F458207

General Info

Members Datasets Scaffolds Average Seq Length
518 218 1036 183

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10618469|Ga0065715_106184691
Length 176
Sequence MKLTLIIVLVLGCAGIIISFPTYSALQEKESKTQPKEVTLAKDSQSDKYAEVAFNHENHVTKKYSPDGTAVLTCVECHHTDQPAASLKPPLKTSERKTVLTSEELAGADSKPVKTCRACHLQVQYPDKPAATKLTNDVAYHLNCNVCHDKALAARPALKGKVPGSNDCVPCHKPAG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
182 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
183 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
184 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
187 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
188 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
194 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
197 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
198 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
205 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
206 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
207 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
208 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.54
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 22.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10618469 3300005293 Bacteria 696
2 SwRhRL2b_contig_3625000 2162886007 Eukaryota 1043
3 JGI24751J29686_10000125 3300002459 Bacteria 38661
4 Ga0058861_11323968 3300004800 Bacteria 1441
5 Ga0065714_10064457 3300005288 Bacteria 69065
6 Ga0065704_10002548 3300005289 Bacteria 9886
7 Ga0065704_10124735 3300005289 Bacteria 1713
8 Ga0065712_10003508 3300005290 Bacteria 6089
9 Ga0065712_10067742 3300005290 Bacteria 73878
10 Ga0065712_10160613 3300005290 Bacteria 1305
11 Ga0065715_10005904 3300005293 Bacteria 5908
12 Ga0065715_10025830 3300005293 Bacteria 2018
13 Ga0065715_10089412 3300005293 Bacteria 10449
14 Ga0065715_10090710 3300005293 Bacteria 6564
15 Ga0065715_10144424 3300005293 Bacteria 1808
16 Ga0065715_10271489 3300005293 Unclassified 1110
17 Ga0065707_10107645 3300005295 Unclassified 2545
18 Ga0065707_10287934 3300005295 Unclassified 1032
19 Ga0065707_10539011 3300005295 Unclassified 729
20 Ga0070676_10466800 3300005328 Bacteria 890
21 Ga0070670_100000118 3300005331 Bacteria 73231
22 Ga0070670_100055390 3300005331 Bacteria 3404
23 Ga0070670_100073734 3300005331 Bacteria 2932
24 Ga0070670_100274379 3300005331 Bacteria 1472
25 Ga0070670_100670673 3300005331 Bacteria 931
26 Ga0070670_100692887 3300005331 Bacteria 916
27 Ga0070670_100845694 3300005331 Unclassified 828
28 Ga0068869_100014645 3300005334 Bacteria 5244
29 Ga0068869_100058185 3300005334 Bacteria 2825
30 Ga0068869_100141287 3300005334 Bacteria 1859
31 Ga0068869_100238284 3300005334 Bacteria 1448
32 Ga0068869_100259396 3300005334 Bacteria 1391
33 Ga0070680_100004442 3300005336 Bacteria 10562
34 Ga0070680_100011216 3300005336 Bacteria 6932
35 Ga0070680_100754425 3300005336 Unclassified 838
36 Ga0070682_100002303 3300005337 Bacteria 10556
37 Ga0068868_100562546 3300005338 Bacteria 1006
38 Ga0070660_100065856 3300005339 Bacteria 2820
39 Ga0070689_100611225 3300005340 Bacteria 945
40 Ga0070691_10516708 3300005341 Unclassified 693
41 Ga0070691_10639791 3300005341 Unclassified 632
42 Ga0070687_100069514 3300005343 Bacteria 1886
43 Ga0070687_100071888 3300005343 Bacteria 1860
44 Ga0070661_100063254 3300005344 Bacteria 2717
45 Ga0070692_10031735 3300005345 Bacteria 2650
46 Ga0070692_10110562 3300005345 Viruses 1519
47 Ga0070692_10317987 3300005345 Bacteria 956
48 Ga0070668_100029280 3300005347 Bacteria 4182
49 Ga0070669_100013178 3300005353 Bacteria 5877
50 Ga0070669_100235033 3300005353 Bacteria 1454
51 Ga0070669_100796165 3300005353 Unclassified 803
52 Ga0070675_100177467 3300005354 Bacteria 1840
53 Ga0070675_100228912 3300005354 Bacteria 1621
54 Ga0070675_100442882 3300005354 Bacteria 1164
55 Ga0070673_100050225 3300005364 Bacteria 3260
56 Ga0070673_100705066 3300005364 Unclassified 927
57 Ga0070659_100019775 3300005366 Bacteria 5110
58 Ga0070703_10021943 3300005406 Bacteria 1870
59 Ga0070703_10101661 3300005406 Bacteria 1014
60 Ga0070701_10008167 3300005438 Bacteria 4511
61 Ga0070701_10114177 3300005438 Bacteria 1513
62 Ga0070701_10154519 3300005438 Unclassified 1324
63 Ga0070705_100026344 3300005440 Bacteria 3163
64 Ga0070705_100137556 3300005440 Bacteria 1603
65 Ga0070705_100233099 3300005440 Bacteria 1282
66 Ga0070705_100410810 3300005440 Bacteria 1005
67 Ga0070705_101038622 3300005440 Bacteria 667
68 Ga0070700_100000115 3300005441 Bacteria 51077
69 Ga0070700_100033449 3300005441 Bacteria 3096
70 Ga0070700_100147185 3300005441 Bacteria 1607
71 Ga0070694_100019401 3300005444 Bacteria 4323
72 Ga0070694_100021309 3300005444 Bacteria 4140
73 Ga0070694_100061571 3300005444 Bacteria 2561
74 Ga0070694_100282314 3300005444 Bacteria 1266
75 Ga0070694_100393838 3300005444 Bacteria 1083
76 Ga0070694_100435632 3300005444 Bacteria 1032
77 Ga0070694_100490031 3300005444 Bacteria 977
78 Ga0070694_100516047 3300005444 Bacteria 953
79 Ga0070708_100684933 3300005445 Unclassified 965
80 Ga0070678_100232617 3300005456 Bacteria 1537
81 Ga0070662_100124896 3300005457 Bacteria 1977
82 Ga0070681_10000787 3300005458 Bacteria 26428
83 Ga0070681_10007689 3300005458 Bacteria 10538
84 Ga0070681_10197462 3300005458 Bacteria 1930
85 Ga0068867_101029965 3300005459 Viruses 748
86 Ga0070706_100000002 3300005467 Bacteria 326510
87 Ga0070706_100041639 3300005467 Bacteria 4241
88 Ga0070706_100165799 3300005467 Bacteria 2063
89 Ga0070707_100241435 3300005468 Bacteria 1758
90 Ga0070707_100316828 3300005468 Bacteria 1516
91 Ga0070707_100516242 3300005468 Bacteria 1157
92 Ga0070707_100535489 3300005468 Bacteria 1133
93 Ga0070698_100051924 3300005471 Unclassified 4173
94 Ga0070698_100407346 3300005471 Bacteria 1293
95 Ga0070699_100009773 3300005518 Bacteria 8300
96 Ga0070699_100855372 3300005518 Bacteria 833
97 Ga0070679_100000011 3300005530 Bacteria 162902
98 Ga0070679_100019391 3300005530 Bacteria 6612
99 Ga0070697_100001479 3300005536 Bacteria 17851
100 Ga0070697_100126268 3300005536 Bacteria 2143
101 Ga0070697_100138289 3300005536 Bacteria 2047
102 Ga0070697_100159926 3300005536 Bacteria 1902
103 Ga0068853_100027251 3300005539 Bacteria 4800
104 Ga0068853_100136839 3300005539 Bacteria 2197
105 Ga0068853_100312182 3300005539 Bacteria 1456
106 Ga0070672_100025173 3300005543 Bacteria 4411
107 Ga0070672_100205212 3300005543 Bacteria 1649
108 Ga0070686_100020758 3300005544 Bacteria 3892
109 Ga0070686_100199037 3300005544 Bacteria 1435
110 Ga0070686_100639369 3300005544 Unclassified 842
111 Ga0070695_100096597 3300005545 Bacteria 1983
112 Ga0070695_100276812 3300005545 Bacteria 1231
113 Ga0070695_100485649 3300005545 Bacteria 953
114 Ga0070695_100578481 3300005545 Unclassified 879
115 Ga0070695_100991241 3300005545 Unclassified 683
116 Ga0070696_100015533 3300005546 Bacteria 5114
117 Ga0070696_100132127 3300005546 Bacteria 1817
118 Ga0070696_100135570 3300005546 Bacteria 1795
119 Ga0070696_100759850 3300005546 Bacteria 795
120 Ga0070696_100833603 3300005546 Unclassified 761
121 Ga0070696_101174166 3300005546 Bacteria 648
122 Ga0070693_100020217 3300005547 Bacteria 3507
123 Ga0070693_100470924 3300005547 Unclassified 885
124 Ga0070704_100061573 3300005549 Bacteria 2686
125 Ga0070704_100211639 3300005549 Bacteria 1571
126 Ga0070704_100223097 3300005549 Bacteria 1533
127 Ga0070704_100397577 3300005549 Bacteria 1175
128 Ga0070704_100482584 3300005549 Bacteria 1073
129 Ga0070704_100540079 3300005549 Unclassified 1017
130 Ga0070704_100678978 3300005549 Unclassified 912
131 Ga0068855_100368246 3300005563 Bacteria 1580
132 Ga0070664_100009618 3300005564 Bacteria 7841
133 Ga0068857_100022620 3300005577 Bacteria 5529
134 Ga0068857_100118773 3300005577 Bacteria 2380
135 Ga0068854_100237061 3300005578 Bacteria 1451
136 Ga0068854_100310012 3300005578 Bacteria 1280
137 Ga0068854_100547910 3300005578 Bacteria 981
138 Ga0068854_100624773 3300005578 Bacteria 922
139 Ga0068854_100674259 3300005578 Bacteria 890
140 Ga0068856_100020347 3300005614 Bacteria 6446
141 Ga0070702_100011813 3300005615 Bacteria 4355
142 Ga0070702_100032343 3300005615 Bacteria 2870
143 Ga0070702_100044926 3300005615 Bacteria 2496
144 Ga0070702_100139555 3300005615 Bacteria 1542
145 Ga0070702_100343516 3300005615 Bacteria 1048
146 Ga0070702_101243221 3300005615 Unclassified 602
147 Ga0068852_100212009 3300005616 Bacteria 1838
148 Ga0068859_100002161 3300005617 Bacteria 19974
149 Ga0068859_100188352 3300005617 Bacteria 2147
150 Ga0068859_100197394 3300005617 Bacteria 2097
151 Ga0068859_100259086 3300005617 Bacteria 1830
152 Ga0068859_100268623 3300005617 Unclassified 1797
153 Ga0068859_100411099 3300005617 Bacteria 1449
154 Ga0068859_100431558 3300005617 Bacteria 1414
155 Ga0068859_100610492 3300005617 Bacteria 1184
156 Ga0068859_100681635 3300005617 Unclassified 1119
157 Ga0068859_101422298 3300005617 Unclassified 765
158 Ga0068864_100172493 3300005618 Unclassified 1973
159 Ga0068861_100003077 3300005719 Bacteria 11022
160 Ga0068861_100088720 3300005719 Bacteria 2436
161 Ga0068861_100276622 3300005719 Bacteria 1444
162 Ga0068861_100455594 3300005719 Bacteria 1147
163 Ga0068861_101041676 3300005719 Unclassified 783
164 Ga0068851_10034698 3300005834 Bacteria 2518
165 Ga0068870_10025260 3300005840 Bacteria 2948
166 Ga0068870_10052102 3300005840 Bacteria 2169
167 Ga0068870_10146487 3300005840 Bacteria 1387
168 Ga0068870_10732812 3300005840 Unclassified 685
169 Ga0068863_100146552 3300005841 Bacteria 2258
170 Ga0068863_100666491 3300005841 Bacteria 1032
171 Ga0068863_100671288 3300005841 Bacteria 1029
172 Ga0068858_100045710 3300005842 Bacteria 4058
173 Ga0068858_100128308 3300005842 Bacteria 2377
174 Ga0068858_100393852 3300005842 Bacteria 1330
175 Ga0068858_100408723 3300005842 Bacteria 1305
176 Ga0068860_100031085 3300005843 Bacteria 5134
177 Ga0068860_100031422 3300005843 Bacteria 5104
178 Ga0068860_100037852 3300005843 Bacteria 4616
179 Ga0068860_100048909 3300005843 Unclassified 4030
180 Ga0068860_100814714 3300005843 Unclassified 947
181 Ga0068860_101076409 3300005843 Bacteria 823
182 Ga0068860_101524714 3300005843 Viruses 690
183 Ga0068862_100136505 3300005844 Bacteria 2174
184 Ga0068862_100176406 3300005844 Bacteria 1916
185 Ga0068862_100304656 3300005844 Bacteria 1467
186 Ga0070716_100003980 3300006173 Bacteria 7014
187 Ga0097621_100007511 3300006237 Bacteria 7804
188 Ga0068871_100011370 3300006358 Bacteria 6526
189 Ga0075428_100185889 3300006844 Bacteria 2248
190 Ga0075428_100215080 3300006844 Bacteria 2076
191 Ga0075428_100562225 3300006844 Bacteria 1219
192 Ga0075430_100062565 3300006846 Unclassified 3126
193 Ga0075430_100234439 3300006846 Bacteria 1521
194 Ga0075431_100241898 3300006847 Bacteria 1836
195 Ga0075431_100275964 3300006847 Bacteria 1702
196 Ga0075433_10156930 3300006852 Bacteria 2024
197 Ga0075433_10708112 3300006852 Bacteria 882
198 Ga0075434_100029165 3300006871 Bacteria 5426
199 Ga0075434_100055462 3300006871 Bacteria 3938
200 Ga0075429_100054452 3300006880 Bacteria 3480
201 Ga0075429_100514391 3300006880 Bacteria 1049
202 Ga0075429_100860288 3300006880 Unclassified 794
203 Ga0097620_100002161 3300006931 Bacteria 19974
204 Ga0097620_100188343 3300006931 Bacteria 2147
205 Ga0097620_100197398 3300006931 Bacteria 2097
206 Ga0097620_100259081 3300006931 Bacteria 1830
207 Ga0097620_100268612 3300006931 Unclassified 1797
208 Ga0097620_100411122 3300006931 Bacteria 1449
209 Ga0097620_100431516 3300006931 Bacteria 1414
210 Ga0097620_100610482 3300006931 Bacteria 1184
211 Ga0097620_100681651 3300006931 Unclassified 1119
212 Ga0097620_101422514 3300006931 Unclassified 765
213 Ga0099794_10491043 3300007265 Bacteria 646
214 Ga0105251_10298806 3300009011 Unclassified 730
215 Ga0105251_10316908 3300009011 Unclassified 708
216 Ga0105251_10410701 3300009011 Unclassified 623
217 Ga0105250_10074478 3300009092 Unclassified 1373
218 Ga0105240_10930989 3300009093 Unclassified 933
219 Ga0111539_10004362 3300009094 Bacteria 18531
220 Ga0111539_10022073 3300009094 Bacteria 7824
221 Ga0111539_10321163 3300009094 Bacteria 1802
222 Ga0111539_10561670 3300009094 Unclassified 1329
223 Ga0105247_10002969 3300009101 Bacteria 11249
224 Ga0105247_10127716 3300009101 Bacteria 1654
225 Ga0114129_10008385 3300009147 Bacteria 14724
226 Ga0114129_10014762 3300009147 Bacteria 11131
227 Ga0114129_10201617 3300009147 Bacteria 2694
228 Ga0114129_10220026 3300009147 Bacteria 2562
229 Ga0114129_10327201 3300009147 Bacteria 2036
230 Ga0114129_10572357 3300009147 Bacteria 1467
231 Ga0114129_11453077 3300009147 Unclassified 844
232 Ga0114129_12152268 3300009147 Unclassified 672
233 Ga0105243_10060639 3300009148 Bacteria 3022
234 Ga0105243_10387090 3300009148 Bacteria 1295
235 Ga0105243_10824163 3300009148 Bacteria 916
236 Ga0105243_11097330 3300009148 Unclassified 804
237 Ga0105241_10209057 3300009174 Bacteria 1634
238 Ga0105241_10438088 3300009174 Bacteria 1154
239 Ga0105241_10494964 3300009174 Bacteria 1089
240 Ga0105241_10826678 3300009174 Unclassified 855
241 Ga0105241_11386434 3300009174 Unclassified 672
242 Ga0105242_11334514 3300009176 Unclassified 742
243 Ga0105248_10029143 3300009177 Bacteria 6156
244 Ga0105248_10031592 3300009177 Bacteria 5917
245 Ga0105248_10041941 3300009177 Bacteria 5131
246 Ga0105248_10097362 3300009177 Bacteria 3315
247 Ga0105248_10604364 3300009177 Bacteria 1237
248 Ga0105248_10745534 3300009177 Bacteria 1105
249 Ga0105237_10191102 3300009545 Unclassified 2047
250 Ga0105237_10352243 3300009545 Bacteria 1477
251 Ga0105238_10070843 3300009551 Bacteria 3485
252 Ga0105238_10095908 3300009551 Bacteria 2952
253 Ga0105249_10000254 3300009553 Bacteria 58502
254 Ga0105249_10029653 3300009553 Bacteria 4942
255 Ga0105249_10200657 3300009553 Unclassified 1952
256 Ga0105249_10285368 3300009553 Bacteria 1650
257 Ga0105249_10326907 3300009553 Bacteria 1546
258 Ga0105249_10681054 3300009553 Bacteria 1087
259 Ga0105249_11035891 3300009553 Unclassified 890
260 Ga0105239_10245952 3300010375 Bacteria 2008
261 Ga0105239_10529969 3300010375 Bacteria 1340
262 Ga0105239_11016524 3300010375 Unclassified 953
263 Ga0105246_10635231 3300011119 Unclassified 927
264 Ga0105246_10723072 3300011119 Bacteria 875
265 Ga0105246_11254177 3300011119 Unclassified 685
266 Ga0157373_10032044 3300013100 Bacteria 3784
267 Ga0157373_10567907 3300013100 Unclassified 824
268 Ga0157378_10260326 3300013297 Unclassified 1664
269 Ga0157378_10277355 3300013297 Bacteria 1615
270 Ga0157378_10703004 3300013297 Bacteria 1030
271 Ga0157378_10943790 3300013297 Unclassified 895
272 Ga0157378_11060882 3300013297 Unclassified 846
273 Ga0157378_11107338 3300013297 Bacteria 829
274 Ga0163162_10000179 3300013306 Bacteria 58502
275 Ga0163162_10027136 3300013306 Bacteria 5663
276 Ga0163162_10060472 3300013306 Bacteria 3824
277 Ga0163162_11081782 3300013306 Viruses 908
278 Ga0157372_10016847 3300013307 Bacteria 7845
279 Ga0157372_10019576 3300013307 Bacteria 7295
280 Ga0157372_10145400 3300013307 Bacteria 2734
281 Ga0157372_11346439 3300013307 Unclassified 823
282 Ga0157375_10227902 3300013308 Bacteria 2022
283 Ga0157375_10236018 3300013308 Bacteria 1988
284 Ga0157375_10434416 3300013308 Unclassified 1479
285 Ga0157375_10508998 3300013308 Bacteria 1368
286 Ga0157375_10781886 3300013308 Bacteria 1104
287 Ga0157375_11324638 3300013308 Viruses 847
288 Ga0157375_11771603 3300013308 Bacteria 732
289 Ga0163163_10000540 3300014325 Bacteria 33464
290 Ga0163163_10015415 3300014325 Bacteria 7066
291 Ga0163163_10081402 3300014325 Bacteria 3240
292 Ga0163163_10214687 3300014325 Bacteria 1973
293 Ga0163163_10468864 3300014325 Bacteria 1320
294 Ga0157380_10006434 3300014326 Bacteria 8270
295 Ga0157380_10070359 3300014326 Viruses 2827
296 Ga0157380_10149915 3300014326 Bacteria 2015
297 Ga0157380_10752697 3300014326 Unclassified 986
298 Ga0157377_10283307 3300014745 Unclassified 1087
299 Ga0157379_10091118 3300014968 Bacteria 2735
300 Ga0157379_10314100 3300014968 Unclassified 1430
301 Ga0182005_1178069 3300015265 Unclassified 630
302 Ga0163161_10474369 3300017792 Bacteria 1015
303 Ga0207697_10212326 3300025315 Unclassified 853
304 Ga0207656_10062437 3300025321 Bacteria 1638
305 Ga0207653_10000459 3300025885 Bacteria 16469
306 Ga0207682_10289605 3300025893 Bacteria 767
307 Ga0207710_10220311 3300025900 Bacteria 942
308 Ga0207647_10022622 3300025904 Bacteria 4172
309 Ga0207647_10198123 3300025904 Unclassified 1162
310 Ga0207647_10546613 3300025904 Unclassified 643
311 Ga0207643_10034409 3300025908 Bacteria 2839
312 Ga0207643_10395191 3300025908 Unclassified 873
313 Ga0207643_10640364 3300025908 Unclassified 685
314 Ga0207684_10000065 3300025910 Bacteria 194463
315 Ga0207684_10007654 3300025910 Bacteria 9688
316 Ga0207654_10050621 3300025911 Bacteria 2388
317 Ga0207654_10060514 3300025911 Bacteria 2212
318 Ga0207654_10342849 3300025911 Bacteria 1027
319 Ga0207707_10000028 3300025912 Bacteria 167115
320 Ga0207707_10051185 3300025912 Bacteria 3597
321 Ga0207707_10171960 3300025912 Bacteria 1893
322 Ga0207671_10114168 3300025914 Unclassified 2058
323 Ga0207660_10017551 3300025917 Bacteria 4757
324 Ga0207660_10049217 3300025917 Bacteria 2986
325 Ga0207662_10116537 3300025918 Viruses 1671
326 Ga0207662_10183812 3300025918 Bacteria 1346
327 Ga0207662_10207247 3300025918 Unclassified 1271
328 Ga0207649_10163701 3300025920 Bacteria 1543
329 Ga0207652_10000573 3300025921 Bacteria 37033
330 Ga0207646_10075283 3300025922 Bacteria 3016
331 Ga0207681_10026259 3300025923 Bacteria 3755
332 Ga0207681_10105451 3300025923 Bacteria 2041
333 Ga0207681_10331373 3300025923 Bacteria 1213
334 Ga0207681_10355298 3300025923 Bacteria 1174
335 Ga0207681_11047347 3300025923 Unclassified 685
336 Ga0207694_10054165 3300025924 Bacteria 3111
337 Ga0207694_10326153 3300025924 Unclassified 1268
338 Ga0207650_10000046 3300025925 Bacteria 178190
339 Ga0207650_10064353 3300025925 Bacteria 2745
340 Ga0207659_10060172 3300025926 Bacteria 2733
341 Ga0207690_10005933 3300025932 Bacteria 7233
342 Ga0207706_10081679 3300025933 Viruses 2840
343 Ga0207706_10340827 3300025933 Bacteria 1304
344 Ga0207706_10475926 3300025933 Bacteria 1079
345 Ga0207686_10090694 3300025934 Bacteria 2017
346 Ga0207709_10059677 3300025935 Bacteria 2376
347 Ga0207709_10344780 3300025935 Bacteria 1122
348 Ga0207709_10606972 3300025935 Unclassified 867
349 Ga0207670_10206392 3300025936 Bacteria 1496
350 Ga0207670_10537160 3300025936 Unclassified 954
351 Ga0207665_10020937 3300025939 Bacteria 4298
352 Ga0207665_10358234 3300025939 Bacteria 1102
353 Ga0207691_10040699 3300025940 Bacteria 4292
354 Ga0207691_10142337 3300025940 Bacteria 2113
355 Ga0207691_10356297 3300025940 Bacteria 1251
356 Ga0207691_10389933 3300025940 Bacteria 1188
357 Ga0207711_10010344 3300025941 Bacteria 7749
358 Ga0207711_10285501 3300025941 Bacteria 1520
359 Ga0207689_10005974 3300025942 Bacteria 10772
360 Ga0207689_10092395 3300025942 Bacteria 2486
361 Ga0207689_10118931 3300025942 Bacteria 2173
362 Ga0207689_10206199 3300025942 Bacteria 1624
363 Ga0207689_10840690 3300025942 Unclassified 775
364 Ga0207679_10063259 3300025945 Bacteria 2761
365 Ga0207679_10335714 3300025945 Bacteria 1313
366 Ga0207667_10257752 3300025949 Unclassified 1784
367 Ga0207651_10626459 3300025960 Bacteria 942
368 Ga0207651_10684482 3300025960 Bacteria 902
369 Ga0207651_10933899 3300025960 Unclassified 773
370 Ga0207712_10000781 3300025961 Bacteria 23731
371 Ga0207712_10011077 3300025961 Bacteria 5743
372 Ga0207712_10014946 3300025961 Bacteria 5000
373 Ga0207712_10119087 3300025961 Bacteria 1994
374 Ga0207712_10266075 3300025961 Bacteria 1392
375 Ga0207712_10306787 3300025961 Bacteria 1305
376 Ga0207712_10322173 3300025961 Bacteria 1276
377 Ga0207712_10772343 3300025961 Unclassified 843
378 Ga0207668_10018417 3300025972 Bacteria 4394
379 Ga0207640_10059131 3300025981 Bacteria 2528
380 Ga0207640_10456863 3300025981 Bacteria 1054
381 Ga0207640_10911973 3300025981 Bacteria 768
382 Ga0207640_11187943 3300025981 Unclassified 678
383 Ga0207703_10053712 3300026035 Bacteria 3275
384 Ga0207703_10225252 3300026035 Bacteria 1678
385 Ga0207703_10439863 3300026035 Bacteria 1216
386 Ga0207639_10138835 3300026041 Bacteria 2022
387 Ga0207639_10298931 3300026041 Unclassified 1422
388 Ga0207639_10313979 3300026041 Bacteria 1389
389 Ga0207708_10000083 3300026075 Bacteria 74423
390 Ga0207708_10020276 3300026075 Bacteria 5014
391 Ga0207708_10031541 3300026075 Bacteria 4023
392 Ga0207708_10047926 3300026075 Bacteria 3252
393 Ga0207708_10216063 3300026075 Bacteria 1534
394 Ga0207708_10810208 3300026075 Unclassified 807
395 Ga0207641_10125895 3300026088 Bacteria 2294
396 Ga0207641_10128735 3300026088 Bacteria 2270
397 Ga0207648_10051291 3300026089 Bacteria 3606
398 Ga0207648_10103437 3300026089 Bacteria 2497
399 Ga0207648_10323376 3300026089 Unclassified 1386
400 Ga0207676_10018800 3300026095 Bacteria 5030
401 Ga0207676_10301161 3300026095 Bacteria 1464
402 Ga0207676_10307627 3300026095 Bacteria 1449
403 Ga0207676_10739018 3300026095 Unclassified 956
404 Ga0207674_10000006 3300026116 Bacteria 233530
405 Ga0207675_100006512 3300026118 Bacteria 11051
406 Ga0207675_100125928 3300026118 Bacteria 2426
407 Ga0207675_100334850 3300026118 Bacteria 1480
408 Ga0207675_101178550 3300026118 Unclassified 786
409 Ga0207698_10378439 3300026142 Bacteria 1346
410 Ga0207698_11888220 3300026142 Unclassified 612
411 Ga0207428_10007945 3300027907 Bacteria 9636
412 Ga0207428_10102139 3300027907 Bacteria 2214
413 Ga0268265_10015895 3300028380 Bacteria 5162
414 Ga0268265_10119577 3300028380 Bacteria 2168
415 Ga0268265_10231267 3300028380 Bacteria 1625
416 Ga0268265_10559914 3300028380 Bacteria 1087
417 Ga0268264_10044180 3300028381 Bacteria 3696
418 Ga0268264_10096444 3300028381 Bacteria 2561
419 Ga0268264_10121557 3300028381 Unclassified 2302
420 Ga0268264_10497760 3300028381 Unclassified 1188
421 Ga0268264_10530178 3300028381 Unclassified 1152
422 Ga0307408_100443420 3300031548 Bacteria 1124
423 Ga0307408_100524774 3300031548 Unclassified 1041
424 Ga0307405_10306127 3300031731 Bacteria 1208
425 Ga0307405_10657050 3300031731 Bacteria 863
426 Ga0307413_10293864 3300031824 Bacteria 1229
427 Ga0307410_10149787 3300031852 Bacteria 1736
428 Ga0307410_10358503 3300031852 Bacteria 1167
429 Ga0307406_10006245 3300031901 Bacteria 6564
430 Ga0307407_10008396 3300031903 Bacteria 4737
431 Ga0307407_10094009 3300031903 Bacteria 1845
432 Ga0307407_10336492 3300031903 Bacteria 1064
433 Ga0307412_10088397 3300031911 Bacteria 2161
434 Ga0307409_100133938 3300031995 Bacteria 2123
435 Ga0307409_100142134 3300031995 Bacteria 2070
436 Ga0307409_100696999 3300031995 Bacteria 1014
437 Ga0307414_10729270 3300032004 Bacteria 899
438 Ga0307411_10164222 3300032005 Bacteria 1667
439 Ga0307411_10693535 3300032005 Bacteria 886
440 Ga0373951_0019121 3300035091 Unclassified 1560
441 Ga0373932_0092185 3300035112 Unclassified 974
442 Ga0373942_0004968 3300035207 Unclassified 3083
443 Ga0373961_0144526 3300035241 Unclassified 806
444 Ga0373931_0064275 3300035691 Bacteria 1986
445 Ga0373937_0189131 3300036401 Unclassified 1934
446 Ga0395900_0212454 3300037418 Bacteria 1953
447 Ga0395898_0419642 3300037466 Bacteria 1275
448 Ga0395901_0071254 3300038443 Bacteria 3622
449 Ga0395901_0073099 3300038443 Bacteria 3576
450 Ga0242422_01858 3300038699 Bacteria 1455
451 Ga0439436_0073625 3300041404 Bacteria 952
452 Ga0439458_0030066 3300042157 Bacteria 1291
453 Ga0451576_1561058 3300045051 Bacteria 685
454 Ga0495586_0572737 3300046535 Unclassified 652
455 Ga0495625_0183704 3300046660 Bacteria 1389
456 Ga0496102_0665454 3300048905 Bacteria 964
457 Ga0496104_0228444 3300048907 Bacteria 1773
458 Ga0496106_0270267 3300048909 Bacteria 1361
459 Ga0496107_0028020 3300048910 Unclassified 4003
460 Ga0496108_0180322 3300048911 Bacteria 1829
461 Ga0496109_0376595 3300048912 Bacteria 1341
462 Ga0496112_0276458 3300048915 Bacteria 1627
463 Ga0496112_0496781 3300048915 Bacteria 1156
464 Ga0501291_005845 3300049514 Bacteria 1623
465 Ga0501292_012202 3300049515 Bacteria 1309
466 Ga0501292_013787 3300049515 Bacteria 1247
467 Ga0501296_007177 3300049519 Bacteria 1276
468 Ga0501299_025013 3300049522 Bacteria 1118
469 Ga0501048_0396820 3300049582 Bacteria 986
470 Ga0501198_024329 3300049649 Unclassified 980
471 Ga0501216_005678 3300049660 Bacteria 1889
472 Ga0501233_014915 3300049668 Unclassified 1594
473 Ga0501235_039183 3300049669 Bacteria 1081
474 Ga0501235_124814 3300049669 Unclassified 647
475 Ga0501242_009323 3300049674 Unclassified 1160
476 Ga0501243_034447 3300049675 Unclassified 874
477 Ga0501249_050466 3300049679 Unclassified 955
478 Ga0501251_006916 3300049681 Bacteria 1248
479 Ga0501253_008862 3300049683 Bacteria 1464
480 Ga0501257_031735 3300049686 Unclassified 1276
481 Ga0501259_037244 3300049688 Unclassified 943
482 Ga0501261_010433 3300049690 Bacteria 1224
483 Ga0501221_017250 3300049704 Bacteria 1376
484 Ga0501225_0122168 3300049705 Unclassified 774
485 Ga0501229_004346 3300049706 Bacteria 1721
486 Ga0501234_036395 3300049707 Unclassified 801
487 Ga0501245_026892 3300049708 Bacteria 931
488 Ga0501245_094684 3300049708 Unclassified 596
489 Ga0501081_0719942 3300049743 Bacteria 750
490 Ga0501232_028604 3300049757 Unclassified 762
491 Ga0501273_003187 3300049770 Bacteria 1723
492 Ga0501283_010445 3300049779 Bacteria 1366
493 Ga0501283_040287 3300049779 Unclassified 807
494 Ga0501204_020981 3300049850 Unclassified 853
495 Ga0501226_001554 3300049853 Bacteria 2913
496 nmdc:mga05p37_228457_c2 3300050507 Unclassified 773
497 nmdc:mga05p37_611293_c1 3300050507 Bacteria 1228
498 nmdc:mga05p37_980503_c1 3300050507 Unclassified 900
499 nmdc:mga09592_351800_c1 3300050508 Bacteria 1275
500 nmdc:mga06r32_216470_c1 3300050510 Bacteria 1903
501 nmdc:mga06r32_569245_c1 3300050510 Bacteria 1106
502 nmdc:mga08y16_233951_c1 3300050511 Bacteria 1900
503 nmdc:mga08y16_52088_c1 3300050511 Bacteria 4283
504 nmdc:mga08y16_63646_c1 3300050511 Bacteria 3852
505 nmdc:mga08y16_81811_c1 3300050511 Bacteria 3366
506 nmdc:mga08y16_8198_c1 3300050511 Bacteria 10933
507 nmdc:mga0n895_647304_c1 3300050512 Bacteria 1056
508 nmdc:mga0n895_66003_c1 3300050512 Bacteria 3583
509 nmdc:mga0n895_793581_c1 3300050512 Unclassified 938
510 nmdc:mga0rr50_408027_c1 3300050513 Bacteria 1148
511 nmdc:mga08x19_14362_c1 3300050514 Bacteria 4802
512 nmdc:mga0a205_136676_c1 3300050515 Bacteria 2352
513 nmdc:mga0a205_344754_c1 3300050515 Bacteria 1358
514 nmdc:mga0a205_398023_c1 3300050515 Bacteria 1241
515 nmdc:mga0a205_695097_c1 3300050515 Unclassified 867
516 Ga0501084_0179241 3300054114 Bacteria 1789
517 Ga0501084_0905248 3300054114 Unclassified 742
518 Ga0501082_0522226 3300060353 Bacteria 1038
519 Ga0065715_10618469
520 SwRhRL2b_contig_3625000
521 JGI24751J29686_10000125
522 Ga0058861_11323968
523 Ga0065714_10064457
524 Ga0065704_10002548
525 Ga0065704_10124735
526 Ga0065712_10003508
527 Ga0065712_10067742
528 Ga0065712_10160613
529 Ga0065715_10005904
530 Ga0065715_10025830
531 Ga0065715_10089412
532 Ga0065715_10090710
533 Ga0065715_10144424
534 Ga0065715_10271489
535 Ga0065707_10107645
536 Ga0065707_10287934
537 Ga0065707_10539011
538 Ga0070676_10466800
539 Ga0070670_100000118
540 Ga0070670_100055390
541 Ga0070670_100073734
542 Ga0070670_100274379
543 Ga0070670_100670673
544 Ga0070670_100692887
545 Ga0070670_100845694
546 Ga0068869_100014645
547 Ga0068869_100058185
548 Ga0068869_100141287
549 Ga0068869_100238284
550 Ga0068869_100259396
551 Ga0070680_100004442
552 Ga0070680_100011216
553 Ga0070680_100754425
554 Ga0070682_100002303
555 Ga0068868_100562546
556 Ga0070660_100065856
557 Ga0070689_100611225
558 Ga0070691_10516708
559 Ga0070691_10639791
560 Ga0070687_100069514
561 Ga0070687_100071888
562 Ga0070661_100063254
563 Ga0070692_10031735
564 Ga0070692_10110562
565 Ga0070692_10317987
566 Ga0070668_100029280
567 Ga0070669_100013178
568 Ga0070669_100235033
569 Ga0070669_100796165
570 Ga0070675_100177467
571 Ga0070675_100228912
572 Ga0070675_100442882
573 Ga0070673_100050225
574 Ga0070673_100705066
575 Ga0070659_100019775
576 Ga0070703_10021943
577 Ga0070703_10101661
578 Ga0070701_10008167
579 Ga0070701_10114177
580 Ga0070701_10154519
581 Ga0070705_100026344
582 Ga0070705_100137556
583 Ga0070705_100233099
584 Ga0070705_100410810
585 Ga0070705_101038622
586 Ga0070700_100000115
587 Ga0070700_100033449
588 Ga0070700_100147185
589 Ga0070694_100019401
590 Ga0070694_100021309
591 Ga0070694_100061571
592 Ga0070694_100282314
593 Ga0070694_100393838
594 Ga0070694_100435632
595 Ga0070694_100490031
596 Ga0070694_100516047
597 Ga0070708_100684933
598 Ga0070678_100232617
599 Ga0070662_100124896
600 Ga0070681_10000787
601 Ga0070681_10007689
602 Ga0070681_10197462
603 Ga0068867_101029965
604 Ga0070706_100000002
605 Ga0070706_100041639
606 Ga0070706_100165799
607 Ga0070707_100241435
608 Ga0070707_100316828
609 Ga0070707_100516242
610 Ga0070707_100535489
611 Ga0070698_100051924
612 Ga0070698_100407346
613 Ga0070699_100009773
614 Ga0070699_100855372
615 Ga0070679_100000011
616 Ga0070679_100019391
617 Ga0070697_100001479
618 Ga0070697_100126268
619 Ga0070697_100138289
620 Ga0070697_100159926
621 Ga0068853_100027251
622 Ga0068853_100136839
623 Ga0068853_100312182
624 Ga0070672_100025173
625 Ga0070672_100205212
626 Ga0070686_100020758
627 Ga0070686_100199037
628 Ga0070686_100639369
629 Ga0070695_100096597
630 Ga0070695_100276812
631 Ga0070695_100485649
632 Ga0070695_100578481
633 Ga0070695_100991241
634 Ga0070696_100015533
635 Ga0070696_100132127
636 Ga0070696_100135570
637 Ga0070696_100759850
638 Ga0070696_100833603
639 Ga0070696_101174166
640 Ga0070693_100020217
641 Ga0070693_100470924
642 Ga0070704_100061573
643 Ga0070704_100211639
644 Ga0070704_100223097
645 Ga0070704_100397577
646 Ga0070704_100482584
647 Ga0070704_100540079
648 Ga0070704_100678978
649 Ga0068855_100368246
650 Ga0070664_100009618
651 Ga0068857_100022620
652 Ga0068857_100118773
653 Ga0068854_100237061
654 Ga0068854_100310012
655 Ga0068854_100547910
656 Ga0068854_100624773
657 Ga0068854_100674259
658 Ga0068856_100020347
659 Ga0070702_100011813
660 Ga0070702_100032343
661 Ga0070702_100044926
662 Ga0070702_100139555
663 Ga0070702_100343516
664 Ga0070702_101243221
665 Ga0068852_100212009
666 Ga0068859_100002161
667 Ga0068859_100188352
668 Ga0068859_100197394
669 Ga0068859_100259086
670 Ga0068859_100268623
671 Ga0068859_100411099
672 Ga0068859_100431558
673 Ga0068859_100610492
674 Ga0068859_100681635
675 Ga0068859_101422298
676 Ga0068864_100172493
677 Ga0068861_100003077
678 Ga0068861_100088720
679 Ga0068861_100276622
680 Ga0068861_100455594
681 Ga0068861_101041676
682 Ga0068851_10034698
683 Ga0068870_10025260
684 Ga0068870_10052102
685 Ga0068870_10146487
686 Ga0068870_10732812
687 Ga0068863_100146552
688 Ga0068863_100666491
689 Ga0068863_100671288
690 Ga0068858_100045710
691 Ga0068858_100128308
692 Ga0068858_100393852
693 Ga0068858_100408723
694 Ga0068860_100031085
695 Ga0068860_100031422
696 Ga0068860_100037852
697 Ga0068860_100048909
698 Ga0068860_100814714
699 Ga0068860_101076409
700 Ga0068860_101524714
701 Ga0068862_100136505
702 Ga0068862_100176406
703 Ga0068862_100304656
704 Ga0070716_100003980
705 Ga0097621_100007511
706 Ga0068871_100011370
707 Ga0075428_100185889
708 Ga0075428_100215080
709 Ga0075428_100562225
710 Ga0075430_100062565
711 Ga0075430_100234439
712 Ga0075431_100241898
713 Ga0075431_100275964
714 Ga0075433_10156930
715 Ga0075433_10708112
716 Ga0075434_100029165
717 Ga0075434_100055462
718 Ga0075429_100054452
719 Ga0075429_100514391
720 Ga0075429_100860288
721 Ga0097620_100002161
722 Ga0097620_100188343
723 Ga0097620_100197398
724 Ga0097620_100259081
725 Ga0097620_100268612
726 Ga0097620_100411122
727 Ga0097620_100431516
728 Ga0097620_100610482
729 Ga0097620_100681651
730 Ga0097620_101422514
731 Ga0099794_10491043
732 Ga0105251_10298806
733 Ga0105251_10316908
734 Ga0105251_10410701
735 Ga0105250_10074478
736 Ga0105240_10930989
737 Ga0111539_10004362
738 Ga0111539_10022073
739 Ga0111539_10321163
740 Ga0111539_10561670
741 Ga0105247_10002969
742 Ga0105247_10127716
743 Ga0114129_10008385
744 Ga0114129_10014762
745 Ga0114129_10201617
746 Ga0114129_10220026
747 Ga0114129_10327201
748 Ga0114129_10572357
749 Ga0114129_11453077
750 Ga0114129_12152268
751 Ga0105243_10060639
752 Ga0105243_10387090
753 Ga0105243_10824163
754 Ga0105243_11097330
755 Ga0105241_10209057
756 Ga0105241_10438088
757 Ga0105241_10494964
758 Ga0105241_10826678
759 Ga0105241_11386434
760 Ga0105242_11334514
761 Ga0105248_10029143
762 Ga0105248_10031592
763 Ga0105248_10041941
764 Ga0105248_10097362
765 Ga0105248_10604364
766 Ga0105248_10745534
767 Ga0105237_10191102
768 Ga0105237_10352243
769 Ga0105238_10070843
770 Ga0105238_10095908
771 Ga0105249_10000254
772 Ga0105249_10029653
773 Ga0105249_10200657
774 Ga0105249_10285368
775 Ga0105249_10326907
776 Ga0105249_10681054
777 Ga0105249_11035891
778 Ga0105239_10245952
779 Ga0105239_10529969
780 Ga0105239_11016524
781 Ga0105246_10635231
782 Ga0105246_10723072
783 Ga0105246_11254177
784 Ga0157373_10032044
785 Ga0157373_10567907
786 Ga0157378_10260326
787 Ga0157378_10277355
788 Ga0157378_10703004
789 Ga0157378_10943790
790 Ga0157378_11060882
791 Ga0157378_11107338
792 Ga0163162_10000179
793 Ga0163162_10027136
794 Ga0163162_10060472
795 Ga0163162_11081782
796 Ga0157372_10016847
797 Ga0157372_10019576
798 Ga0157372_10145400
799 Ga0157372_11346439
800 Ga0157375_10227902
801 Ga0157375_10236018
802 Ga0157375_10434416
803 Ga0157375_10508998
804 Ga0157375_10781886
805 Ga0157375_11324638
806 Ga0157375_11771603
807 Ga0163163_10000540
808 Ga0163163_10015415
809 Ga0163163_10081402
810 Ga0163163_10214687
811 Ga0163163_10468864
812 Ga0157380_10006434
813 Ga0157380_10070359
814 Ga0157380_10149915
815 Ga0157380_10752697
816 Ga0157377_10283307
817 Ga0157379_10091118
818 Ga0157379_10314100
819 Ga0182005_1178069
820 Ga0163161_10474369
821 Ga0207697_10212326
822 Ga0207656_10062437
823 Ga0207653_10000459
824 Ga0207682_10289605
825 Ga0207710_10220311
826 Ga0207647_10022622
827 Ga0207647_10198123
828 Ga0207647_10546613
829 Ga0207643_10034409
830 Ga0207643_10395191
831 Ga0207643_10640364
832 Ga0207684_10000065
833 Ga0207684_10007654
834 Ga0207654_10050621
835 Ga0207654_10060514
836 Ga0207654_10342849
837 Ga0207707_10000028
838 Ga0207707_10051185
839 Ga0207707_10171960
840 Ga0207671_10114168
841 Ga0207660_10017551
842 Ga0207660_10049217
843 Ga0207662_10116537
844 Ga0207662_10183812
845 Ga0207662_10207247
846 Ga0207649_10163701
847 Ga0207652_10000573
848 Ga0207646_10075283
849 Ga0207681_10026259
850 Ga0207681_10105451
851 Ga0207681_10331373
852 Ga0207681_10355298
853 Ga0207681_11047347
854 Ga0207694_10054165
855 Ga0207694_10326153
856 Ga0207650_10000046
857 Ga0207650_10064353
858 Ga0207659_10060172
859 Ga0207690_10005933
860 Ga0207706_10081679
861 Ga0207706_10340827
862 Ga0207706_10475926
863 Ga0207686_10090694
864 Ga0207709_10059677
865 Ga0207709_10344780
866 Ga0207709_10606972
867 Ga0207670_10206392
868 Ga0207670_10537160
869 Ga0207665_10020937
870 Ga0207665_10358234
871 Ga0207691_10040699
872 Ga0207691_10142337
873 Ga0207691_10356297
874 Ga0207691_10389933
875 Ga0207711_10010344
876 Ga0207711_10285501
877 Ga0207689_10005974
878 Ga0207689_10092395
879 Ga0207689_10118931
880 Ga0207689_10206199
881 Ga0207689_10840690
882 Ga0207679_10063259
883 Ga0207679_10335714
884 Ga0207667_10257752
885 Ga0207651_10626459
886 Ga0207651_10684482
887 Ga0207651_10933899
888 Ga0207712_10000781
889 Ga0207712_10011077
890 Ga0207712_10014946
891 Ga0207712_10119087
892 Ga0207712_10266075
893 Ga0207712_10306787
894 Ga0207712_10322173
895 Ga0207712_10772343
896 Ga0207668_10018417
897 Ga0207640_10059131
898 Ga0207640_10456863
899 Ga0207640_10911973
900 Ga0207640_11187943
901 Ga0207703_10053712
902 Ga0207703_10225252
903 Ga0207703_10439863
904 Ga0207639_10138835
905 Ga0207639_10298931
906 Ga0207639_10313979
907 Ga0207708_10000083
908 Ga0207708_10020276
909 Ga0207708_10031541
910 Ga0207708_10047926
911 Ga0207708_10216063
912 Ga0207708_10810208
913 Ga0207641_10125895
914 Ga0207641_10128735
915 Ga0207648_10051291
916 Ga0207648_10103437
917 Ga0207648_10323376
918 Ga0207676_10018800
919 Ga0207676_10301161
920 Ga0207676_10307627
921 Ga0207676_10739018
922 Ga0207674_10000006
923 Ga0207675_100006512
924 Ga0207675_100125928
925 Ga0207675_100334850
926 Ga0207675_101178550
927 Ga0207698_10378439
928 Ga0207698_11888220
929 Ga0207428_10007945
930 Ga0207428_10102139
931 Ga0268265_10015895
932 Ga0268265_10119577
933 Ga0268265_10231267
934 Ga0268265_10559914
935 Ga0268264_10044180
936 Ga0268264_10096444
937 Ga0268264_10121557
938 Ga0268264_10497760
939 Ga0268264_10530178
940 Ga0307408_100443420
941 Ga0307408_100524774
942 Ga0307405_10306127
943 Ga0307405_10657050
944 Ga0307413_10293864
945 Ga0307410_10149787
946 Ga0307410_10358503
947 Ga0307406_10006245
948 Ga0307407_10008396
949 Ga0307407_10094009
950 Ga0307407_10336492
951 Ga0307412_10088397
952 Ga0307409_100133938
953 Ga0307409_100142134
954 Ga0307409_100696999
955 Ga0307414_10729270
956 Ga0307411_10164222
957 Ga0307411_10693535
958 Ga0373951_0019121
959 Ga0373932_0092185
960 Ga0373942_0004968
961 Ga0373961_0144526
962 Ga0373931_0064275
963 Ga0373937_0189131
964 Ga0395900_0212454
965 Ga0395898_0419642
966 Ga0395901_0071254
967 Ga0395901_0073099
968 Ga0242422_01858
969 Ga0439436_0073625
970 Ga0439458_0030066
971 Ga0451576_1561058
972 Ga0495586_0572737
973 Ga0495625_0183704
974 Ga0496102_0665454
975 Ga0496104_0228444
976 Ga0496106_0270267
977 Ga0496107_0028020
978 Ga0496108_0180322
979 Ga0496109_0376595
980 Ga0496112_0276458
981 Ga0496112_0496781
982 Ga0501291_005845
983 Ga0501292_012202
984 Ga0501292_013787
985 Ga0501296_007177
986 Ga0501299_025013
987 Ga0501048_0396820
988 Ga0501198_024329
989 Ga0501216_005678
990 Ga0501233_014915
991 Ga0501235_039183
992 Ga0501235_124814
993 Ga0501242_009323
994 Ga0501243_034447
995 Ga0501249_050466
996 Ga0501251_006916
997 Ga0501253_008862
998 Ga0501257_031735
999 Ga0501259_037244
1000 Ga0501261_010433
1001 Ga0501221_017250
1002 Ga0501225_0122168
1003 Ga0501229_004346
1004 Ga0501234_036395
1005 Ga0501245_026892
1006 Ga0501245_094684
1007 Ga0501081_0719942
1008 Ga0501232_028604
1009 Ga0501273_003187
1010 Ga0501283_010445
1011 Ga0501283_040287
1012 Ga0501204_020981
1013 Ga0501226_001554
1014 nmdc:mga05p37_228457_c2
1015 nmdc:mga05p37_611293_c1
1016 nmdc:mga05p37_980503_c1
1017 nmdc:mga09592_351800_c1
1018 nmdc:mga06r32_216470_c1
1019 nmdc:mga06r32_569245_c1
1020 nmdc:mga08y16_233951_c1
1021 nmdc:mga08y16_52088_c1
1022 nmdc:mga08y16_63646_c1
1023 nmdc:mga08y16_81811_c1
1024 nmdc:mga08y16_8198_c1
1025 nmdc:mga0n895_647304_c1
1026 nmdc:mga0n895_66003_c1
1027 nmdc:mga0n895_793581_c1
1028 nmdc:mga0rr50_408027_c1
1029 nmdc:mga08x19_14362_c1
1030 nmdc:mga0a205_136676_c1
1031 nmdc:mga0a205_344754_c1
1032 nmdc:mga0a205_398023_c1
1033 nmdc:mga0a205_695097_c1
1034 Ga0501084_0179241
1035 Ga0501084_0905248
1036 Ga0501082_0522226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

99

173

0.84

Map