Ga0207670_10000218 3300025936 Bacteria 37420
170 Ga0207670_10004195 3300025936 Bacteria 7726
171 Ga0207670_10384724 3300025936 Bacteria 1118
172 Ga0207704_10000492 3300025938 Bacteria 17627
173 Ga0207689_10000656 3300025942 Bacteria 33014
174 Ga0207667_10025521 3300025949 Bacteria 6467
175 Ga0207651_10168496 3300025960 Bacteria 1725
176 Ga0207640_10001372 3300025981 Bacteria 13175
177 Ga0207677_10323917 3300026023 Bacteria 1282
178 Ga0207677_10950401 3300026023 Bacteria 777
179 Ga0207703_10022961 3300026035 Bacteria 4898
180 Ga0207703_10088965 3300026035 Bacteria 2593
181 Ga0207708_10003922 3300026075 Bacteria 10946
182 Ga0207708_10058327 3300026075 Bacteria 2945
183 Ga0207708_10188798 3300026075 Bacteria 1639
184 Ga0207702_10151795 3300026078 Bacteria 2108
185 Ga0207648_10000898 3300026089 Bacteria 33537
186 Ga0207648_10280567 3300026089 Bacteria 1490
187 Ga0207648_11429650 3300026089 Bacteria 650
188 Ga0207676_10015111 3300026095 Bacteria 5567
189 Ga0207674_10599432 3300026116 Bacteria 1064
190 Ga0207675_100000733 3300026118 Bacteria 32544
191 Ga0207675_102543709 3300026118 Bacteria 522
192 Ga0209969_1002118 3300027360 Bacteria 2733
193 Ga0209967_1000759 3300027364 Bacteria 4140
194 Ga0209967_1019362 3300027364 Bacteria 989
195 Ga0209996_1000684 3300027395 Bacteria 4057
196 Ga0210000_1002012 3300027462 Bacteria 2871
197 Ga0209995_1004215 3300027471 Bacteria 2298
198 Ga0209968_1006673 3300027526 Bacteria 1741
199 Ga0209999_1003859 3300027543 Bacteria 2695
200 Ga0209999_1006547 3300027543 Bacteria 2092
201 Ga0209588_1084758 3300027671 Bacteria 1023
202 Ga0209971_1029354 3300027682 Bacteria 1317
203 Ga0209974_10046130 3300027876 Bacteria 1457
204 Ga0207428_10003882 3300027907 Bacteria 14333
205 Ga0207428_10011342 3300027907 Bacteria 7882
206 Ga0268265_10000643 3300028380 Bacteria 34764
207 Ga0268265_10582886 3300028380 Bacteria 1066
208 Ga0268264_10000816 3300028381 Bacteria 33573
209 Ga0307408_100136341 3300031548 Bacteria 1921
210 Ga0307408_100752734 3300031548 Bacteria 880
211 Ga0307408_101253071 3300031548 Bacteria 693
212 Ga0316575_10115075 3300031665 Bacteria 1098
213 Ga0316579_10004247 3300031691 Bacteria 5674
214 Ga0316578_10587662 3300031728 Bacteria 653
215 Ga0307405_10199551 3300031731 Bacteria 1452
216 Ga0307406_11143910 3300031901 Bacteria 674
217 Ga0307412_10232351 3300031911 Bacteria 1421
218 Ga0307416_100452859 3300032002 Bacteria 1336
219 Ga0307416_100698337 3300032002 Bacteria 1103
220 Ga0373948_0056655 3300034817 Bacteria 853
221 Ga0373948_0087454 3300034817 Bacteria 719
222 Ga0373958_0002663 3300034819 Bacteria 2525
223 Ga0373938_0148555 3300034957 Bacteria 622
224 Ga0373926_0216121 3300035083 Bacteria 739
225 Ga0373928_0062570 3300035084 Bacteria 903
226 Ga0373929_0013058 3300035085 Bacteria 1587
227 Ga0373934_0086446 3300035086 Bacteria 1262
228 Ga0373934_0096792 3300035086 Bacteria 1192
229 Ga0373940_0004689 3300035088 Bacteria 2906
230 Ga0373940_0081760 3300035088 Bacteria 956
231 Ga0373944_0045594 3300035089 Bacteria 1368
232 Ga0373949_0018912 3300035090 Bacteria 1565
233 Ga0373951_0071645 3300035091 Bacteria 884
234 Ga0373952_0016849 3300035092 Bacteria 1492
235 Ga0373932_0007578 3300035112 Bacteria 2586
236 Ga0373932_0101598 3300035112 Bacteria 936
237 Ga0373936_0016196 3300035113 Bacteria 2866
238 Ga0373936_0101299 3300035113 Bacteria 1215
239 Ga0373939_0056370 3300035114 Bacteria 1236
240 Ga0373941_0002659 3300035115 Bacteria 3962
241 Ga0373941_0062116 3300035115 Bacteria 1218
242 Ga0373941_0196782 3300035115 Bacteria 764
243 Ga0373945_0005171 3300035116 Bacteria 4167
244 Ga0373953_0008656 3300035117 Bacteria 3466
245 Ga0373953_0111025 3300035117 Bacteria 1159
246 Ga0373954_0000094 3300035118 Bacteria 30419
247 Ga0373954_0326296 3300035118 Bacteria 758
248 Ga0373956_0153774 3300035119 Bacteria 1083
249 Ga0373956_0177443 3300035119 Bacteria 1006
250 Ga0373956_0196417 3300035119 Bacteria 956
251 Ga0373957_0063984 3300035120 Bacteria 1429
252 Ga0373960_0033104 3300035121 Bacteria 1456
253 Ga0373960_0219103 3300035121 Bacteria 680
254 Ga0373946_0018544 3300035171 Bacteria 2673
255 Ga0373955_0038886 3300035172 Bacteria 2537
256 Ga0373955_0214156 3300035172 Bacteria 1149
257 Ga0373955_0531176 3300035172 Bacteria 719
258 Ga0373942_0002715 3300035207 Bacteria 4231
259 Ga0373962_0030642 3300035242 Bacteria 1472
260 Ga0373962_0142998 3300035242 Unclassified 778
261 Ga0373924_0003524 3300035410 Bacteria 5398
262 Ga0373924_0432916 3300035410 Bacteria 589
263 Ga0373931_0001145 3300035691 Bacteria 11276
264 Ga0373931_0006091 3300035691 Bacteria 5619
265 Ga0373931_0220691 3300035691 Bacteria 1141
266 Ga0373931_0497331 3300035691 Bacteria 786
267 Ga0373935_0073806 3300035692 Bacteria 2204
268 Ga0373935_0088855 3300035692 Bacteria 2019
269 Ga0373935_0169699 3300035692 Bacteria 1492
270 Ga0373927_0262181 3300035695 Bacteria 1136
271 Ga0373933_0048323 3300035724 Bacteria 2533
272 Ga0373933_0166102 3300035724 Bacteria 1403
273 Ga0373933_0301532 3300035724 Bacteria 1037
274 Ga0373937_0000449 3300036401 Bacteria 37990
275 Ga0373937_0031645 3300036401 Bacteria 4795
276 Ga0373937_0063384 3300036401 Bacteria 3399
277 Ga0373937_0599227 3300036401 Bacteria 1046
278 Ga0373925_0102817 3300037068 Bacteria 2198
279 Ga0373925_0227742 3300037068 Bacteria 1489
280 Ga0439439_0090815 3300041406 Bacteria 834
281 Ga0439461_0014182 3300041410 Bacteria 1512
282 Ga0451800_0469163 3300041459 Unclassified 584
283 Ga0451807_0045908 3300041486 Unclassified 841
284 Ga0451839_1369546 3300041496 Bacteria 581
285 Ga0451853_2412548 3300041512 Bacteria 787
286 Ga0439433_0136899 3300041999 Bacteria 625
287 Ga0439462_0056152 3300042015 Bacteria 1063
288 Ga0439434_0091654 3300042435 Bacteria 972
289 Ga0439435_0000006 3300042436 Bacteria 24825
290 Ga0451577_0022272 3300042876 Bacteria 5786
291 Ga0451577_0402037 3300042876 Bacteria 1243
292 Ga0466965_0586573 3300044683 Bacteria 632
293 Ga0466964_0218513 3300044706 Bacteria 924
294 Ga0453684_1155491 3300044712 Bacteria 815
295 Ga0466957_0026870 3300044842 Bacteria 3417
296 Ga0451576_0002975 3300045051 Bacteria 24009
297 Ga0451576_0076387 3300045051 Bacteria 3485
298 Ga0451576_0291488 3300045051 Bacteria 1706
299 Ga0451576_0431124 3300045051 Bacteria 1383
300 Ga0451576_1274142 3300045051 Bacteria 766
301 Ga0495653_0092976 3300046463 Bacteria 2201
302 Ga0495580_0004159 3300046472 Bacteria 12167
303 Ga0495582_0890832 3300046473 Bacteria 514
304 Ga0495639_0009307 3300046475 Bacteria 4212
305 Ga0495639_0183894 3300046475 Bacteria 1018
306 Ga0495662_0004818 3300046476 Bacteria 6763
307 Ga0495662_0597779 3300046476 Bacteria 540
308 Ga0495608_0010394 3300046511 Bacteria 6495
309 Ga0495608_0109646 3300046511 Bacteria 1775
310 Ga0495608_0197204 3300046511 Bacteria 1270
311 Ga0495618_0400150 3300046514 Bacteria 840
312 Ga0495628_0006337 3300046516 Bacteria 10341
313 Ga0495628_0168084 3300046516 Bacteria 1664
314 Ga0495630_0001124 3300046517 Bacteria 18441
315 Ga0495630_0044567 3300046517 Bacteria 3315
316 Ga0495630_0439027 3300046517 Bacteria 1000
317 Ga0495630_0906732 3300046517 Bacteria 671
318 Ga0495666_0006290 3300046526 Bacteria 5981
319 Ga0495642_0082942 3300046528 Bacteria 1352
320 Ga0495642_0145543 3300046528 Bacteria 1024
321 Ga0495652_0052066 3300046529 Bacteria 3493
322 Ga0495652_0289571 3300046529 Bacteria 1196
323 Ga0495665_0096218 3300046531 Bacteria 1555
324 Ga0495640_0001398 3300046533 Bacteria 18997
325 Ga0495640_0021347 3300046533 Bacteria 4755
326 Ga0495586_0001311 3300046535 Bacteria 13836
327 Ga0495586_0005650 3300046535 Bacteria 6685
328 Ga0495586_0181030 3300046535 Bacteria 1192
329 Ga0495598_0003898 3300046537 Bacteria 3197
330 Ga0495598_0161841 3300046537 Bacteria 788
331 Ga0495621_0091024 3300046539 Bacteria 1149
332 Ga0495667_0017435 3300046559 Bacteria 4850
333 Ga0495667_0213378 3300046559 Bacteria 1233
334 Ga0495667_0396736 3300046559 Bacteria 869
335 Ga0495656_0102327 3300046615 Bacteria 1327
336 Ga0495634_0004109 3300046642 Bacteria 11527
337 Ga0495659_0007042 3300046664 Bacteria 3557
338 Ga0495659_0131390 3300046664 Bacteria 993
339 Ga0495588_0081611 3300046674 Bacteria 1688
340 Ga0495657_0044941 3300046675 Bacteria 3000
341 Ga0495599_0072731 3300046678 Bacteria 2146
342 Ga0495647_0015389 3300046681 Bacteria 2679
343 Ga0495647_0057594 3300046681 Bacteria 1526
344 Ga0495658_0015876 3300046683 Bacteria 3870
345 Ga0495658_0321163 3300046683 Bacteria 981
346 Ga0495669_0006201 3300046684 Bacteria 4989
347 Ga0495613_0014125 3300046689 Bacteria 5925
348 Ga0495624_0016753 3300046690 Bacteria 4932
349 Ga0495624_0043008 3300046690 Bacteria 2883
350 Ga0495624_0177411 3300046690 Bacteria 1299
351 Ga0495670_0423872 3300046691 Unclassified 720
352 Ga0495600_0161660 3300046809 Bacteria 1447
353 Ga0495600_0264992 3300046809 Bacteria 1091
354 Ga0495581_0461591 3300047315 Bacteria 739
355 Ga0495604_0001361 3300047317 Bacteria 20003
356 Ga0495604_0057287 3300047317 Bacteria 2996
357 Ga0495604_0142698 3300047317 Bacteria 1710
358 Ga0495636_0044922 3300047318 Bacteria 1840
359 Ga0495674_0853337 3300047319 Bacteria 705
360 Ga0495674_1051011 3300047319 Unclassified 622
361 Ga0495676_0124686 3300047321 Bacteria 1868
362 Ga0495680_0014826 3300047322 Bacteria 6739
363 Ga0495680_0933670 3300047322 Bacteria 558
364 Ga0495675_0298190 3300047444 Bacteria 958
365 Ga0495677_0306255 3300047445 Bacteria 625
366 Ga0495684_0114549 3300047471 Bacteria 2033
367 Ga0495593_0087460 3300047673 Bacteria 1607
368 Ga0495593_0134445 3300047673 Bacteria 1254
369 Ga0496104_1690677 3300048907 Bacteria 535
370 Ga0501299_082461 3300049522 Bacteria 717
371 Ga0501300_073504 3300049523 Unclassified 556
372 Ga0501032_0023323 3300049569 Bacteria 4279
373 Ga0501033_0001545 3300049570 Bacteria 20328
374 Ga0501033_0762510 3300049570 Bacteria 656
375 Ga0501036_0000136 3300049572 Bacteria 47600
376 Ga0501036_0188185 3300049572 Unclassified 1737
377 Ga0501036_0486811 3300049572 Bacteria 1027
378 Ga0501037_0082458 3300049573 Bacteria 2330
379 Ga0501037_0364385 3300049573 Bacteria 995
380 Ga0501038_0000957 3300049574 Bacteria 25820
381 Ga0501038_0037170 3300049574 Bacteria 4271
382 Ga0501039_0005418 3300049575 Bacteria 9648
383 Ga0501039_0019978 3300049575 Bacteria 5134
384 Ga0501039_0206853 3300049575 Bacteria 1543
385 Ga0501039_0334890 3300049575 Bacteria 1189
386 Ga0501039_0738583 3300049575 Bacteria 769
387 Ga0501039_1275336 3300049575 Unclassified 567
388 Ga0501040_0000788 3300049576 Bacteria 19738
389 Ga0501040_0056747 3300049576 Bacteria 2688
390 Ga0501040_0057788 3300049576 Bacteria 2664
391 Ga0501040_0109700 3300049576 Bacteria 1929
392 Ga0501040_0214091 3300049576 Bacteria 1370
393 Ga0501041_0036539 3300049577 Bacteria 2975
394 Ga0501041_0094687 3300049577 Bacteria 1845
395 Ga0501041_0218374 3300049577 Bacteria 1196
396 Ga0501041_1060668 3300049577 Bacteria 522
397 Ga0501042_0003293 3300049578 Bacteria 10107
398 Ga0501042_0057484 3300049578 Bacteria 2776
399 Ga0501042_0069482 3300049578 Bacteria 2519
400 Ga0501042_0225383 3300049578 Bacteria 1352
401 Ga0501042_0247812 3300049578 Bacteria 1285
402 Ga0501042_0252386 3300049578 Bacteria 1273
403 Ga0501042_0850622 3300049578 Bacteria 664
404 Ga0501043_0131967 3300049579 Bacteria 1957
405 Ga0501043_0781258 3300049579 Bacteria 692
406 Ga0501046_0001441 3300049580 Bacteria 22888
407 Ga0501046_0073095 3300049580 Bacteria 2661
408 Ga0501046_0094882 3300049580 Bacteria 2292
409 Ga0501046_0178507 3300049580 Bacteria 1589
410 Ga0501047_0217769 3300049581 Bacteria 1766
411 Ga0501048_0059265 3300049582 Bacteria 2713
412 Ga0501048_0062057 3300049582 Bacteria 2646
413 Ga0501048_0070388 3300049582 Bacteria 2471
414 Ga0501048_0255518 3300049582 Bacteria 1245
415 Ga0501048_0777976 3300049582 Bacteria 687
416 Ga0501068_0024696 3300049584 Bacteria 3530
417 Ga0501068_0090910 3300049584 Bacteria 1883
418 Ga0501070_0180321 3300049586 Bacteria 1738
419 Ga0501071_0010225 3300049587 Bacteria 6279
420 Ga0501071_0032113 3300049587 Bacteria 3726
421 Ga0501071_0104903 3300049587 Bacteria 2086
422 Ga0501071_0412390 3300049587 Bacteria 1032
423 Ga0501071_0529481 3300049587 Bacteria 904
424 Ga0501072_0009825 3300049588 Bacteria 7274
425 Ga0501072_0051101 3300049588 Bacteria 3255
426 Ga0501072_0131166 3300049588 Bacteria 1997
427 Ga0501072_0450900 3300049588 Bacteria 1019
428 Ga0501072_0474011 3300049588 Bacteria 991
429 Ga0501072_0932444 3300049588 Unclassified 678
430 Ga0501073_0274476 3300049589 Bacteria 1163
431 Ga0501073_1057403 3300049589 Bacteria 558
432 Ga0501074_0116832 3300049590 Bacteria 1908
433 Ga0501074_0229708 3300049590 Bacteria 1321
434 Ga0501075_0001307 3300049591 Bacteria 16155
435 Ga0501075_0008633 3300049591 Bacteria 7104
436 Ga0501075_0078890 3300049591 Bacteria 2492
437 Ga0501075_0257378 3300049591 Bacteria 1330
438 Ga0501075_1115266 3300049591 Bacteria 599
439 Ga0501076_0001154 3300049592 Bacteria 17470
440 Ga0501076_0002070 3300049592 Bacteria 13739
441 Ga0501076_0197814 3300049592 Bacteria 1641
442 Ga0501076_0635112 3300049592 Bacteria 881
443 Ga0501077_0044299 3300049593 Bacteria 2827
444 Ga0501077_0076673 3300049593 Bacteria 2117
445 Ga0501229_034941 3300049706 Bacteria 701
446 Ga0501079_0012688 3300049741 Bacteria 6436
447 Ga0501079_0018335 3300049741 Bacteria 5349
448 Ga0501079_0410195 3300049741 Bacteria 1063
449 Ga0501079_0759017 3300049741 Bacteria 763
450 Ga0501080_0004679 3300049742 Bacteria 12204
451 Ga0501080_0065143 3300049742 Bacteria 3390
452 Ga0501080_0067340 3300049742 Bacteria 3330
453 Ga0501080_0647016 3300049742 Bacteria 936
454 Ga0501080_0853736 3300049742 Bacteria 796
455 Ga0501081_0014040 3300049743 Bacteria 5275
456 Ga0501081_0126386 3300049743 Bacteria 1824
457 Ga0501081_0142080 3300049743 Bacteria 1721
458 Ga0501081_0218308 3300049743 Bacteria 1386
459 Ga0501083_0191886 3300049744 Bacteria 1333
460 Ga0501283_026939 3300049779 Unclassified 948
461 Ga0501035_0188835 3300049822 Bacteria 1772
462 Ga0501035_0228887 3300049822 Bacteria 1585
463 Ga0501044_0304101 3300049823 Bacteria 1523
464 Ga0501045_0000851 3300049824 Bacteria 19807
465 Ga0501045_0028852 3300049824 Bacteria 4005
466 Ga0501045_0049809 3300049824 Bacteria 3055
467 Ga0501045_0068182 3300049824 Bacteria 2613
468 Ga0501045_0530613 3300049824 Bacteria 874
469 Ga0501045_1024727 3300049824 Bacteria 605
470 nmdc:mga05p37_12860_c1 3300050507 Bacteria 10009
471 nmdc:mga05p37_188814_c1 3300050507 Bacteria 2503
472 nmdc:mga05p37_943450_c1 3300050507 Bacteria 924
473 nmdc:mga09592_1114184_c1 3300050508 Bacteria 656
474 nmdc:mga09592_157503_c1 3300050508 Bacteria 1961
475 nmdc:mga09592_1866_c1 3300050508 Bacteria 16955
476 nmdc:mga09592_26266_c1 3300050508 Bacteria 4823
477 nmdc:mga09592_558066_c1 3300050508 Bacteria 983
478 nmdc:mga0qj67_2114_c1 3300050509 Bacteria 14162
479 nmdc:mga0qj67_38788_c1 3300050509 Bacteria 3738
480 nmdc:mga0qj67_499116_c1 3300050509 Bacteria 978
481 nmdc:mga06r32_1045543_c1 3300050510 Unclassified 768
482 nmdc:mga06r32_1184995_c1 3300050510 Bacteria 711
483 nmdc:mga06r32_319077_c1 3300050510 Bacteria 1539
484 nmdc:mga08y16_3478_c1 3300050511 Bacteria 16339
485 nmdc:mga08y16_6489_c1 3300050511 Bacteria 12271
486 nmdc:mga0n895_25365_c1 3300050512 Bacteria 5600
487 nmdc:mga0n895_519491_c1 3300050512 Bacteria 1198
488 nmdc:mga0n895_84_c1 3300050512 Bacteria 54345
489 nmdc:mga0n895_973915_c1 3300050512 Bacteria 831
490 nmdc:mga0rr50_1823299_c1 3300050513 Bacteria 512
491 nmdc:mga0rr50_19508_c1 3300050513 Bacteria 4579
492 nmdc:mga0rr50_385374_c1 3300050513 Bacteria 1182
493 nmdc:mga0rr50_5034_c1 3300050513 Bacteria 7834
494 nmdc:mga0rr50_54308_c1 3300050513 Bacteria 2984
495 nmdc:mga08x19_174655_c1 3300050514 Bacteria 1464
496 nmdc:mga08x19_26816_c1 3300050514 Bacteria 3598
497 nmdc:mga08x19_564_c1 3300050514 Bacteria 24248
498 nmdc:mga0a205_121_c1 3300050515 Bacteria 47144
499 nmdc:mga0a205_175813_c1 3300050515 Bacteria 2036
500 nmdc:mga0a205_408129_c1 3300050515 Bacteria 1222
501 Ga0495601_0077618 3300053077 Bacteria 2127
502 Ga0495612_0169106 3300053078 Bacteria 957
503 Ga0501084_0017319 3300054114 Bacteria 5987
504 Ga0501084_0051816 3300054114 Bacteria 3435
505 Ga0501084_0121241 3300054114 Bacteria 2199
506 Ga0501084_0184193 3300054114 Bacteria 1763
507 Ga0501084_0221868 3300054114 Bacteria 1595
508 Ga0590071_002927 3300059421 Bacteria 4242
509 Ga0590071_146550 3300059421 Bacteria 611
510 Ga0501082_0022247 3300060353 Bacteria 5463
511 Ga0501082_0213611 3300060353 Bacteria 1678
512 Ga0501082_0341056 3300060353 Bacteria 1306
513 Ga0501082_0560220 3300060353 Bacteria 1000
514 Ga0501082_0795252 3300060353 Bacteria 827
515 Ga0530510_0002052 3300061734 Bacteria 13839
516 Ga0530510_0006956 3300061734 Bacteria 7883
517 Ga0530510_0079005 3300061734 Bacteria 2393
518 Ga0530510_1263729 3300061734 Bacteria 566
519 Ga0099794_10056684
520 JGI25406J46586_10035146
521 Ga0065707_10261720
522 Ga0070690_100000214
523 Ga0070690_100025738
524 Ga0070690_100238507
525 Ga0070690_101120340
526 Ga0070690_101409731
527 Ga0068869_100000046
528 Ga0070666_10130798
529 Ga0070680_100001489
530 Ga0070680_100063916
531 Ga0068868_100859224
532 Ga0068868_100905706
533 Ga0070689_100005826
534 Ga0070689_100015280
535 Ga0070689_100085493
536 Ga0070691_10044562
537 Ga0070691_10057704
538 Ga0070687_100139980
539 Ga0070692_10331421
540 Ga0070675_100470025
541 Ga0070675_100846156
542 Ga0070674_100414094
543 Ga0070688_100094955
544 Ga0070709_11567432
545 Ga0070710_10056914
546 Ga0070701_10000152
547 Ga0070701_10193645
548 Ga0070705_100000302
549 Ga0070700_100000276
550 Ga0070700_100165903
551 Ga0070700_100219682
552 Ga0070694_100000062
553 Ga0070694_100081443
554 Ga0070694_100119724
555 Ga0070694_100218434
556 Ga0070694_100599683
557 Ga0070694_100730073
558 Ga0070678_100404956
559 Ga0070681_10026128
560 Ga0070681_10366448
561 Ga0068867_100000649
562 Ga0068867_101166568
563 Ga0070685_10192535
564 Ga0070699_100530289
565 Ga0070699_101183634
566 Ga0070679_100001291
567 Ga0070679_100189262
568 Ga0070697_100042864
569 Ga0070697_101964042
570 Ga0068853_100042330
571 Ga0070686_100000300
572 Ga0070686_100104030
573 Ga0070686_100570183
574 Ga0070686_100698597
575 Ga0070695_100008896
576 Ga0070695_100303116
577 Ga0070695_100343122
578 Ga0070695_100938943
579 Ga0070696_100000702
580 Ga0070696_100020599
581 Ga0070696_100719960
582 Ga0070696_101344139
583 Ga0070696_101502299
584 Ga0070693_100000129
585 Ga0068855_100011405
586 Ga0068855_100744226
587 Ga0068857_100383777
588 Ga0068856_100019730
589 Ga0070702_100000026
590 Ga0070702_100345685
591 Ga0068852_100082170
592 Ga0068859_100003492
593 Ga0068864_100020067
594 Ga0068866_10000142
595 Ga0068861_100000167
596 Ga0068870_10329300
597 Ga0068858_100000538
598 Ga0068860_100000859
599 Ga0068860_100114179
600 Ga0068862_100002150
601 Ga0081539_10002623
602 Ga0097621_100004219
603 Ga0097621_100008072
604 Ga0068871_100000374
605 Ga0068871_100036866
606 Ga0075428_100002178
607 Ga0075428_100227661
608 Ga0075428_100293572
609 Ga0075428_100732791
610 Ga0075430_100003485
611 Ga0075430_100008481
612 Ga0075430_100050204
613 Ga0075430_100372212
614 Ga0075430_100410058
615 Ga0075430_100756868
616 Ga0075431_100200922
617 Ga0075431_100210940
618 Ga0075431_100316659
619 Ga0075431_100463915
620 Ga0075433_10034283
621 Ga0075433_10155219
622 Ga0075433_11868028
623 Ga0075434_100000065
624 Ga0075434_100002726
625 Ga0075434_100049777
626 Ga0075434_101710392
627 Ga0075429_100000925
628 Ga0075429_100095840
629 Ga0075429_100553775
630 Ga0075436_100040959
631 Ga0075436_100066931
632 Ga0097620_100003492
633 Ga0075435_100000756
634 Ga0075435_100006010
635 Ga0075435_100012279
636 Ga0075435_100029871
637 Ga0075435_100236721
638 Ga0099794_10029463
639 Ga0099794_10228679
640 Ga0105240_10659769
641 Ga0111539_10008103
642 Ga0111539_10087967
643 Ga0111539_10233272
644 Ga0111539_10738400
645 Ga0111539_12041710
646 Ga0105245_10002231
647 Ga0114129_10001618
648 Ga0114129_10016784
649 Ga0114129_10582696
650 Ga0114129_12807536
651 Ga0105243_10000641
652 Ga0105241_11284222
653 Ga0105242_10000151
654 Ga0105237_11434686
655 Ga0105249_10000850
656 Ga0099796_10184774
657 Ga0105239_10824285
658 Ga0105246_10032893
659 Ga0157374_10435524
660 Ga0157378_10000657
661 Ga0157372_11976852
662 Ga0157380_10031493
663 Ga0157380_11105871
664 Ga0157376_10042009
665 Ga0157376_10057228
666 Ga0207692_10092551
667 Ga0207642_10000469
668 Ga0207647_10076239
669 Ga0207643_10042347
670 Ga0207654_10412555
671 Ga0207707_10027621
672 Ga0207707_10061049
673 Ga0207707_10405644
674 Ga0207707_10794725
675 Ga0207660_10006756
676 Ga0207660_10138116
677 Ga0207660_10403929
678 Ga0207662_10000141
679 Ga0207662_10293009
680 Ga0207652_10004259
681 Ga0207652_10152556
682 Ga0207652_10595339
683 Ga0207659_10404361
684 Ga0207659_10793503
685 Ga0207687_10007632
686 Ga0207709_10202137
687 Ga0207670_10000218
688 Ga0207670_10004195
689 Ga0207670_10384724
690 Ga0207704_10000492
691 Ga0207689_10000656
692 Ga0207667_10025521
693 Ga0207651_10168496
694 Ga0207640_10001372
695 Ga0207677_10323917
696 Ga0207677_10950401
697 Ga0207703_10022961
698 Ga0207703_10088965
699 Ga0207708_10003922
700 Ga0207708_10058327
701 Ga0207708_10188798
702 Ga0207702_10151795
703 Ga0207648_10000898
704 Ga0207648_10280567
705 Ga0207648_11429650
706 Ga0207676_10015111
707 Ga0207674_10599432
708 Ga0207675_100000733
709 Ga0207675_102543709
710 Ga0209969_1002118
711 Ga0209967_1000759
712 Ga0209967_1019362
713 Ga0209996_1000684
714 Ga0210000_1002012
715 Ga0209995_1004215
716 Ga0209968_1006673
717 Ga0209999_1003859
718 Ga0209999_1006547
719 Ga0209588_1084758
720 Ga0209971_1029354
721 Ga0209974_10046130
722 Ga0207428_10003882
723 Ga0207428_10011342
724 Ga0268265_10000643
725 Ga0268265_10582886
726 Ga0268264_10000816
727 Ga0307408_100136341
728 Ga0307408_100752734
729 Ga0307408_101253071
730 Ga0316575_10115075
731 Ga0316579_10004247
732 Ga0316578_10587662
733 Ga0307405_10199551
734 Ga0307406_11143910
735 Ga0307412_10232351
736 Ga0307416_100452859
737 Ga0307416_100698337
738 Ga0373948_0056655
739 Ga0373948_0087454
740 Ga0373958_0002663
741 Ga0373938_0148555
742 Ga0373926_0216121
743 Ga0373928_0062570
744 Ga0373929_0013058
745 Ga0373934_0086446
746 Ga0373934_0096792
747 Ga0373940_0004689
748 Ga0373940_0081760
749 Ga0373944_0045594
750 Ga0373949_0018912
751 Ga0373951_0071645
752 Ga0373952_0016849
753 Ga0373932_0007578
754 Ga0373932_0101598
755 Ga0373936_0016196
756 Ga0373936_0101299
757 Ga0373939_0056370
758 Ga0373941_0002659
759 Ga0373941_0062116
760 Ga0373941_0196782
761 Ga0373945_0005171
762 Ga0373953_0008656
763 Ga0373953_0111025
764 Ga0373954_0000094
765 Ga0373954_0326296
766 Ga0373956_0153774
767 Ga0373956_0177443
768 Ga0373956_0196417
769 Ga0373957_0063984
770 Ga0373960_0033104
771 Ga0373960_0219103
772 Ga0373946_0018544
773 Ga0373955_0038886
774 Ga0373955_0214156
775 Ga0373955_0531176
776 Ga0373942_0002715
777 Ga0373962_0030642
778 Ga0373962_0142998
779 Ga0373924_0003524
780 Ga0373924_0432916
781 Ga0373931_0001145
782 Ga0373931_0006091
783 Ga0373931_0220691
784 Ga0373931_0497331
785 Ga0373935_0073806
786 Ga0373935_0088855
787 Ga0373935_0169699
788 Ga0373927_0262181
789 Ga0373933_0048323
790 Ga0373933_0166102
791 Ga0373933_0301532
792 Ga0373937_0000449
793 Ga0373937_0031645
794 Ga0373937_0063384
795 Ga0373937_0599227
796 Ga0373925_0102817
797 Ga0373925_0227742
798 Ga0439439_0090815
799 Ga0439461_0014182
800 Ga0451800_0469163
801 Ga0451807_0045908
802 Ga0451839_1369546
803 Ga0451853_2412548
804 Ga0439433_0136899
805 Ga0439462_0056152
806 Ga0439434_0091654
807 Ga0439435_0000006
808 Ga0451577_0022272
809 Ga0451577_0402037
810 Ga0466965_0586573
811 Ga0466964_0218513
812 Ga0453684_1155491
813 Ga0466957_0026870
814 Ga0451576_0002975
815 Ga0451576_0076387
816 Ga0451576_0291488
817 Ga0451576_0431124
818 Ga0451576_1274142
819 Ga0495653_0092976
820 Ga0495580_0004159
821 Ga0495582_0890832
822 Ga0495639_0009307
823 Ga0495639_0183894
824 Ga0495662_0004818
825 Ga0495662_0597779
826 Ga0495608_0010394
827 Ga0495608_0109646
828 Ga0495608_0197204
829 Ga0495618_0400150
830 Ga0495628_0006337
831 Ga0495628_0168084
832 Ga0495630_0001124
833 Ga0495630_0044567
834 Ga0495630_0439027
835 Ga0495630_0906732
836 Ga0495666_0006290
837 Ga0495642_0082942
838 Ga0495642_0145543
839 Ga0495652_0052066
840 Ga0495652_0289571
841 Ga0495665_0096218
842 Ga0495640_0001398
843 Ga0495640_0021347
844 Ga0495586_0001311
845 Ga0495586_0005650
846 Ga0495586_0181030
847 Ga0495598_0003898
848 Ga0495598_0161841
849 Ga0495621_0091024
850 Ga0495667_0017435
851 Ga0495667_0213378
852 Ga0495667_0396736
853 Ga0495656_0102327
854 Ga0495634_0004109
855 Ga0495659_0007042
856 Ga0495659_0131390
857 Ga0495588_0081611
858 Ga0495657_0044941
859 Ga0495599_0072731
860 Ga0495647_0015389
861 Ga0495647_0057594
862 Ga0495658_0015876
863 Ga0495658_0321163
864 Ga0495669_0006201
865 Ga0495613_0014125
866 Ga0495624_0016753
867 Ga0495624_0043008
868 Ga0495624_0177411
869 Ga0495670_0423872
870 Ga0495600_0161660
871 Ga0495600_0264992
872 Ga0495581_0461591
873 Ga0495604_0001361
874 Ga0495604_0057287
875 Ga0495604_0142698
876 Ga0495636_0044922
877 Ga0495674_0853337
878 Ga0495674_1051011
879 Ga0495676_0124686
880 Ga0495680_0014826
881 Ga0495680_0933670
882 Ga0495675_0298190
883 Ga0495677_0306255
884 Ga0495684_0114549
885 Ga0495593_0087460
886 Ga0495593_0134445
887 Ga0496104_1690677
888 Ga0501299_082461
889 Ga0501300_073504
890 Ga0501032_0023323
891 Ga0501033_0001545
892 Ga0501033_0762510
893 Ga0501036_0000136
894 Ga0501036_0188185
895 Ga0501036_0486811
896 Ga0501037_0082458
897 Ga0501037_0364385
898 Ga0501038_0000957
899 Ga0501038_0037170
900 Ga0501039_0005418
901 Ga0501039_0019978
902 Ga0501039_0206853
903 Ga0501039_0334890
904 Ga0501039_0738583
905 Ga0501039_1275336
906 Ga0501040_0000788
907 Ga0501040_0056747
908 Ga0501040_0057788
909 Ga0501040_0109700
910 Ga0501040_0214091
911 Ga0501041_0036539
912 Ga0501041_0094687
913 Ga0501041_0218374
914 Ga0501041_1060668
915 Ga0501042_0003293
916 Ga0501042_0057484
917 Ga0501042_0069482
918 Ga0501042_0225383
919 Ga0501042_0247812
920 Ga0501042_0252386
921 Ga0501042_0850622
922 Ga0501043_0131967
923 Ga0501043_0781258
924 Ga0501046_0001441
925 Ga0501046_0073095
926 Ga0501046_0094882
927 Ga0501046_0178507
928 Ga0501047_0217769
929 Ga0501048_0059265
930 Ga0501048_0062057
931 Ga0501048_0070388
932 Ga0501048_0255518
933 Ga0501048_0777976
934 Ga0501068_0024696
935 Ga0501068_0090910
936 Ga0501070_0180321
937 Ga0501071_0010225
938 Ga0501071_0032113
939 Ga0501071_0104903
940 Ga0501071_0412390
941 Ga0501071_0529481
942 Ga0501072_0009825
943 Ga0501072_0051101
944 Ga0501072_0131166
945 Ga0501072_0450900
946 Ga0501072_0474011
947 Ga0501072_0932444
948 Ga0501073_0274476
949 Ga0501073_1057403
950 Ga0501074_0116832
951 Ga0501074_0229708
952 Ga0501075_0001307
953 Ga0501075_0008633
954 Ga0501075_0078890
955 Ga0501075_0257378
956 Ga0501075_1115266
957 Ga0501076_0001154
958 Ga0501076_0002070
959 Ga0501076_0197814
960 Ga0501076_0635112
961 Ga0501077_0044299
962 Ga0501077_0076673
963 Ga0501229_034941
964 Ga0501079_0012688
965 Ga0501079_0018335
966 Ga0501079_0410195
967 Ga0501079_0759017
968 Ga0501080_0004679
969 Ga0501080_0065143
970 Ga0501080_0067340
971 Ga0501080_0647016
972 Ga0501080_0853736
973 Ga0501081_0014040
974 Ga0501081_0126386
975 Ga0501081_0142080
976 Ga0501081_0218308
977 Ga0501083_0191886
978 Ga0501283_026939
979 Ga0501035_0188835
980 Ga0501035_0228887
981 Ga0501044_0304101
982 Ga0501045_0000851
983 Ga0501045_0028852
984 Ga0501045_0049809
985 Ga0501045_0068182
986 Ga0501045_0530613
987 Ga0501045_1024727
988 nmdc:mga05p37_12860_c1
989 nmdc:mga05p37_188814_c1
990 nmdc:mga05p37_943450_c1
991 nmdc:mga09592_1114184_c1
992 nmdc:mga09592_157503_c1
993 nmdc:mga09592_1866_c1
994 nmdc:mga09592_26266_c1
995 nmdc:mga09592_558066_c1
996 nmdc:mga0qj67_2114_c1
997 nmdc:mga0qj67_38788_c1
998 nmdc:mga0qj67_499116_c1
999 nmdc:mga06r32_1045543_c1
1000 nmdc:mga06r32_1184995_c1
1001 nmdc:mga06r32_319077_c1
1002 nmdc:mga08y16_3478_c1
1003 nmdc:mga08y16_6489_c1
1004 nmdc:mga0n895_25365_c1
1005 nmdc:mga0n895_519491_c1
1006 nmdc:mga0n895_84_c1
1007 nmdc:mga0n895_973915_c1
1008 nmdc:mga0rr50_1823299_c1
1009 nmdc:mga0rr50_19508_c1
1010 nmdc:mga0rr50_385374_c1
1011 nmdc:mga0rr50_5034_c1
1012 nmdc:mga0rr50_54308_c1
1013 nmdc:mga08x19_174655_c1
1014 nmdc:mga08x19_26816_c1
1015 nmdc:mga08x19_564_c1
1016 nmdc:mga0a205_121_c1
1017 nmdc:mga0a205_175813_c1
1018 nmdc:mga0a205_408129_c1
1019 Ga0495601_0077618
1020 Ga0495612_0169106
1021 Ga0501084_0017319
1022 Ga0501084_0051816
1023 Ga0501084_0121241
1024 Ga0501084_0184193
1025 Ga0501084_0221868
1026 Ga0590071_002927
1027 Ga0590071_146550
1028 Ga0501082_0022247
1029 Ga0501082_0213611
1030 Ga0501082_0341056
1031 Ga0501082_0560220
1032 Ga0501082_0795252
1033 Ga0530510_0002052
1034 Ga0530510_0006956
1035 Ga0530510_0079005
1036 Ga0530510_1263729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

53

130

0.96

PF14539

DUF4442

Domain of unknown function (DUF4442)

9

138

0.92

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

47

137

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9463 13 132
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9425 33 131
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9175 6 131
3e1e-assembly1.cif.gz_B crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a 0.9168 4 133
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9147 6 131
ID Description Score Start End Superfamily
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9437 13 131 3.10.129.10
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.926 4 133 3.10.129.10
af_O06178_3_143_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9201 2 129 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9194 13 131 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9018 13 134 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1F4EIG4-F1-model_v4 Thioesterase domain-containing protein 0.9815 1 135 GO:0047617
AF-A0A522N978-F1-model_v4 PaaI family thioesterase 0.9556 1 130
AF-A0A537B678-F1-model_v4 PaaI family thioesterase 0.9553 13 135 GO:0047617
AF-A0A6J4QSC5-F1-model_v4 Thioesterase domain-containing protein 0.9528 15 131 GO:0047617
AF-A0A7C6DV91-F1-model_v4 PaaI family thioesterase 0.9523 4 131 GO:0047617

Map