F458202

General Info

Members Datasets Scaffolds Average Seq Length
518 239 1036 379

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10001563|JGI25406J46586_100015634
Length 429
Sequence VFTVPVPSSPRAPSARTRNPERERGTGVLLIRSDVLVVGAGPAGSIAALVLARAGVGVRVIDRARFPRDKLCGDTLNPGALAIPVEGMIVTGPRGTTVSAAYPDGLRGVAVKRADLDLLLIAEATAAGACFEQGIAVRAPLMEGDDRSVRGVLARSSGAETELRARVVIAADGRASRLASALGLSRFAFSPRRWAFGAYFQGVTGQTARGEMHVRRDGYIGVAPLPCGLTNVCVVREIGPPEGGPHEEPESDALELGHGRENVGAAFRRPYRGIVANAVAADPLLRDRFANARQVASVTTLGPLAIDSRGAGCPGLLLAGDAAGFIDPMTGDGLRFALRGGMLAAEAALRELETDQPAWRWLDARRADEFSRKWRINRVLRRLVGSPAGVDLAARLAAHWDAPVRYLIGVAGDISIAQHVNSQLPTLLR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0
Rhizoplane 2.9
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001563 3300003203 Bacteria 10790
2 Ga0065712_10000564 3300005290 Bacteria 26949
3 Ga0070676_10007715 3300005328 Bacteria 5779
4 Ga0070690_100004046 3300005330 Bacteria 8116
5 Ga0070670_100001039 3300005331 Bacteria 22001
6 Ga0070670_100001992 3300005331 Bacteria 16700
7 Ga0070670_100028306 3300005331 Bacteria 4823
8 Ga0070670_100057429 3300005331 Bacteria 3341
9 Ga0070670_100196723 3300005331 Bacteria 1751
10 Ga0070670_100234978 3300005331 Bacteria 1596
11 Ga0070666_10002151 3300005335 Bacteria 11969
12 Ga0070680_100150055 3300005336 Bacteria 1956
13 Ga0068868_100051044 3300005338 Bacteria 3251
14 Ga0068868_100148209 3300005338 Bacteria 1931
15 Ga0070689_100026166 3300005340 Bacteria 4390
16 Ga0070691_10004468 3300005341 Bacteria 6351
17 Ga0070691_10049146 3300005341 Bacteria 2009
18 Ga0070687_100020541 3300005343 Bacteria 3089
19 Ga0070668_100092630 3300005347 Bacteria 2384
20 Ga0070669_100086150 3300005353 Bacteria 2347
21 Ga0070675_100008367 3300005354 Bacteria 8025
22 Ga0070675_100012563 3300005354 Bacteria 6639
23 Ga0070675_100021421 3300005354 Bacteria 5165
24 Ga0070675_100049770 3300005354 Bacteria 3440
25 Ga0070675_100157708 3300005354 Bacteria 1949
26 Ga0070675_100204100 3300005354 Bacteria 1716
27 Ga0070671_100040574 3300005355 Bacteria 3866
28 Ga0070674_100061733 3300005356 Unclassified 2617
29 Ga0070674_100189585 3300005356 Bacteria 1581
30 Ga0070673_100012235 3300005364 Bacteria 5886
31 Ga0070673_100032725 3300005364 Bacteria 3919
32 Ga0070673_100045383 3300005364 Bacteria 3408
33 Ga0070673_100082758 3300005364 Unclassified 2606
34 Ga0070673_100113236 3300005364 Bacteria 2253
35 Ga0070673_100176507 3300005364 Bacteria 1826
36 Ga0070688_100010445 3300005365 Bacteria 5119
37 Ga0070688_100050110 3300005365 Unclassified 2600
38 Ga0070688_100135348 3300005365 Bacteria 1667
39 Ga0070709_10037418 3300005434 Bacteria 2963
40 Ga0070713_100048672 3300005436 Bacteria 3492
41 Ga0070713_100053948 3300005436 Bacteria 3333
42 Ga0070701_10067070 3300005438 Bacteria 1908
43 Ga0070701_10076365 3300005438 Bacteria 1803
44 Ga0070705_100004818 3300005440 Bacteria 6564
45 Ga0070700_100003465 3300005441 Bacteria 8136
46 Ga0070694_100021199 3300005444 Bacteria 4148
47 Ga0070708_100006160 3300005445 Bacteria 9541
48 Ga0070708_100158958 3300005445 Bacteria 2105
49 Ga0070678_100015792 3300005456 Bacteria 4809
50 Ga0070678_100028035 3300005456 Bacteria 3834
51 Ga0070678_100084514 3300005456 Bacteria 2416
52 Ga0070678_100109674 3300005456 Bacteria 2157
53 Ga0070678_100220571 3300005456 Bacteria 1576
54 Ga0070681_10006017 3300005458 Bacteria 11755
55 Ga0068867_100009286 3300005459 Bacteria 6942
56 Ga0068867_100078409 3300005459 Bacteria 2485
57 Ga0070706_100194111 3300005467 Bacteria 1897
58 Ga0070698_100107017 3300005471 Bacteria 2765
59 Ga0070698_100198910 3300005471 Bacteria 1940
60 Ga0070698_100364063 3300005471 Unclassified 1378
61 Ga0070699_100006771 3300005518 Bacteria 9970
62 Ga0070699_100012436 3300005518 Bacteria 7344
63 Ga0070697_100182757 3300005536 Bacteria 1778
64 Ga0070672_100047089 3300005543 Bacteria 3345
65 Ga0070672_100183399 3300005543 Bacteria 1745
66 Ga0070672_100256816 3300005543 Unclassified 1473
67 Ga0070686_100003584 3300005544 Bacteria 8519
68 Ga0070686_100101546 3300005544 Bacteria 1944
69 Ga0070686_100115629 3300005544 Bacteria 1834
70 Ga0070695_100014460 3300005545 Bacteria 4758
71 Ga0070696_100002648 3300005546 Bacteria 11870
72 Ga0070696_100069005 3300005546 Bacteria 2483
73 Ga0070693_100108354 3300005547 Bacteria 1704
74 Ga0070665_100054402 3300005548 Bacteria 4014
75 Ga0070665_100069199 3300005548 Bacteria 3538
76 Ga0070704_100007811 3300005549 Bacteria 6378
77 Ga0070664_100123865 3300005564 Bacteria 2265
78 Ga0070664_100207588 3300005564 Bacteria 1750
79 Ga0068854_100048606 3300005578 Bacteria 3027
80 Ga0070702_100000484 3300005615 Bacteria 14292
81 Ga0070702_100094313 3300005615 Bacteria 1822
82 Ga0068859_100014493 3300005617 Bacteria 7915
83 Ga0068859_100115372 3300005617 Bacteria 2750
84 Ga0068864_100018521 3300005618 Bacteria 5819
85 Ga0068864_100078751 3300005618 Bacteria 2885
86 Ga0068861_100003810 3300005719 Bacteria 10066
87 Ga0068861_100038781 3300005719 Bacteria 3552
88 Ga0068863_100143418 3300005841 Bacteria 2284
89 Ga0068858_100046273 3300005842 Bacteria 4034
90 Ga0068858_100087826 3300005842 Bacteria 2892
91 Ga0068860_100131873 3300005843 Bacteria 2398
92 Ga0068860_100231647 3300005843 Unclassified 1795
93 Ga0081539_10000112 3300005985 Bacteria 190218
94 Ga0081539_10001191 3300005985 Bacteria 46937
95 Ga0081539_10001673 3300005985 Bacteria 35884
96 Ga0070717_10056620 3300006028 Bacteria 3240
97 Ga0075368_10018434 3300006042 Bacteria 2623
98 Ga0075364_10002202 3300006051 Bacteria 10928
99 Ga0075364_10019933 3300006051 Bacteria 4214
100 Ga0075364_10078610 3300006051 Bacteria 2179
101 Ga0075367_10009911 3300006178 Bacteria 4992
102 Ga0075366_10021650 3300006195 Bacteria 3738
103 Ga0075366_10035932 3300006195 Bacteria 2921
104 Ga0097621_100006127 3300006237 Bacteria 8516
105 Ga0097621_100027048 3300006237 Bacteria 4507
106 Ga0097621_100144486 3300006237 Bacteria 2035
107 Ga0097621_100338217 3300006237 Bacteria 1336
108 Ga0068871_100005477 3300006358 Bacteria 8904
109 Ga0068871_100019169 3300006358 Bacteria 5221
110 Ga0068871_100104699 3300006358 Bacteria 2373
111 Ga0075428_100003567 3300006844 Bacteria 17035
112 Ga0075428_100023185 3300006844 Bacteria 6867
113 Ga0075428_100062719 3300006844 Unclassified 4069
114 Ga0075428_100066827 3300006844 Bacteria 3936
115 Ga0075428_100149737 3300006844 Bacteria 2535
116 Ga0075430_100005707 3300006846 Bacteria 10499
117 Ga0075430_100008009 3300006846 Bacteria 8932
118 Ga0075430_100013244 3300006846 Bacteria 7028
119 Ga0075430_100152645 3300006846 Unclassified 1923
120 Ga0075431_100010377 3300006847 Bacteria 9359
121 Ga0075431_100021005 3300006847 Bacteria 6672
122 Ga0075431_100021699 3300006847 Bacteria 6565
123 Ga0075431_100033667 3300006847 Bacteria 5280
124 Ga0075431_100073308 3300006847 Bacteria 3532
125 Ga0075431_100370610 3300006847 Bacteria 1437
126 Ga0075433_10011472 3300006852 Bacteria 7136
127 Ga0075433_10069567 3300006852 Bacteria 3092
128 Ga0075433_10137449 3300006852 Bacteria 2172
129 Ga0075434_100000298 3300006871 Bacteria 35329
130 Ga0075434_100001025 3300006871 Bacteria 22733
131 Ga0075434_100003053 3300006871 Bacteria 14896
132 Ga0075434_100006727 3300006871 Bacteria 10563
133 Ga0075434_100027731 3300006871 Bacteria 5561
134 Ga0075434_100166672 3300006871 Bacteria 2223
135 Ga0075434_100235651 3300006871 Bacteria 1850
136 Ga0075429_100025772 3300006880 Bacteria 5106
137 Ga0075429_100180476 3300006880 Bacteria 1850
138 Ga0068865_100021668 3300006881 Bacteria 4183
139 Ga0075436_100005539 3300006914 Bacteria 8677
140 Ga0075436_100011177 3300006914 Bacteria 6153
141 Ga0075436_100033334 3300006914 Bacteria 3550
142 Ga0075436_100054142 3300006914 Bacteria 2769
143 Ga0097620_100014492 3300006931 Bacteria 7915
144 Ga0097620_100115374 3300006931 Bacteria 2750
145 Ga0075435_100000216 3300007076 Bacteria 35336
146 Ga0075435_100001005 3300007076 Bacteria 17887
147 Ga0075435_100003027 3300007076 Bacteria 11322
148 Ga0075435_100007953 3300007076 Bacteria 7587
149 Ga0075435_100011405 3300007076 Bacteria 6536
150 Ga0075435_100012483 3300007076 Bacteria 6295
151 Ga0075435_100071817 3300007076 Bacteria 2827
152 Ga0075435_100150365 3300007076 Bacteria 1957
153 Ga0111539_10000848 3300009094 Bacteria 39851
154 Ga0111539_10001054 3300009094 Bacteria 36306
155 Ga0111539_10002485 3300009094 Bacteria 24447
156 Ga0111539_10006172 3300009094 Bacteria 15467
157 Ga0111539_10013220 3300009094 Bacteria 10318
158 Ga0111539_10020215 3300009094 Bacteria 8206
159 Ga0111539_10027138 3300009094 Bacteria 6993
160 Ga0111539_10085156 3300009094 Bacteria 3715
161 Ga0111539_10092567 3300009094 Unclassified 3552
162 Ga0111539_10113910 3300009094 Bacteria 3172
163 Ga0111539_10158051 3300009094 Bacteria 2652
164 Ga0111539_10202545 3300009094 Bacteria 2314
165 Ga0111539_10286571 3300009094 Unclassified 1917
166 Ga0111539_10405626 3300009094 Bacteria 1587
167 Ga0105245_10008713 3300009098 Bacteria 8844
168 Ga0105247_10023688 3300009101 Unclassified 3699
169 Ga0114129_10000239 3300009147 Bacteria 61404
170 Ga0114129_10001751 3300009147 Bacteria 29559
171 Ga0114129_10006775 3300009147 Bacteria 16266
172 Ga0114129_10012472 3300009147 Bacteria 12099
173 Ga0114129_10013991 3300009147 Bacteria 11430
174 Ga0114129_10027027 3300009147 Bacteria 8125
175 Ga0114129_10033142 3300009147 Bacteria 7299
176 Ga0114129_10037300 3300009147 Bacteria 6863
177 Ga0114129_10089525 3300009147 Bacteria 4266
178 Ga0114129_10096721 3300009147 Bacteria 4087
179 Ga0114129_10279448 3300009147 Bacteria 2231
180 Ga0114129_10291153 3300009147 Bacteria 2179
181 Ga0114129_10343294 3300009147 Bacteria 1980
182 Ga0114129_10485386 3300009147 Bacteria 1616
183 Ga0105241_10123897 3300009174 Bacteria 2085
184 Ga0105242_10003291 3300009176 Bacteria 12588
185 Ga0105242_10034385 3300009176 Bacteria 4062
186 Ga0105242_10303503 3300009176 Bacteria 1458
187 Ga0105248_10005419 3300009177 Bacteria 14018
188 Ga0105248_10005798 3300009177 Bacteria 13576
189 Ga0105248_10009120 3300009177 Bacteria 10914
190 Ga0105248_10120100 3300009177 Bacteria 2965
191 Ga0105248_10155033 3300009177 Bacteria 2584
192 Ga0105248_10325182 3300009177 Bacteria 1732
193 Ga0105249_10010981 3300009553 Bacteria 7958
194 Ga0105249_10126683 3300009553 Bacteria 2433
195 Ga0105249_10325830 3300009553 Bacteria 1548
196 Ga0105239_10380183 3300010375 Bacteria 1596
197 Ga0163162_10635412 3300013306 Bacteria 1192
198 Ga0157375_10020202 3300013308 Bacteria 6079
199 Ga0157375_10022144 3300013308 Bacteria 5846
200 Ga0163163_10036359 3300014325 Bacteria 4783
201 Ga0163163_10058672 3300014325 Bacteria 3806
202 Ga0157380_10114990 3300014326 Bacteria 2268
203 Ga0157380_10236350 3300014326 Unclassified 1645
204 Ga0157377_10048154 3300014745 Unclassified 2390
205 Ga0157377_10110849 3300014745 Unclassified 1649
206 Ga0157379_10014465 3300014968 Bacteria 6925
207 Ga0157379_10043396 3300014968 Bacteria 4014
208 Ga0157376_10003509 3300014969 Bacteria 10818
209 Ga0157376_10020231 3300014969 Bacteria 5145
210 Ga0206356_11904175 3300020070 Bacteria 1470
211 Ga0207697_10001430 3300025315 Bacteria 13057
212 Ga0207697_10025656 3300025315 Unclassified 2408
213 Ga0207688_10004991 3300025901 Bacteria 7219
214 Ga0207680_10104425 3300025903 Bacteria 1826
215 Ga0207685_10027266 3300025905 Bacteria 1997
216 Ga0207645_10002002 3300025907 Bacteria 16370
217 Ga0207645_10164274 3300025907 Bacteria 1453
218 Ga0207705_10032650 3300025909 Bacteria 3721
219 Ga0207662_10047191 3300025918 Bacteria 2551
220 Ga0207662_10053794 3300025918 Bacteria 2399
221 Ga0207662_10087676 3300025918 Bacteria 1910
222 Ga0207649_10091687 3300025920 Bacteria 1991
223 Ga0207646_10202595 3300025922 Bacteria 1793
224 Ga0207681_10099857 3300025923 Bacteria 2091
225 Ga0207650_10036771 3300025925 Bacteria 3563
226 Ga0207650_10048893 3300025925 Unclassified 3120
227 Ga0207650_10054982 3300025925 Bacteria 2954
228 Ga0207659_10007108 3300025926 Bacteria 6874
229 Ga0207659_10010015 3300025926 Bacteria 5937
230 Ga0207659_10012056 3300025926 Bacteria 5480
231 Ga0207659_10167796 3300025926 Bacteria 1729
232 Ga0207700_10008036 3300025928 Bacteria 6504
233 Ga0207644_10090831 3300025931 Bacteria 2276
234 Ga0207644_10096666 3300025931 Bacteria 2211
235 Ga0207644_10322641 3300025931 Bacteria 1249
236 Ga0207706_10013107 3300025933 Bacteria 7541
237 Ga0207706_10058066 3300025933 Bacteria 3409
238 Ga0207706_10111290 3300025933 Bacteria 2409
239 Ga0207706_10203372 3300025933 Bacteria 1737
240 Ga0207686_10033340 3300025934 Unclassified 3074
241 Ga0207686_10064258 3300025934 Bacteria 2336
242 Ga0207709_10071753 3300025935 Bacteria 2200
243 Ga0207670_10217094 3300025936 Bacteria 1462
244 Ga0207669_10002412 3300025937 Bacteria 7970
245 Ga0207669_10210767 3300025937 Bacteria 1418
246 Ga0207704_10004440 3300025938 Bacteria 6414
247 Ga0207691_10005963 3300025940 Bacteria 11769
248 Ga0207691_10013789 3300025940 Bacteria 7721
249 Ga0207691_10018291 3300025940 Bacteria 6638
250 Ga0207691_10131830 3300025940 Bacteria 2207
251 Ga0207691_10186015 3300025940 Bacteria 1813
252 Ga0207691_10186892 3300025940 Bacteria 1808
253 Ga0207711_10009532 3300025941 Bacteria 8098
254 Ga0207711_10084651 3300025941 Bacteria 2776
255 Ga0207711_10125269 3300025941 Bacteria 2297
256 Ga0207689_10045026 3300025942 Bacteria 3649
257 Ga0207679_10074436 3300025945 Bacteria 2573
258 Ga0207679_10086703 3300025945 Bacteria 2409
259 Ga0207679_10295698 3300025945 Bacteria 1394
260 Ga0207651_10010966 3300025960 Bacteria 5048
261 Ga0207651_10016938 3300025960 Bacteria 4289
262 Ga0207651_10062221 3300025960 Unclassified 2600
263 Ga0207651_10096228 3300025960 Bacteria 2183
264 Ga0207640_10005380 3300025981 Bacteria 6981
265 Ga0207658_10318291 3300025986 Bacteria 1346
266 Ga0207677_10143613 3300026023 Bacteria 1831
267 Ga0207703_10250174 3300026035 Bacteria 1597
268 Ga0207678_10145940 3300026067 Bacteria 2019
269 Ga0207708_10003077 3300026075 Bacteria 12281
270 Ga0207708_10005571 3300026075 Bacteria 9294
271 Ga0207708_10066250 3300026075 Bacteria 2761
272 Ga0207641_10068530 3300026088 Bacteria 3042
273 Ga0207648_10012086 3300026089 Bacteria 8097
274 Ga0207648_10037675 3300026089 Bacteria 4260
275 Ga0207648_10038661 3300026089 Bacteria 4198
276 Ga0207648_10053261 3300026089 Bacteria 3537
277 Ga0207676_10021053 3300026095 Bacteria 4780
278 Ga0207676_10031345 3300026095 Bacteria 3998
279 Ga0207676_10120132 3300026095 Bacteria 2214
280 Ga0207674_10063929 3300026116 Bacteria 3713
281 Ga0207675_100002748 3300026118 Bacteria 17293
282 Ga0207675_100016415 3300026118 Bacteria 6915
283 Ga0207675_100065806 3300026118 Bacteria 3387
284 Ga0207683_10013002 3300026121 Bacteria 7105
285 Ga0207683_10031802 3300026121 Bacteria 4581
286 Ga0207683_10053774 3300026121 Bacteria 3531
287 Ga0207683_10066900 3300026121 Bacteria 3169
288 Ga0207683_10135154 3300026121 Bacteria 2220
289 Ga0207698_10093953 3300026142 Bacteria 2464
290 Ga0207698_10112005 3300026142 Bacteria 2289
291 Ga0207698_10200522 3300026142 Bacteria 1786
292 Ga0207428_10044364 3300027907 Bacteria 3587
293 Ga0207428_10071758 3300027907 Bacteria 2719
294 Ga0268266_10132867 3300028379 Bacteria 2227
295 Ga0268264_10021284 3300028381 Bacteria 5297
296 Ga0268264_10235940 3300028381 Bacteria 1692
297 Ga0307408_100022485 3300031548 Bacteria 4285
298 Ga0307408_100035068 3300031548 Bacteria 3518
299 Ga0307405_10002774 3300031731 Bacteria 7857
300 Ga0307405_10017918 3300031731 Bacteria 3897
301 Ga0307413_10013483 3300031824 Bacteria 4112
302 Ga0307413_10224900 3300031824 Bacteria 1373
303 Ga0307410_10003204 3300031852 Bacteria 8156
304 Ga0307407_10005016 3300031903 Bacteria 5698
305 Ga0307407_10006769 3300031903 Bacteria 5131
306 Ga0307412_10010953 3300031911 Bacteria 5235
307 Ga0307412_10037532 3300031911 Bacteria 3114
308 Ga0307412_10059209 3300031911 Bacteria 2566
309 Ga0307409_100000434 3300031995 Bacteria 17725
310 Ga0307409_100041320 3300031995 Bacteria 3443
311 Ga0307409_100073639 3300031995 Bacteria 2725
312 Ga0307416_100013181 3300032002 Bacteria 5609
313 Ga0307416_100083929 3300032002 Bacteria 2705
314 Ga0307416_100245033 3300032002 Bacteria 1740
315 Ga0307414_10002556 3300032004 Bacteria 9571
316 Ga0307414_10054114 3300032004 Bacteria 2803
317 Ga0307414_10116272 3300032004 Bacteria 2047
318 Ga0307411_10006713 3300032005 Bacteria 5784
319 Ga0307411_10009612 3300032005 Bacteria 5099
320 Ga0307411_10139461 3300032005 Bacteria 1786
321 Ga0307415_100006193 3300032126 Bacteria 6427
322 Ga0307415_100011545 3300032126 Bacteria 5061
323 Ga0307415_100019532 3300032126 Bacteria 4116
324 Ga0373930_0000051 3300034816 Bacteria 10681
325 Ga0373938_0001007 3300034957 Unclassified 4536
326 Ga0373928_0000359 3300035084 Bacteria 9112
327 Ga0373949_0001939 3300035090 Bacteria 5573
328 Ga0373951_0000500 3300035091 Bacteria 11150
329 Ga0373952_0002258 3300035092 Bacteria 3469
330 Ga0373923_0050037 3300035111 Bacteria 1749
331 Ga0373932_0000133 3300035112 Bacteria 21018
332 Ga0373939_0000672 3300035114 Bacteria 8486
333 Ga0373960_0000368 3300035121 Bacteria 8692
334 Ga0373943_0074685 3300035170 Unclassified 1724
335 Ga0373946_0007368 3300035171 Bacteria 4020
336 Ga0373955_0063825 3300035172 Bacteria 2040
337 Ga0373942_0000431 3300035207 Bacteria 11705
338 Ga0373961_0002516 3300035241 Unclassified 4733
339 Ga0373961_0017458 3300035241 Bacteria 1862
340 Ga0373962_0009914 3300035242 Bacteria 2367
341 Ga0373924_0002319 3300035410 Bacteria 6386
342 Ga0373935_0081360 3300035692 Bacteria 2105
343 Ga0373933_0085804 3300035724 Unclassified 1936
344 Ga0373937_0001133 3300036401 Bacteria 22430
345 Ga0373937_0111638 3300036401 Bacteria 2543
346 Ga0373937_0189155 3300036401 Unclassified 1934
347 Ga0373925_0003703 3300037068 Bacteria 11742
348 Ga0395900_0357797 3300037418 Bacteria 1432
349 Ga0451853_1777107 3300041512 Bacteria 2466
350 Ga0439435_0003774 3300042436 Unclassified 3190
351 Ga0439435_0017586 3300042436 Unclassified 1809
352 Ga0451577_0023942 3300042876 Bacteria 5561
353 Ga0453684_0131509 3300044712 Bacteria 3002
354 Ga0453684_0340461 3300044712 Unclassified 1694
355 Ga0451576_0003826 3300045051 Bacteria 20230
356 Ga0451576_0027721 3300045051 Bacteria 6080
357 Ga0451576_0380280 3300045051 Unclassified 1480
358 Ga0451576_0482339 3300045051 Bacteria 1302
359 Ga0495592_0133645 3300046454 Bacteria 1733
360 Ga0495603_0161450 3300046455 Bacteria 1300
361 Ga0495629_0015813 3300046459 Bacteria 5419
362 Ga0495580_0201920 3300046472 Bacteria 1369
363 Ga0495582_0026932 3300046473 Bacteria 3150
364 Ga0495664_0158085 3300046477 Bacteria 1375
365 Ga0495594_0006673 3300046499 Bacteria 5939
366 Ga0495608_0187613 3300046511 Bacteria 1306
367 Ga0495630_0044379 3300046517 Bacteria 3322
368 Ga0495643_0003205 3300046522 Bacteria 12140
369 Ga0495586_0040243 3300046535 Bacteria 2514
370 Ga0495645_0001192 3300046543 Bacteria 17745
371 Ga0495645_0022921 3300046543 Bacteria 4519
372 Ga0495667_0109154 3300046559 Bacteria 1788
373 Ga0495659_0015211 3300046664 Bacteria 2528
374 Ga0495588_0014187 3300046674 Unclassified 3810
375 Ga0495658_0040668 3300046683 Unclassified 2586
376 Ga0495669_0009139 3300046684 Bacteria 4176
377 Ga0495613_0006752 3300046689 Bacteria 8570
378 Ga0495604_0022550 3300047317 Bacteria 5027
379 Ga0495674_0011154 3300047319 Bacteria 8484
380 Ga0495674_0163092 3300047319 Unclassified 1864
381 Ga0495684_0000226 3300047471 Bacteria 44097
382 Ga0496100_0039243 3300048903 Bacteria 3006
383 Ga0496101_0067820 3300048904 Bacteria 2606
384 Ga0496102_0031872 3300048905 Bacteria 4732
385 Ga0496102_0319257 3300048905 Bacteria 1463
386 Ga0496104_0052833 3300048907 Bacteria 3838
387 Ga0496104_0093155 3300048907 Unclassified 2881
388 Ga0496106_0030983 3300048909 Unclassified 3987
389 Ga0496109_0067626 3300048912 Bacteria 3273
390 Ga0496109_0189993 3300048912 Bacteria 1930
391 Ga0496109_0265278 3300048912 Bacteria 1618
392 Ga0496110_0008139 3300048913 Bacteria 8424
393 Ga0496111_0023805 3300048914 Bacteria 4302
394 Ga0496112_0074137 3300048915 Bacteria 3365
395 Ga0496114_0002704 3300048917 Bacteria 13545
396 Ga0496114_0201295 3300048917 Bacteria 1744
397 Ga0501034_0019831 3300049571 Bacteria 6872
398 Ga0501034_0025293 3300049571 Bacteria 6043
399 Ga0501034_0050614 3300049571 Bacteria 4190
400 Ga0501036_0066685 3300049572 Unclassified 3045
401 Ga0501036_0142156 3300049572 Bacteria 2025
402 Ga0501036_0252856 3300049572 Unclassified 1477
403 Ga0501038_0070855 3300049574 Unclassified 2958
404 Ga0501038_0078047 3300049574 Bacteria 2795
405 Ga0501039_0048666 3300049575 Unclassified 3277
406 Ga0501040_0006332 3300049576 Bacteria 7686
407 Ga0501040_0019732 3300049576 Bacteria 4486
408 Ga0501042_0007425 3300049578 Bacteria 7179
409 Ga0501042_0070464 3300049578 Bacteria 2501
410 Ga0501046_0012749 3300049580 Bacteria 7150
411 Ga0501046_0074614 3300049580 Bacteria 2631
412 Ga0501046_0119470 3300049580 Bacteria 2007
413 Ga0501046_0281441 3300049580 Bacteria 1218
414 Ga0501047_0016873 3300049581 Bacteria 6979
415 Ga0501047_0490604 3300049581 Bacteria 1055
416 Ga0501048_0011724 3300049582 Bacteria 6538
417 Ga0501070_0113305 3300049586 Bacteria 2241
418 Ga0501070_0220791 3300049586 Bacteria 1554
419 Ga0501071_0031721 3300049587 Bacteria 3748
420 Ga0501071_0163985 3300049587 Bacteria 1662
421 Ga0501072_0004635 3300049588 Bacteria 10469
422 Ga0501072_0103061 3300049588 Bacteria 2268
423 Ga0501072_0224861 3300049588 Bacteria 1495
424 Ga0501073_0000430 3300049589 Bacteria 28781
425 Ga0501073_0052080 3300049589 Bacteria 2867
426 Ga0501074_0031387 3300049590 Bacteria 3849
427 Ga0501074_0033712 3300049590 Bacteria 3711
428 Ga0501074_0065319 3300049590 Bacteria 2619
429 Ga0501075_0011992 3300049591 Bacteria 6151
430 Ga0501075_0072231 3300049591 Unclassified 2609
431 Ga0501075_0088918 3300049591 Unclassified 2342
432 Ga0501076_0016074 3300049592 Bacteria 5667
433 Ga0501076_0070683 3300049592 Bacteria 2791
434 Ga0501076_0086474 3300049592 Bacteria 2520
435 Ga0501076_0218818 3300049592 Bacteria 1557
436 Ga0501079_0062925 3300049741 Unclassified 2862
437 Ga0501080_0049026 3300049742 Bacteria 3930
438 Ga0501081_0004524 3300049743 Bacteria 8929
439 Ga0501083_0011901 3300049744 Bacteria 6095
440 Ga0501035_0046986 3300049822 Unclassified 3879
441 Ga0501044_0056356 3300049823 Unclassified 4035
442 Ga0501045_0037484 3300049824 Bacteria 3524
443 nmdc:mga00v17_15767_c1 3300050491 Bacteria 4248
444 nmdc:mga0k408_22797_c1 3300050493 Bacteria 3528
445 nmdc:mga05p37_116819_c1 3300050507 Bacteria 3279
446 nmdc:mga05p37_1310_c1 3300050507 Bacteria 28946
447 nmdc:mga05p37_16479_c1 3300050507 Bacteria 8903
448 nmdc:mga05p37_179337_c1 3300050507 Bacteria 2578
449 nmdc:mga05p37_20953_c1 3300050507 Bacteria 7913
450 nmdc:mga05p37_24643_c1 3300050507 Bacteria 7312
451 nmdc:mga05p37_30_c1 3300050507 Bacteria 114300
452 nmdc:mga05p37_395131_c1 3300050507 Bacteria 1616
453 nmdc:mga05p37_436292_c1 3300050507 Bacteria 1520
454 nmdc:mga05p37_82078_c1 3300050507 Bacteria 3971
455 nmdc:mga09592_13528_c1 3300050508 Bacteria 6664
456 nmdc:mga0qj67_147878_c1 3300050509 Unclassified 1905
457 nmdc:mga0qj67_15116_c1 3300050509 Bacteria 5841
458 nmdc:mga0qj67_87203_c1 3300050509 Bacteria 2504
459 nmdc:mga06r32_194695_c1 3300050510 Bacteria 2014
460 nmdc:mga06r32_329856_c1 3300050510 Unclassified 1511
461 nmdc:mga06r32_35368_c1 3300050510 Bacteria 4714
462 nmdc:mga06r32_506282_c1 3300050510 Bacteria 1184
463 nmdc:mga06r32_68068_c1 3300050510 Bacteria 3439
464 nmdc:mga08y16_26409_c1 3300050511 Bacteria 6123
465 nmdc:mga08y16_279067_c1 3300050511 Bacteria 1724
466 nmdc:mga08y16_305_c1 3300050511 Bacteria 44208
467 nmdc:mga08y16_3701_c1 3300050511 Bacteria 15914
468 nmdc:mga08y16_4483_c1 3300050511 Bacteria 14594
469 nmdc:mga08y16_45897_c1 3300050511 Bacteria 4577
470 nmdc:mga08y16_5411_c1 3300050511 Bacteria 13349
471 nmdc:mga08y16_64656_c1 3300050511 Bacteria 3819
472 nmdc:mga08y16_67083_c1 3300050511 Bacteria 3743
473 nmdc:mga08y16_67483_c1 3300050511 Bacteria 3731
474 nmdc:mga0n895_1599_c1 3300050512 Bacteria 17047
475 nmdc:mga0n895_207271_c1 3300050512 Bacteria 1991
476 nmdc:mga0n895_229_c1 3300050512 Bacteria 35421
477 nmdc:mga0n895_32329_c1 3300050512 Bacteria 5021
478 nmdc:mga0n895_345895_c1 3300050512 Bacteria 1506
479 nmdc:mga0n895_67048_c1 3300050512 Bacteria 3554
480 nmdc:mga0n895_91255_c1 3300050512 Bacteria 3048
481 nmdc:mga0rr50_10864_c1 3300050513 Bacteria 5804
482 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
483 nmdc:mga0rr50_32704_c1 3300050513 Bacteria 3709
484 nmdc:mga0rr50_35878_c1 3300050513 Bacteria 3566
485 nmdc:mga0rr50_53379_c1 3300050513 Bacteria 3006
486 nmdc:mga0rr50_689_c1 3300050513 Bacteria 18046
487 nmdc:mga0rr50_78212_c1 3300050513 Bacteria 2545
488 nmdc:mga08x19_235_c1 3300050514 Bacteria 42307
489 nmdc:mga08x19_2793_c1 3300050514 Bacteria 10538
490 nmdc:mga08x19_71847_c1 3300050514 Bacteria 2257
491 nmdc:mga0a205_10223_c1 3300050515 Bacteria 7206
492 nmdc:mga0a205_13823_c1 3300050515 Bacteria 7522
493 nmdc:mga0a205_139331_c1 3300050515 Bacteria 2326
494 nmdc:mga0a205_2077_c1 3300050515 Bacteria 17512
495 nmdc:mga0a205_298567_c1 3300050515 Bacteria 1484
496 Ga0495601_0008120 3300053077 Bacteria 6189
497 Ga0495601_0180063 3300053077 Bacteria 1382
498 Ga0495619_0003775 3300053085 Bacteria 9743
499 Ga0495619_0017035 3300053085 Bacteria 4607
500 Ga0500555_000445 3300053103 Bacteria 17132
501 Ga0500616_0000158 3300053153 Bacteria 112091
502 Ga0500645_000402 3300053730 Bacteria 30326
503 Ga0501084_0003532 3300054114 Bacteria 12689
504 Ga0501084_0042644 3300054114 Unclassified 3795
505 Ga0501084_0057489 3300054114 Unclassified 3255
506 Ga0501084_0327599 3300054114 Bacteria 1294
507 Ga0590071_000043 3300059421 Bacteria 32171
508 Ga0590074_001637 3300059423 Bacteria 3649
509 Ga0590075_011767 3300059424 Bacteria 2119
510 Ga0590075_021415 3300059424 Unclassified 1613
511 Ga0590077_000159 3300059426 Bacteria 19089
512 Ga0590077_003094 3300059426 Bacteria 3484
513 Ga0501082_0023449 3300060353 Bacteria 5324
514 Ga0501082_0152059 3300060353 Bacteria 2010
515 Ga0501082_0250040 3300060353 Unclassified 1543
516 Ga0530510_0004014 3300061734 Bacteria 10163
517 Ga0530510_0082042 3300061734 Bacteria 2348
518 Ga0530510_0106768 3300061734 Bacteria 2049
519 JGI25406J46586_10001563
520 Ga0065712_10000564
521 Ga0070676_10007715
522 Ga0070690_100004046
523 Ga0070670_100001039
524 Ga0070670_100001992
525 Ga0070670_100028306
526 Ga0070670_100057429
527 Ga0070670_100196723
528 Ga0070670_100234978
529 Ga0070666_10002151
530 Ga0070680_100150055
531 Ga0068868_100051044
532 Ga0068868_100148209
533 Ga0070689_100026166
534 Ga0070691_10004468
535 Ga0070691_10049146
536 Ga0070687_100020541
537 Ga0070668_100092630
538 Ga0070669_100086150
539 Ga0070675_100008367
540 Ga0070675_100012563
541 Ga0070675_100021421
542 Ga0070675_100049770
543 Ga0070675_100157708
544 Ga0070675_100204100
545 Ga0070671_100040574
546 Ga0070674_100061733
547 Ga0070674_100189585
548 Ga0070673_100012235
549 Ga0070673_100032725
550 Ga0070673_100045383
551 Ga0070673_100082758
552 Ga0070673_100113236
553 Ga0070673_100176507
554 Ga0070688_100010445
555 Ga0070688_100050110
556 Ga0070688_100135348
557 Ga0070709_10037418
558 Ga0070713_100048672
559 Ga0070713_100053948
560 Ga0070701_10067070
561 Ga0070701_10076365
562 Ga0070705_100004818
563 Ga0070700_100003465
564 Ga0070694_100021199
565 Ga0070708_100006160
566 Ga0070708_100158958
567 Ga0070678_100015792
568 Ga0070678_100028035
569 Ga0070678_100084514
570 Ga0070678_100109674
571 Ga0070678_100220571
572 Ga0070681_10006017
573 Ga0068867_100009286
574 Ga0068867_100078409
575 Ga0070706_100194111
576 Ga0070698_100107017
577 Ga0070698_100198910
578 Ga0070698_100364063
579 Ga0070699_100006771
580 Ga0070699_100012436
581 Ga0070697_100182757
582 Ga0070672_100047089
583 Ga0070672_100183399
584 Ga0070672_100256816
585 Ga0070686_100003584
586 Ga0070686_100101546
587 Ga0070686_100115629
588 Ga0070695_100014460
589 Ga0070696_100002648
590 Ga0070696_100069005
591 Ga0070693_100108354
592 Ga0070665_100054402
593 Ga0070665_100069199
594 Ga0070704_100007811
595 Ga0070664_100123865
596 Ga0070664_100207588
597 Ga0068854_100048606
598 Ga0070702_100000484
599 Ga0070702_100094313
600 Ga0068859_100014493
601 Ga0068859_100115372
602 Ga0068864_100018521
603 Ga0068864_100078751
604 Ga0068861_100003810
605 Ga0068861_100038781
606 Ga0068863_100143418
607 Ga0068858_100046273
608 Ga0068858_100087826
609 Ga0068860_100131873
610 Ga0068860_100231647
611 Ga0081539_10000112
612 Ga0081539_10001191
613 Ga0081539_10001673
614 Ga0070717_10056620
615 Ga0075368_10018434
616 Ga0075364_10002202
617 Ga0075364_10019933
618 Ga0075364_10078610
619 Ga0075367_10009911
620 Ga0075366_10021650
621 Ga0075366_10035932
622 Ga0097621_100006127
623 Ga0097621_100027048
624 Ga0097621_100144486
625 Ga0097621_100338217
626 Ga0068871_100005477
627 Ga0068871_100019169
628 Ga0068871_100104699
629 Ga0075428_100003567
630 Ga0075428_100023185
631 Ga0075428_100062719
632 Ga0075428_100066827
633 Ga0075428_100149737
634 Ga0075430_100005707
635 Ga0075430_100008009
636 Ga0075430_100013244
637 Ga0075430_100152645
638 Ga0075431_100010377
639 Ga0075431_100021005
640 Ga0075431_100021699
641 Ga0075431_100033667
642 Ga0075431_100073308
643 Ga0075431_100370610
644 Ga0075433_10011472
645 Ga0075433_10069567
646 Ga0075433_10137449
647 Ga0075434_100000298
648 Ga0075434_100001025
649 Ga0075434_100003053
650 Ga0075434_100006727
651 Ga0075434_100027731
652 Ga0075434_100166672
653 Ga0075434_100235651
654 Ga0075429_100025772
655 Ga0075429_100180476
656 Ga0068865_100021668
657 Ga0075436_100005539
658 Ga0075436_100011177
659 Ga0075436_100033334
660 Ga0075436_100054142
661 Ga0097620_100014492
662 Ga0097620_100115374
663 Ga0075435_100000216
664 Ga0075435_100001005
665 Ga0075435_100003027
666 Ga0075435_100007953
667 Ga0075435_100011405
668 Ga0075435_100012483
669 Ga0075435_100071817
670 Ga0075435_100150365
671 Ga0111539_10000848
672 Ga0111539_10001054
673 Ga0111539_10002485
674 Ga0111539_10006172
675 Ga0111539_10013220
676 Ga0111539_10020215
677 Ga0111539_10027138
678 Ga0111539_10085156
679 Ga0111539_10092567
680 Ga0111539_10113910
681 Ga0111539_10158051
682 Ga0111539_10202545
683 Ga0111539_10286571
684 Ga0111539_10405626
685 Ga0105245_10008713
686 Ga0105247_10023688
687 Ga0114129_10000239
688 Ga0114129_10001751
689 Ga0114129_10006775
690 Ga0114129_10012472
691 Ga0114129_10013991
692 Ga0114129_10027027
693 Ga0114129_10033142
694 Ga0114129_10037300
695 Ga0114129_10089525
696 Ga0114129_10096721
697 Ga0114129_10279448
698 Ga0114129_10291153
699 Ga0114129_10343294
700 Ga0114129_10485386
701 Ga0105241_10123897
702 Ga0105242_10003291
703 Ga0105242_10034385
704 Ga0105242_10303503
705 Ga0105248_10005419
706 Ga0105248_10005798
707 Ga0105248_10009120
708 Ga0105248_10120100
709 Ga0105248_10155033
710 Ga0105248_10325182
711 Ga0105249_10010981
712 Ga0105249_10126683
713 Ga0105249_10325830
714 Ga0105239_10380183
715 Ga0163162_10635412
716 Ga0157375_10020202
717 Ga0157375_10022144
718 Ga0163163_10036359
719 Ga0163163_10058672
720 Ga0157380_10114990
721 Ga0157380_10236350
722 Ga0157377_10048154
723 Ga0157377_10110849
724 Ga0157379_10014465
725 Ga0157379_10043396
726 Ga0157376_10003509
727 Ga0157376_10020231
728 Ga0206356_11904175
729 Ga0207697_10001430
730 Ga0207697_10025656
731 Ga0207688_10004991
732 Ga0207680_10104425
733 Ga0207685_10027266
734 Ga0207645_10002002
735 Ga0207645_10164274
736 Ga0207705_10032650
737 Ga0207662_10047191
738 Ga0207662_10053794
739 Ga0207662_10087676
740 Ga0207649_10091687
741 Ga0207646_10202595
742 Ga0207681_10099857
743 Ga0207650_10036771
744 Ga0207650_10048893
745 Ga0207650_10054982
746 Ga0207659_10007108
747 Ga0207659_10010015
748 Ga0207659_10012056
749 Ga0207659_10167796
750 Ga0207700_10008036
751 Ga0207644_10090831
752 Ga0207644_10096666
753 Ga0207644_10322641
754 Ga0207706_10013107
755 Ga0207706_10058066
756 Ga0207706_10111290
757 Ga0207706_10203372
758 Ga0207686_10033340
759 Ga0207686_10064258
760 Ga0207709_10071753
761 Ga0207670_10217094
762 Ga0207669_10002412
763 Ga0207669_10210767
764 Ga0207704_10004440
765 Ga0207691_10005963
766 Ga0207691_10013789
767 Ga0207691_10018291
768 Ga0207691_10131830
769 Ga0207691_10186015
770 Ga0207691_10186892
771 Ga0207711_10009532
772 Ga0207711_10084651
773 Ga0207711_10125269
774 Ga0207689_10045026
775 Ga0207679_10074436
776 Ga0207679_10086703
777 Ga0207679_10295698
778 Ga0207651_10010966
779 Ga0207651_10016938
780 Ga0207651_10062221
781 Ga0207651_10096228
782 Ga0207640_10005380
783 Ga0207658_10318291
784 Ga0207677_10143613
785 Ga0207703_10250174
786 Ga0207678_10145940
787 Ga0207708_10003077
788 Ga0207708_10005571
789 Ga0207708_10066250
790 Ga0207641_10068530
791 Ga0207648_10012086
792 Ga0207648_10037675
793 Ga0207648_10038661
794 Ga0207648_10053261
795 Ga0207676_10021053
796 Ga0207676_10031345
797 Ga0207676_10120132
798 Ga0207674_10063929
799 Ga0207675_100002748
800 Ga0207675_100016415
801 Ga0207675_100065806
802 Ga0207683_10013002
803 Ga0207683_10031802
804 Ga0207683_10053774
805 Ga0207683_10066900
806 Ga0207683_10135154
807 Ga0207698_10093953
808 Ga0207698_10112005
809 Ga0207698_10200522
810 Ga0207428_10044364
811 Ga0207428_10071758
812 Ga0268266_10132867
813 Ga0268264_10021284
814 Ga0268264_10235940
815 Ga0307408_100022485
816 Ga0307408_100035068
817 Ga0307405_10002774
818 Ga0307405_10017918
819 Ga0307413_10013483
820 Ga0307413_10224900
821 Ga0307410_10003204
822 Ga0307407_10005016
823 Ga0307407_10006769
824 Ga0307412_10010953
825 Ga0307412_10037532
826 Ga0307412_10059209
827 Ga0307409_100000434
828 Ga0307409_100041320
829 Ga0307409_100073639
830 Ga0307416_100013181
831 Ga0307416_100083929
832 Ga0307416_100245033
833 Ga0307414_10002556
834 Ga0307414_10054114
835 Ga0307414_10116272
836 Ga0307411_10006713
837 Ga0307411_10009612
838 Ga0307411_10139461
839 Ga0307415_100006193
840 Ga0307415_100011545
841 Ga0307415_100019532
842 Ga0373930_0000051
843 Ga0373938_0001007
844 Ga0373928_0000359
845 Ga0373949_0001939
846 Ga0373951_0000500
847 Ga0373952_0002258
848 Ga0373923_0050037
849 Ga0373932_0000133
850 Ga0373939_0000672
851 Ga0373960_0000368
852 Ga0373943_0074685
853 Ga0373946_0007368
854 Ga0373955_0063825
855 Ga0373942_0000431
856 Ga0373961_0002516
857 Ga0373961_0017458
858 Ga0373962_0009914
859 Ga0373924_0002319
860 Ga0373935_0081360
861 Ga0373933_0085804
862 Ga0373937_0001133
863 Ga0373937_0111638
864 Ga0373937_0189155
865 Ga0373925_0003703
866 Ga0395900_0357797
867 Ga0451853_1777107
868 Ga0439435_0003774
869 Ga0439435_0017586
870 Ga0451577_0023942
871 Ga0453684_0131509
872 Ga0453684_0340461
873 Ga0451576_0003826
874 Ga0451576_0027721
875 Ga0451576_0380280
876 Ga0451576_0482339
877 Ga0495592_0133645
878 Ga0495603_0161450
879 Ga0495629_0015813
880 Ga0495580_0201920
881 Ga0495582_0026932
882 Ga0495664_0158085
883 Ga0495594_0006673
884 Ga0495608_0187613
885 Ga0495630_0044379
886 Ga0495643_0003205
887 Ga0495586_0040243
888 Ga0495645_0001192
889 Ga0495645_0022921
890 Ga0495667_0109154
891 Ga0495659_0015211
892 Ga0495588_0014187
893 Ga0495658_0040668
894 Ga0495669_0009139
895 Ga0495613_0006752
896 Ga0495604_0022550
897 Ga0495674_0011154
898 Ga0495674_0163092
899 Ga0495684_0000226
900 Ga0496100_0039243
901 Ga0496101_0067820
902 Ga0496102_0031872
903 Ga0496102_0319257
904 Ga0496104_0052833
905 Ga0496104_0093155
906 Ga0496106_0030983
907 Ga0496109_0067626
908 Ga0496109_0189993
909 Ga0496109_0265278
910 Ga0496110_0008139
911 Ga0496111_0023805
912 Ga0496112_0074137
913 Ga0496114_0002704
914 Ga0496114_0201295
915 Ga0501034_0019831
916 Ga0501034_0025293
917 Ga0501034_0050614
918 Ga0501036_0066685
919 Ga0501036_0142156
920 Ga0501036_0252856
921 Ga0501038_0070855
922 Ga0501038_0078047
923 Ga0501039_0048666
924 Ga0501040_0006332
925 Ga0501040_0019732
926 Ga0501042_0007425
927 Ga0501042_0070464
928 Ga0501046_0012749
929 Ga0501046_0074614
930 Ga0501046_0119470
931 Ga0501046_0281441
932 Ga0501047_0016873
933 Ga0501047_0490604
934 Ga0501048_0011724
935 Ga0501070_0113305
936 Ga0501070_0220791
937 Ga0501071_0031721
938 Ga0501071_0163985
939 Ga0501072_0004635
940 Ga0501072_0103061
941 Ga0501072_0224861
942 Ga0501073_0000430
943 Ga0501073_0052080
944 Ga0501074_0031387
945 Ga0501074_0033712
946 Ga0501074_0065319
947 Ga0501075_0011992
948 Ga0501075_0072231
949 Ga0501075_0088918
950 Ga0501076_0016074
951 Ga0501076_0070683
952 Ga0501076_0086474
953 Ga0501076_0218818
954 Ga0501079_0062925
955 Ga0501080_0049026
956 Ga0501081_0004524
957 Ga0501083_0011901
958 Ga0501035_0046986
959 Ga0501044_0056356
960 Ga0501045_0037484
961 nmdc:mga00v17_15767_c1
962 nmdc:mga0k408_22797_c1
963 nmdc:mga05p37_116819_c1
964 nmdc:mga05p37_1310_c1
965 nmdc:mga05p37_16479_c1
966 nmdc:mga05p37_179337_c1
967 nmdc:mga05p37_20953_c1
968 nmdc:mga05p37_24643_c1
969 nmdc:mga05p37_30_c1
970 nmdc:mga05p37_395131_c1
971 nmdc:mga05p37_436292_c1
972 nmdc:mga05p37_82078_c1
973 nmdc:mga09592_13528_c1
974 nmdc:mga0qj67_147878_c1
975 nmdc:mga0qj67_15116_c1
976 nmdc:mga0qj67_87203_c1
977 nmdc:mga06r32_194695_c1
978 nmdc:mga06r32_329856_c1
979 nmdc:mga06r32_35368_c1
980 nmdc:mga06r32_506282_c1
981 nmdc:mga06r32_68068_c1
982 nmdc:mga08y16_26409_c1
983 nmdc:mga08y16_279067_c1
984 nmdc:mga08y16_305_c1
985 nmdc:mga08y16_3701_c1
986 nmdc:mga08y16_4483_c1
987 nmdc:mga08y16_45897_c1
988 nmdc:mga08y16_5411_c1
989 nmdc:mga08y16_64656_c1
990 nmdc:mga08y16_67083_c1
991 nmdc:mga08y16_67483_c1
992 nmdc:mga0n895_1599_c1
993 nmdc:mga0n895_207271_c1
994 nmdc:mga0n895_229_c1
995 nmdc:mga0n895_32329_c1
996 nmdc:mga0n895_345895_c1
997 nmdc:mga0n895_67048_c1
998 nmdc:mga0n895_91255_c1
999 nmdc:mga0rr50_10864_c1
1000 nmdc:mga0rr50_14_c1
1001 nmdc:mga0rr50_32704_c1
1002 nmdc:mga0rr50_35878_c1
1003 nmdc:mga0rr50_53379_c1
1004 nmdc:mga0rr50_689_c1
1005 nmdc:mga0rr50_78212_c1
1006 nmdc:mga08x19_235_c1
1007 nmdc:mga08x19_2793_c1
1008 nmdc:mga08x19_71847_c1
1009 nmdc:mga0a205_10223_c1
1010 nmdc:mga0a205_13823_c1
1011 nmdc:mga0a205_139331_c1
1012 nmdc:mga0a205_2077_c1
1013 nmdc:mga0a205_298567_c1
1014 Ga0495601_0008120
1015 Ga0495601_0180063
1016 Ga0495619_0003775
1017 Ga0495619_0017035
1018 Ga0500555_000445
1019 Ga0500616_0000158
1020 Ga0500645_000402
1021 Ga0501084_0003532
1022 Ga0501084_0042644
1023 Ga0501084_0057489
1024 Ga0501084_0327599
1025 Ga0590071_000043
1026 Ga0590074_001637
1027 Ga0590075_011767
1028 Ga0590075_021415
1029 Ga0590077_000159
1030 Ga0590077_003094
1031 Ga0501082_0023449
1032 Ga0501082_0152059
1033 Ga0501082_0250040
1034 Ga0530510_0004014
1035 Ga0530510_0082042
1036 Ga0530510_0106768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

32

84

0.89

PF01494

FAD_binding_3

FAD binding domain

104

232

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j0f-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p212121 space group 0.9961 35 62
7o1k-assembly1.cif.gz_A structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant 0.9752 35 64
7o1i-assembly1.cif.gz_A-2 structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a mutant 0.9606 35 64
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.9534 34 63
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9532 34 63
ID Description Score Start End Superfamily
af_A7YT47_359_542_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.999 35 64 3.40.50.720
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9951 35 63 3.40.50.720
4b3jB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9709 35 64 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9631 34 63 3.40.50.720
af_Q60E84_301_451_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9618 35 65 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A661XAR7-F1-model_v4 FAD-binding domain-containing protein 0.9184 31 237 GO:0071949
AF-A0A7K0YR28-F1-model_v4 Geranylgeranyl reductase family protein 0.8853 32 236 GO:0016628
GO:0071949
AF-A0A0U2WRP8-F1-model_v4 Monooxygenase FAD-binding protein 0.8784 33 413 GO:0004497
GO:0071949
AF-A0A7W0K8F2-F1-model_v4 FAD-dependent monooxygenase 0.8779 140 413 GO:0004497
GO:0071949
AF-A0A7W1PG21-F1-model_v4 FAD-dependent monooxygenase 0.8769 84 414 GO:0004497
GO:0071949

Map