F458172

General Info

Members Datasets Scaffolds Average Seq Length
517 298 1034 379

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0000220|Ga0496102_0000220_59612_60742
Length 376
Sequence MTPELEDLRDAVRRFIDSEITPHQQRFKEQQHVDRALWNKAGELGVLLADIPEQYGGSGGTFAHQCVVFEELGYAGDMAFGIHVHAIVAHYILNQGTEAQKRKYLPLLASGEMVGAIAMSEPGAGSDLKGIRTTAAAGKGDNGGYRVNGSKTFISNGYLADLILVVVKTDPNAGARGVSLLLLETKDNPGFRVGRILDKVGQKGQDTCELFFDGAHVPTENVLGGVEGQGFAQLMTELPYERTILGVTGVAAIERALKLTVEYTRERKAFGQALIEMQNTRFVLAEIKTEATIARIFIDRCIEDMIAGRMDTVQASMAKYWISDLQCKVVDQCVQLFGGYGYMLEYPIAQMYVDARVQRIYGGANEIMKEIIARAL

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
120 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
125 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
151 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
171 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
260 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
261 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
262 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
265 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
266 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
267 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
268 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
269 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
270 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
271 2643221556 Massilia sp. Root1485 Isolate Unclassified
272 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
273 2643221658 Variovorax sp. Root411 Isolate Unclassified
274 2643221672 Variovorax sp. Root434 Isolate Unclassified
275 2643221684 Massilia sp. Root133 Isolate Unclassified
276 2721755523 Delftia sp. HK171 Isolate Unclassified
277 2738541277 Variovorax sp. GV051 Isolate Unclassified
278 2738541307 Variovorax sp. GV008 Isolate Unclassified
279 2738543019 Variovorax sp. GV040 Isolate Unclassified
280 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
281 2818991446 Variovorax sp. 1180 Isolate Unclassified
282 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
283 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
284 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
285 2885198086 Variovorax sp. 679 Isolate Unclassified
286 2885211737 Variovorax sp. 553 Isolate Unclassified
287 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
288 2899924645 Variovorax sp. 369 Isolate Unclassified
289 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
290 2928037797 Variovorax sp. 1126 Isolate Unclassified
291 2928044640 Variovorax sp. 1128 Isolate Unclassified
292 2928051484 Variovorax sp. 1133 Isolate Unclassified
293 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
294 2928070936 Variovorax gossypii 1167 Isolate Unclassified
295 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
296 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
297 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
298 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 0.19
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.54
Nodule 1.93
Rhizoplane 3.87
Rhizosphere 67.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0000220 3300048905 Bacteria 75547
2 JGI25152J39213_1008597 3300002773 Bacteria 2518
3 JGI25150J39212_1001405 3300002774 Bacteria 6796
4 JGI25151J46595_10001530 3300003187 Bacteria 15453
5 JGI25151J46595_10002902 3300003187 Bacteria 9822
6 JGI25151J46595_10003256 3300003187 Bacteria 9031
7 JGI25160J50197_1001521 3300003354 Bacteria 11499
8 JGI25161J50226_1001622 3300003374 Bacteria 6531
9 Ga0006562J51391_1089035 3300003578 Bacteria 4790
10 Ga0055525_1000009 3300003759 Bacteria 596899
11 Ga0055535_1000289 3300003761 Bacteria 53058
12 Ga0055542_1000036 3300003762 Bacteria 227346
13 Ga0055526_1003439 3300003771 Bacteria 10049
14 Ga0055526_1006235 3300003771 Bacteria 6539
15 Ga0055537_1003054 3300003773 Bacteria 5278
16 Ga0055524_1000771 3300003775 Bacteria 21556
17 Ga0055524_1004361 3300003775 Bacteria 6539
18 Ga0055536_1002854 3300003781 Bacteria 9519
19 Ga0055534_1000063 3300003784 Bacteria 81542
20 Ga0055528_1000070 3300003790 Bacteria 81542
21 Ga0055528_1006539 3300003790 Bacteria 5278
22 Ga0055530_10000581 3300003791 Bacteria 31658
23 Ga0055530_10001245 3300003791 Bacteria 19396
24 Ga0055530_10003045 3300003791 Bacteria 10005
25 Ga0055540_1000173 3300003792 Bacteria 63434
26 Ga0055540_1000846 3300003792 Bacteria 20496
27 Ga0055531_10001130 3300003794 Bacteria 20640
28 Ga0055543_1006615 3300004625 Bacteria 2773
29 Ga0065165_1001179 3300005262 Bacteria 30342
30 Ga0065165_1003596 3300005262 Bacteria 10665
31 Ga0065704_10024074 3300005289 Bacteria 1810
32 Ga0065712_10079742 3300005290 Bacteria 3183
33 Ga0065715_10097032 3300005293 Bacteria 3774
34 Ga0070658_10021034 3300005327 Bacteria 5226
35 Ga0070670_100004704 3300005331 Bacteria 11455
36 Ga0070677_10005309 3300005333 Bacteria 4243
37 Ga0070668_100069400 3300005347 Bacteria 2741
38 Ga0070669_100030326 3300005353 Bacteria 3902
39 Ga0070669_100159761 3300005353 Bacteria 1750
40 Ga0070675_100001028 3300005354 Bacteria 20060
41 Ga0070671_100039358 3300005355 Bacteria 3924
42 Ga0070671_100121553 3300005355 Bacteria 2198
43 Ga0070674_100002691 3300005356 Bacteria 9829
44 Ga0070673_100002873 3300005364 Bacteria 10594
45 Ga0070667_100006144 3300005367 Bacteria 9978
46 Ga0070694_100055354 3300005444 Bacteria 2690
47 Ga0070662_100012264 3300005457 Bacteria 5676
48 Ga0070662_100086751 3300005457 Bacteria 2341
49 Ga0068867_100002600 3300005459 Bacteria 12728
50 Ga0068867_100011000 3300005459 Bacteria 6380
51 Ga0068853_100008120 3300005539 Bacteria 8425
52 Ga0070672_100001033 3300005543 Bacteria 16943
53 Ga0070672_100004165 3300005543 Bacteria 9442
54 Ga0068855_100055632 3300005563 Bacteria 4646
55 Ga0068855_100104789 3300005563 Bacteria 3253
56 Ga0068851_10007481 3300005834 Bacteria 5016
57 Ga0068862_100100238 3300005844 Bacteria 2533
58 Ga0075366_10023959 3300006195 Bacteria 3558
59 Ga0097621_100103614 3300006237 Bacteria 2397
60 Ga0075370_10000693 3300006353 Bacteria 13254
61 Ga0075370_10014319 3300006353 Bacteria 4230
62 Ga0068871_100133615 3300006358 Bacteria 2105
63 Ga0075428_100164721 3300006844 Bacteria 2405
64 Ga0075430_100008063 3300006846 Bacteria 8902
65 Ga0068865_100007039 3300006881 Bacteria 6903
66 Ga0079104_1000025 3300006946 Bacteria 218785
67 Ga0079104_1000294 3300006946 Bacteria 63150
68 Ga0099826_10000077 3300006948 Bacteria 51489
69 Ga0105244_10003127 3300009036 Bacteria 12057
70 Ga0111539_10011890 3300009094 Bacteria 10909
71 Ga0105243_10002241 3300009148 Bacteria 16253
72 Ga0105243_10007944 3300009148 Bacteria 8148
73 Ga0105243_10019541 3300009148 Bacteria 5136
74 Ga0105243_10043274 3300009148 Bacteria 3529
75 Ga0105241_10019464 3300009174 Bacteria 5006
76 Ga0105242_10209502 3300009176 Bacteria 1736
77 Ga0105238_10064361 3300009551 Bacteria 3667
78 Ga0157371_10075509 3300013102 Bacteria 2387
79 Ga0157370_10001911 3300013104 Bacteria 25636
80 Ga0157369_10033925 3300013105 Bacteria 5605
81 Ga0157374_10150705 3300013296 Bacteria 2261
82 Ga0163162_10086132 3300013306 Bacteria 3219
83 Ga0157372_10039064 3300013307 Bacteria 5239
84 Ga0157375_10106277 3300013308 Bacteria 2899
85 Ga0182008_10000332 3300014497 Bacteria 37231
86 Ga0182008_10002652 3300014497 Bacteria 11106
87 Ga0182008_10066845 3300014497 Bacteria 1769
88 Ga0157376_10052021 3300014969 Bacteria 3404
89 Ga0182006_1001149 3300015261 Bacteria 16762
90 Ga0182007_10001747 3300015262 Bacteria 11426
91 Ga0163161_10000244 3300017792 Bacteria 49165
92 Ga0213872_10000036 3300021361 Bacteria 129233
93 Ga0209672_100508 3300025228 Bacteria 21501
94 Ga0209147_100380 3300025229 Bacteria 30888
95 Ga0209563_100015 3300025230 Bacteria 879901
96 Ga0209258_100091 3300025242 Bacteria 227454
97 Ga0207425_1000183 3300025245 Bacteria 51638
98 Ga0207425_1005689 3300025245 Bacteria 3516
99 Ga0209677_100830 3300025253 Bacteria 15396
100 Ga0209148_1000033 3300025254 Bacteria 555508
101 Ga0209148_1000310 3300025254 Bacteria 69517
102 Ga0209129_1000091 3300025258 Bacteria 175716
103 Ga0209129_1000853 3300025258 Bacteria 19107
104 Ga0209129_1002459 3300025258 Bacteria 9072
105 Ga0209129_1003670 3300025258 Bacteria 6533
106 Ga0209565_1000130 3300025263 Bacteria 108121
107 Ga0209565_1000270 3300025263 Bacteria 52764
108 Ga0209565_1000822 3300025263 Bacteria 17647
109 Ga0209565_1002231 3300025263 Bacteria 7230
110 Ga0209565_1014449 3300025263 Bacteria 1813
111 Ga0209673_1000106 3300025273 Bacteria 185426
112 Ga0209673_1000154 3300025273 Bacteria 146394
113 Ga0209673_1001319 3300025273 Bacteria 24986
114 Ga0209673_1007185 3300025273 Bacteria 5197
115 Ga0209130_1000140 3300025284 Bacteria 115434
116 Ga0209130_1000203 3300025284 Bacteria 80023
117 Ga0209675_1000058 3300025291 Bacteria 185426
118 Ga0209675_1000447 3300025291 Bacteria 32004
119 Ga0209675_1002260 3300025291 Bacteria 10046
120 Ga0209675_1005069 3300025291 Bacteria 5629
121 Ga0209675_1012696 3300025291 Bacteria 2693
122 Ga0209676_1000088 3300025292 Bacteria 263010
123 Ga0209676_1000966 3300025292 Bacteria 34669
124 Ga0209676_1006871 3300025292 Bacteria 5506
125 Ga0209025_1000207 3300025294 Bacteria 140774
126 Ga0209025_1000244 3300025294 Bacteria 127938
127 Ga0209025_1000356 3300025294 Bacteria 98547
128 Ga0209025_1001327 3300025294 Bacteria 33484
129 Ga0209025_1002931 3300025294 Bacteria 16979
130 Ga0209025_1013396 3300025294 Bacteria 5158
131 Ga0209564_1000103 3300025295 Bacteria 221166
132 Ga0209564_1000530 3300025295 Bacteria 62121
133 Ga0209758_1000092 3300025297 Bacteria 241910
134 Ga0209758_1004583 3300025297 Bacteria 11388
135 Ga0209758_1005932 3300025297 Bacteria 9074
136 Ga0209050_1000110 3300025298 Bacteria 216664
137 Ga0209050_1000916 3300025298 Bacteria 38869
138 Ga0209050_1000983 3300025298 Bacteria 36304
139 Ga0209050_1010828 3300025298 Bacteria 4427
140 Ga0209050_1011823 3300025298 Bacteria 4083
141 Ga0209256_1000036 3300025299 Bacteria 386664
142 Ga0209256_1000065 3300025299 Bacteria 248104
143 Ga0209256_1000094 3300025299 Bacteria 208177
144 Ga0207426_1000084 3300025302 Bacteria 298123
145 Ga0207426_1000124 3300025302 Bacteria 218145
146 Ga0209051_1000069 3300025303 Bacteria 219208
147 Ga0209051_1000379 3300025303 Bacteria 63486
148 Ga0209051_1000685 3300025303 Bacteria 37585
149 Ga0209257_1000093 3300025304 Bacteria 263088
150 Ga0209257_1000141 3300025304 Bacteria 201130
151 Ga0209257_1000575 3300025304 Bacteria 61759
152 Ga0209257_1002147 3300025304 Bacteria 20535
153 Ga0207697_10016154 3300025315 Bacteria 3078
154 Ga0207655_1001639 3300025728 Bacteria 19857
155 Ga0207682_10001251 3300025893 Bacteria 11736
156 Ga0207680_10096101 3300025903 Bacteria 1895
157 Ga0207645_10000882 3300025907 Bacteria 24904
158 Ga0207645_10121357 3300025907 Bacteria 1696
159 Ga0207643_10005642 3300025908 Bacteria 6690
160 Ga0207654_10011377 3300025911 Bacteria 4539
161 Ga0207649_10181701 3300025920 Bacteria 1473
162 Ga0207681_10051620 3300025923 Bacteria 2786
163 Ga0207694_10200741 3300025924 Bacteria 1622
164 Ga0207650_10001012 3300025925 Bacteria 21110
165 Ga0207659_10001055 3300025926 Bacteria 16343
166 Ga0207644_10089505 3300025931 Bacteria 2291
167 Ga0207706_10004566 3300025933 Bacteria 12995
168 Ga0207706_10005643 3300025933 Bacteria 11659
169 Ga0207709_10000159 3300025935 Bacteria 91803
170 Ga0207709_10000740 3300025935 Bacteria 25909
171 Ga0207709_10001906 3300025935 Bacteria 13754
172 Ga0207709_10061810 3300025935 Bacteria 2342
173 Ga0207669_10008500 3300025937 Bacteria 4823
174 Ga0207704_10112583 3300025938 Bacteria 1843
175 Ga0207691_10002053 3300025940 Bacteria 19685
176 Ga0207691_10003721 3300025940 Bacteria 14797
177 Ga0207691_10027526 3300025940 Bacteria 5328
178 Ga0207691_10126267 3300025940 Bacteria 2263
179 Ga0207689_10136701 3300025942 Bacteria 2018
180 Ga0207679_10002533 3300025945 Bacteria 11260
181 Ga0207667_10036690 3300025949 Bacteria 5249
182 Ga0207667_10195237 3300025949 Bacteria 2077
183 Ga0207651_10007642 3300025960 Bacteria 5771
184 Ga0207668_10065687 3300025972 Bacteria 2569
185 Ga0207658_10229569 3300025986 Bacteria 1566
186 Ga0207648_10002575 3300026089 Bacteria 19427
187 Ga0207676_10011673 3300026095 Bacteria 6284
188 Ga0207683_10016157 3300026121 Bacteria 6353
189 Ga0209281_1000007 3300027111 Bacteria 938265
190 Ga0209281_1000423 3300027111 Bacteria 63126
191 Ga0209982_1001062 3300027552 Bacteria 3659
192 Ga0209970_1007651 3300027614 Bacteria 1771
193 Ga0210002_1000336 3300027617 Bacteria 6445
194 Ga0209983_1007331 3300027665 Bacteria 2261
195 Ga0209282_1000223 3300027666 Bacteria 29527
196 Ga0209998_10000573 3300027717 Bacteria 9893
197 Ga0268265_10059714 3300028380 Bacteria 2919
198 Ga0265338_10127474 3300028800 Bacteria 2017
199 Ga0316177_1053015 3300030731 Bacteria 7911
200 Ga0265328_10017566 3300031239 Bacteria 2770
201 Ga0265327_10000178 3300031251 Bacteria 135732
202 Ga0265327_10001131 3300031251 Bacteria 36638
203 Ga0307408_100089111 3300031548 Bacteria 2325
204 Ga0307410_10038399 3300031852 Bacteria 3136
205 Ga0307410_10113280 3300031852 Bacteria 1966
206 Ga0307406_10005704 3300031901 Bacteria 6816
207 Ga0307412_10004356 3300031911 Bacteria 7893
208 Ga0307409_100001827 3300031995 Bacteria 10808
209 Ga0307416_100042429 3300032002 Bacteria 3551
210 Ga0307414_10007017 3300032004 Bacteria 6313
211 Ga0307411_10000366 3300032005 Bacteria 15314
212 Ga0373955_0060595 3300035172 Bacteria 2088
213 Ga0373935_0101910 3300035692 Bacteria 1894
214 Ga0373937_0001606 3300036401 Bacteria 18984
215 Ga0395899_0002181 3300037312 Bacteria 16076
216 Ga0395899_0005496 3300037312 Bacteria 9819
217 Ga0395900_0000729 3300037418 Bacteria 43752
218 Ga0395900_0013154 3300037418 Bacteria 8456
219 Ga0395900_0073997 3300037418 Bacteria 3503
220 Ga0395900_0091418 3300037418 Bacteria 3127
221 Ga0395900_0124103 3300037418 Bacteria 2648
222 Ga0395898_0014471 3300037466 Bacteria 8103
223 Ga0395898_0051762 3300037466 Bacteria 4014
224 Ga0395898_0097771 3300037466 Bacteria 2819
225 Ga0395898_0248803 3300037466 Bacteria 1695
226 Ga0395898_0265369 3300037466 Bacteria 1637
227 Ga0395898_0434077 3300037466 Bacteria 1251
228 Ga0395905_0001374 3300037471 Bacteria 29523
229 Ga0395905_0016632 3300037471 Bacteria 6992
230 Ga0395905_0020360 3300037471 Bacteria 6284
231 Ga0395905_0085132 3300037471 Bacteria 2962
232 Ga0395905_0131539 3300037471 Bacteria 2353
233 Ga0395901_0069688 3300038443 Bacteria 3662
234 Ga0395901_0103554 3300038443 Bacteria 2986
235 Ga0395901_0295949 3300038443 Bacteria 1678
236 Ga0436360_0819426 3300039438 Bacteria 1605
237 Ga0436361_0136966 3300039447 Bacteria 21375
238 Ga0436362_0178613 3300039453 Bacteria 1939
239 Ga0450911_002864 3300042115 Bacteria 3219
240 Ga0450904_000065 3300042139 Bacteria 23701
241 Ga0439458_0009004 3300042157 Bacteria 2226
242 Ga0451577_0012774 3300042876 Bacteria 7878
243 Ga0466969_0054802 3300044656 Bacteria 1952
244 Ga0466972_0004271 3300044658 Bacteria 7137
245 Ga0466965_0004221 3300044683 Bacteria 6384
246 Ga0466965_0024640 3300044683 Bacteria 2911
247 Ga0466965_0151537 3300044683 Bacteria 1212
248 Ga0466961_0048054 3300044693 Bacteria 2727
249 Ga0466964_0020142 3300044706 Bacteria 2567
250 Ga0466964_0031898 3300044706 Bacteria 2091
251 Ga0453684_0019345 3300044712 Bacteria 10372
252 Ga0453684_0049806 3300044712 Bacteria 5518
253 Ga0466971_0101180 3300044719 Bacteria 1324
254 Ga0466968_0014824 3300044735 Bacteria 3084
255 Ga0466957_0001605 3300044842 Bacteria 11870
256 Ga0466960_0037200 3300044901 Bacteria 2283
257 Ga0451576_0025438 3300045051 Bacteria 6376
258 Ga0466958_0022291 3300045836 Bacteria 3708
259 Ga0466958_0066609 3300045836 Bacteria 2199
260 Ga0466967_0032697 3300045976 Bacteria 4396
261 Ga0495617_002907 3300046452 Bacteria 6584
262 Ga0495627_005096 3300046453 Bacteria 5368
263 Ga0495627_005254 3300046453 Bacteria 5251
264 Ga0495603_0011247 3300046455 Bacteria 5421
265 Ga0495590_0000007 3300046457 Bacteria 331108
266 Ga0495590_0021610 3300046457 Bacteria 2280
267 Ga0495591_000039 3300046458 Bacteria 156460
268 Ga0495629_0014496 3300046459 Bacteria 5672
269 Ga0495638_0003255 3300046460 Bacteria 12816
270 Ga0495638_0087331 3300046460 Bacteria 1884
271 Ga0495650_0006474 3300046471 Bacteria 7284
272 Ga0495650_0023353 3300046471 Bacteria 2946
273 Ga0495605_0000085 3300046474 Bacteria 121011
274 Ga0495605_0007201 3300046474 Bacteria 6328
275 Ga0495605_0045164 3300046474 Bacteria 2172
276 Ga0495605_0071772 3300046474 Bacteria 1634
277 Ga0495584_0000022 3300046491 Bacteria 128471
278 Ga0495584_0000160 3300046491 Bacteria 47133
279 Ga0495584_0000282 3300046491 Bacteria 35813
280 Ga0495584_0001939 3300046491 Bacteria 11899
281 Ga0495584_0006959 3300046491 Bacteria 5906
282 Ga0495584_0020143 3300046491 Bacteria 3389
283 Ga0495585_0000004 3300046492 Bacteria 348260
284 Ga0495585_0000172 3300046492 Bacteria 69900
285 Ga0495585_0000398 3300046492 Bacteria 42060
286 Ga0495585_0019987 3300046492 Bacteria 3852
287 Ga0495585_0033540 3300046492 Bacteria 2905
288 Ga0495585_0033991 3300046492 Bacteria 2882
289 Ga0495594_0030182 3300046499 Bacteria 2931
290 Ga0495596_0000186 3300046500 Bacteria 43253
291 Ga0495596_0000686 3300046500 Bacteria 21047
292 Ga0495596_0003028 3300046500 Bacteria 8701
293 Ga0495596_0003609 3300046500 Bacteria 7778
294 Ga0495596_0011499 3300046500 Bacteria 3816
295 Ga0495607_0001053 3300046501 Bacteria 25182
296 Ga0495607_0005317 3300046501 Bacteria 9256
297 Ga0495607_0009832 3300046501 Bacteria 6455
298 Ga0495607_0070596 3300046501 Bacteria 1951
299 Ga0495583_0000257 3300046506 Bacteria 87964
300 Ga0495583_0000442 3300046506 Bacteria 62158
301 Ga0495583_0002083 3300046506 Bacteria 18045
302 Ga0495583_0006453 3300046506 Bacteria 7667
303 Ga0495583_0025616 3300046506 Bacteria 2943
304 Ga0495583_0028927 3300046506 Bacteria 2717
305 Ga0495583_0088387 3300046506 Bacteria 1337
306 Ga0495606_0005965 3300046507 Bacteria 11428
307 Ga0495606_0011250 3300046507 Bacteria 7322
308 Ga0495606_0013467 3300046507 Bacteria 6456
309 Ga0495606_0030661 3300046507 Bacteria 3753
310 Ga0495606_0040540 3300046507 Bacteria 3130
311 Ga0495606_0067110 3300046507 Bacteria 2272
312 Ga0495610_0003618 3300046512 Bacteria 11926
313 Ga0495616_0000127 3300046513 Bacteria 66628
314 Ga0495616_0000145 3300046513 Bacteria 62415
315 Ga0495616_0002100 3300046513 Bacteria 13389
316 Ga0495616_0003135 3300046513 Bacteria 10682
317 Ga0495616_0064411 3300046513 Bacteria 1788
318 Ga0495620_0004327 3300046515 Bacteria 8025
319 Ga0495631_0002994 3300046518 Bacteria 9347
320 Ga0495631_0011559 3300046518 Bacteria 4338
321 Ga0495631_0019069 3300046518 Bacteria 3221
322 Ga0495631_0041154 3300046518 Bacteria 2045
323 Ga0495631_0058771 3300046518 Bacteria 1672
324 Ga0495632_0000669 3300046519 Bacteria 31343
325 Ga0495632_0003042 3300046519 Bacteria 12206
326 Ga0495632_0004184 3300046519 Bacteria 9873
327 Ga0495632_0054438 3300046519 Bacteria 1961
328 Ga0495637_0000006 3300046520 Bacteria 435763
329 Ga0495643_0000183 3300046522 Bacteria 100113
330 Ga0495644_0006591 3300046523 Bacteria 4499
331 Ga0495644_0069579 3300046523 Bacteria 1322
332 Ga0495648_0000044 3300046524 Bacteria 175587
333 Ga0495648_0007342 3300046524 Bacteria 8828
334 Ga0495648_0022157 3300046524 Bacteria 4382
335 Ga0495648_0035839 3300046524 Bacteria 3211
336 Ga0495648_0102060 3300046524 Bacteria 1581
337 Ga0495663_0003407 3300046525 Bacteria 4589
338 Ga0495663_0004300 3300046525 Bacteria 4014
339 Ga0495642_0000542 3300046528 Bacteria 19018
340 Ga0495642_0000705 3300046528 Bacteria 16617
341 Ga0495642_0018330 3300046528 Bacteria 2740
342 Ga0495654_0003148 3300046530 Bacteria 10236
343 Ga0495654_0013161 3300046530 Bacteria 4431
344 Ga0495654_0096048 3300046530 Bacteria 1370
345 Ga0495640_0221113 3300046533 Bacteria 1194
346 Ga0495609_0000002 3300046538 Bacteria 739816
347 Ga0495609_0002681 3300046538 Bacteria 10754
348 Ga0495609_0010729 3300046538 Bacteria 4383
349 Ga0495609_0013676 3300046538 Bacteria 3829
350 Ga0495609_0017340 3300046538 Bacteria 3343
351 Ga0495609_0024555 3300046538 Bacteria 2765
352 Ga0495609_0049324 3300046538 Bacteria 1879
353 Ga0495621_0031026 3300046539 Bacteria 1831
354 Ga0495597_0002413 3300046542 Bacteria 11894
355 Ga0495597_0025604 3300046542 Bacteria 2715
356 Ga0495645_0062380 3300046543 Bacteria 2700
357 Ga0495633_0002260 3300046558 Bacteria 13787
358 Ga0495633_0002302 3300046558 Bacteria 13615
359 Ga0495633_0005644 3300046558 Bacteria 7584
360 Ga0495633_0013664 3300046558 Bacteria 4269
361 Ga0495633_0030826 3300046558 Bacteria 2603
362 Ga0495656_0003616 3300046615 Bacteria 5238
363 Ga0495668_0004411 3300046616 Bacteria 10005
364 Ga0495668_0006449 3300046616 Bacteria 7679
365 Ga0495668_0018461 3300046616 Bacteria 4030
366 Ga0495668_0024602 3300046616 Bacteria 3424
367 Ga0495611_0030488 3300046648 Bacteria 2371
368 Ga0495611_0058685 3300046648 Bacteria 1745
369 Ga0495625_0156084 3300046660 Bacteria 1531
370 Ga0495661_0000271 3300046665 Bacteria 59543
371 Ga0495661_0002644 3300046665 Bacteria 13711
372 Ga0495661_0011473 3300046665 Bacteria 6013
373 Ga0495661_0024666 3300046665 Bacteria 3892
374 Ga0495661_0031507 3300046665 Bacteria 3363
375 Ga0495588_0000135 3300046674 Bacteria 117387
376 Ga0495588_0004836 3300046674 Bacteria 5966
377 Ga0495588_0024376 3300046674 Bacteria 3005
378 Ga0495588_0027063 3300046674 Bacteria 2865
379 Ga0495657_0025278 3300046675 Bacteria 4221
380 Ga0495623_0039623 3300046679 Bacteria 3010
381 Ga0495669_0001801 3300046684 Bacteria 8754
382 Ga0495669_0015305 3300046684 Bacteria 3285
383 Ga0495613_0074676 3300046689 Bacteria 2469
384 Ga0495624_0017524 3300046690 Bacteria 4807
385 Ga0495670_0000327 3300046691 Bacteria 22730
386 Ga0495670_0035321 3300046691 Bacteria 2491
387 Ga0495670_0115694 3300046691 Bacteria 1390
388 Ga0495671_0006547 3300046692 Bacteria 6719
389 Ga0495671_0007982 3300046692 Bacteria 5983
390 Ga0495671_0035645 3300046692 Bacteria 2525
391 Ga0495589_0000030 3300046794 Bacteria 170254
392 Ga0495589_0000146 3300046794 Bacteria 65628
393 Ga0495589_0000700 3300046794 Bacteria 21833
394 Ga0495600_0104142 3300046809 Bacteria 1849
395 Ga0495660_0000103 3300046810 Bacteria 91169
396 Ga0495660_0046121 3300046810 Bacteria 2390
397 Ga0495581_0027790 3300047315 Bacteria 3281
398 Ga0495604_0003298 3300047317 Bacteria 12886
399 Ga0495604_0095681 3300047317 Bacteria 2193
400 Ga0495636_0030701 3300047318 Bacteria 2198
401 Ga0495674_0001746 3300047319 Bacteria 21389
402 Ga0495672_0000118 3300047320 Bacteria 124396
403 Ga0495672_0002945 3300047320 Bacteria 15006
404 Ga0495672_0005158 3300047320 Bacteria 10426
405 Ga0495672_0068721 3300047320 Bacteria 2013
406 Ga0495672_0087474 3300047320 Bacteria 1720
407 Ga0495683_0000492 3300047323 Bacteria 30566
408 Ga0495683_0001944 3300047323 Bacteria 12907
409 Ga0495683_0006662 3300047323 Bacteria 6295
410 Ga0495683_0020196 3300047323 Bacteria 3438
411 Ga0495683_0065714 3300047323 Bacteria 1788
412 Ga0495683_0079323 3300047323 Bacteria 1603
413 Ga0495687_000047 3300047443 Bacteria 206452
414 Ga0495687_000112 3300047443 Bacteria 124725
415 Ga0495687_003286 3300047443 Bacteria 11899
416 Ga0495675_0024662 3300047444 Bacteria 3835
417 Ga0495677_0000044 3300047445 Bacteria 74340
418 Ga0495677_0002379 3300047445 Bacteria 7392
419 Ga0495677_0004766 3300047445 Bacteria 5169
420 Ga0495679_009052 3300047446 Bacteria 4011
421 Ga0495681_0000860 3300047470 Bacteria 23362
422 Ga0495681_0006816 3300047470 Bacteria 7427
423 Ga0495593_0050629 3300047673 Bacteria 2200
424 Ga0495602_0011830 3300048088 Bacteria 9010
425 Ga0495626_0000006 3300048091 Bacteria 284977
426 Ga0495626_0000266 3300048091 Bacteria 59029
427 Ga0495626_0001873 3300048091 Bacteria 15758
428 Ga0495626_0006582 3300048091 Bacteria 6588
429 Ga0496100_0219910 3300048903 Bacteria 1393
430 Ga0496101_0319156 3300048904 Bacteria 1219
431 Ga0496102_0000074 3300048905 Bacteria 148938
432 Ga0496102_0000508 3300048905 Bacteria 42696
433 Ga0496102_0011405 3300048905 Bacteria 7659
434 Ga0496102_0086422 3300048905 Bacteria 2896
435 Ga0496103_0124198 3300048906 Bacteria 1645
436 Ga0496104_0287479 3300048907 Bacteria 1557
437 Ga0496106_0008808 3300048909 Bacteria 7456
438 Ga0496107_0155437 3300048910 Bacteria 1693
439 Ga0496110_0000369 3300048913 Bacteria 30095
440 Ga0496110_0144897 3300048913 Bacteria 2148
441 Ga0496113_0115572 3300048916 Bacteria 2093
442 Ga0496114_0008112 3300048917 Bacteria 8320
443 Ga0496114_0159456 3300048917 Bacteria 1961
444 Ga0496115_0086807 3300048918 Bacteria 2553
445 Ga0496117_0013588 3300048920 Bacteria 7090
446 Ga0496117_0013627 3300048920 Bacteria 7080
447 Ga0496118_0005148 3300048921 Bacteria 14990
448 Ga0496118_0030110 3300048921 Bacteria 4539
449 Ga0496121_0003212 3300048924 Bacteria 23519
450 Ga0496121_0117414 3300048924 Bacteria 2016
451 Ga0496122_0012026 3300048925 Bacteria 8676
452 Ga0496123_0005152 3300048926 Bacteria 13304
453 Ga0496123_0066829 3300048926 Bacteria 2275
454 Ga0496124_0013346 3300048927 Bacteria 8027
455 Ga0496124_0084102 3300048927 Bacteria 2610
456 Ga0496124_0193375 3300048927 Bacteria 1554
457 Ga0496125_0001798 3300048928 Bacteria 29631
458 Ga0496125_0003328 3300048928 Bacteria 19628
459 Ga0496125_0016244 3300048928 Bacteria 7156
460 Ga0496125_0036527 3300048928 Bacteria 4287
461 Ga0496125_0057178 3300048928 Bacteria 3161
462 Ga0496126_0025019 3300048929 Bacteria 5754
463 Ga0496126_0201639 3300048929 Bacteria 1680
464 Ga0495678_000113 3300049459 Bacteria 96866
465 Ga0495678_011861 3300049459 Bacteria 4155
466 Ga0495682_0053393 3300049460 Bacteria 1467
467 Ga0501039_0155410 3300049575 Bacteria 1797
468 Ga0501075_0145638 3300049591 Bacteria 1805
469 Ga0501081_0035566 3300049743 Bacteria 3391
470 Ga0501044_0140724 3300049823 Bacteria 2401
471 Ga0501045_0008406 3300049824 Bacteria 7195
472 nmdc:mga07m45_2812_c1 3300050496 Bacteria 8235
473 nmdc:mga07m45_6121_c1 3300050496 Bacteria 6063
474 nmdc:mga07m45_70985_c1 3300050496 Bacteria 1981
475 nmdc:mga07m45_840_c1 3300050496 Bacteria 13313
476 nmdc:mga06r32_55041_c1 3300050510 Bacteria 3816
477 nmdc:mga08y16_183830_c1 3300050511 Bacteria 2170
478 Ga0500571_000935 3300053110 Bacteria 12820
479 Ga0500593_001648 3300053117 Bacteria 8049
480 Ga0500607_009515 3300053121 Bacteria 5841
481 Ga0500608_001188 3300053122 Bacteria 9292
482 Ga0500634_0031818 3300053161 Bacteria 2879
483 Ga0530510_0077980 3300061734 Bacteria 2408
484 2513721386 2513237104 Bacteria 10034502
485 2524442595 2524023205 Bacteria 8918781
486 2599626210 2599185214 Bacteria 8209958
487 2599675849 2599185226 Bacteria 8233575
488 2599682267 2599185227 Bacteria 8246414
489 2599695918 2599185229 Bacteria 8216126
490 2643797837 2643221556 Bacteria 7251154
491 2644029213 2643221603 Bacteria 6147767
492 2644326812 2643221658 Bacteria 6064537
493 2644399931 2643221672 Bacteria 6322190
494 2644473015 2643221684 Bacteria 7145183
495 2722882686 2721755523 Bacteria 6430384
496 2738721506 2738541277 Bacteria 7458140
497 2738880849 2738541307 Bacteria 8606193
498 2739281175 2738543019 Bacteria 7459457
499 2745074689 2744054633 Bacteria 8678936
500 2819601484 2818991446 Bacteria 7757362
501 2831272250 2831265667 Bacteria 7184833
502 2838059416 2838054893 Bacteria 7451788
503 2839142931 2839138175 Bacteria 6549354
504 2885202841 2885198086 Bacteria 7212419
505 2885216762 2885211737 Bacteria 7212420
506 2894025089 2894023352 Bacteria 5167372
507 2899930969 2899924645 Bacteria 7487985
508 2904544190 2904541872 Bacteria 8915136
509 2928040796 2928037797 Bacteria 7273642
510 2928047638 2928044640 Bacteria 7271509
511 2928055416 2928051484 Bacteria 7773759
512 2928069519 2928064002 Bacteria 7419480
513 2928075540 2928070936 Bacteria 8062541
514 2929162238 2929160207 Bacteria 9075316
515 2945909614 2945909444 Bacteria 7065066
516 2945988410 2945984333 Bacteria 7358892
517 8047677837 8047673197 Bacteria 7395230
518 Ga0496102_0000220
519 JGI25152J39213_1008597
520 JGI25150J39212_1001405
521 JGI25151J46595_10001530
522 JGI25151J46595_10002902
523 JGI25151J46595_10003256
524 JGI25160J50197_1001521
525 JGI25161J50226_1001622
526 Ga0006562J51391_1089035
527 Ga0055525_1000009
528 Ga0055535_1000289
529 Ga0055542_1000036
530 Ga0055526_1003439
531 Ga0055526_1006235
532 Ga0055537_1003054
533 Ga0055524_1000771
534 Ga0055524_1004361
535 Ga0055536_1002854
536 Ga0055534_1000063
537 Ga0055528_1000070
538 Ga0055528_1006539
539 Ga0055530_10000581
540 Ga0055530_10001245
541 Ga0055530_10003045
542 Ga0055540_1000173
543 Ga0055540_1000846
544 Ga0055531_10001130
545 Ga0055543_1006615
546 Ga0065165_1001179
547 Ga0065165_1003596
548 Ga0065704_10024074
549 Ga0065712_10079742
550 Ga0065715_10097032
551 Ga0070658_10021034
552 Ga0070670_100004704
553 Ga0070677_10005309
554 Ga0070668_100069400
555 Ga0070669_100030326
556 Ga0070669_100159761
557 Ga0070675_100001028
558 Ga0070671_100039358
559 Ga0070671_100121553
560 Ga0070674_100002691
561 Ga0070673_100002873
562 Ga0070667_100006144
563 Ga0070694_100055354
564 Ga0070662_100012264
565 Ga0070662_100086751
566 Ga0068867_100002600
567 Ga0068867_100011000
568 Ga0068853_100008120
569 Ga0070672_100001033
570 Ga0070672_100004165
571 Ga0068855_100055632
572 Ga0068855_100104789
573 Ga0068851_10007481
574 Ga0068862_100100238
575 Ga0075366_10023959
576 Ga0097621_100103614
577 Ga0075370_10000693
578 Ga0075370_10014319
579 Ga0068871_100133615
580 Ga0075428_100164721
581 Ga0075430_100008063
582 Ga0068865_100007039
583 Ga0079104_1000025
584 Ga0079104_1000294
585 Ga0099826_10000077
586 Ga0105244_10003127
587 Ga0111539_10011890
588 Ga0105243_10002241
589 Ga0105243_10007944
590 Ga0105243_10019541
591 Ga0105243_10043274
592 Ga0105241_10019464
593 Ga0105242_10209502
594 Ga0105238_10064361
595 Ga0157371_10075509
596 Ga0157370_10001911
597 Ga0157369_10033925
598 Ga0157374_10150705
599 Ga0163162_10086132
600 Ga0157372_10039064
601 Ga0157375_10106277
602 Ga0182008_10000332
603 Ga0182008_10002652
604 Ga0182008_10066845
605 Ga0157376_10052021
606 Ga0182006_1001149
607 Ga0182007_10001747
608 Ga0163161_10000244
609 Ga0213872_10000036
610 Ga0209672_100508
611 Ga0209147_100380
612 Ga0209563_100015
613 Ga0209258_100091
614 Ga0207425_1000183
615 Ga0207425_1005689
616 Ga0209677_100830
617 Ga0209148_1000033
618 Ga0209148_1000310
619 Ga0209129_1000091
620 Ga0209129_1000853
621 Ga0209129_1002459
622 Ga0209129_1003670
623 Ga0209565_1000130
624 Ga0209565_1000270
625 Ga0209565_1000822
626 Ga0209565_1002231
627 Ga0209565_1014449
628 Ga0209673_1000106
629 Ga0209673_1000154
630 Ga0209673_1001319
631 Ga0209673_1007185
632 Ga0209130_1000140
633 Ga0209130_1000203
634 Ga0209675_1000058
635 Ga0209675_1000447
636 Ga0209675_1002260
637 Ga0209675_1005069
638 Ga0209675_1012696
639 Ga0209676_1000088
640 Ga0209676_1000966
641 Ga0209676_1006871
642 Ga0209025_1000207
643 Ga0209025_1000244
644 Ga0209025_1000356
645 Ga0209025_1001327
646 Ga0209025_1002931
647 Ga0209025_1013396
648 Ga0209564_1000103
649 Ga0209564_1000530
650 Ga0209758_1000092
651 Ga0209758_1004583
652 Ga0209758_1005932
653 Ga0209050_1000110
654 Ga0209050_1000916
655 Ga0209050_1000983
656 Ga0209050_1010828
657 Ga0209050_1011823
658 Ga0209256_1000036
659 Ga0209256_1000065
660 Ga0209256_1000094
661 Ga0207426_1000084
662 Ga0207426_1000124
663 Ga0209051_1000069
664 Ga0209051_1000379
665 Ga0209051_1000685
666 Ga0209257_1000093
667 Ga0209257_1000141
668 Ga0209257_1000575
669 Ga0209257_1002147
670 Ga0207697_10016154
671 Ga0207655_1001639
672 Ga0207682_10001251
673 Ga0207680_10096101
674 Ga0207645_10000882
675 Ga0207645_10121357
676 Ga0207643_10005642
677 Ga0207654_10011377
678 Ga0207649_10181701
679 Ga0207681_10051620
680 Ga0207694_10200741
681 Ga0207650_10001012
682 Ga0207659_10001055
683 Ga0207644_10089505
684 Ga0207706_10004566
685 Ga0207706_10005643
686 Ga0207709_10000159
687 Ga0207709_10000740
688 Ga0207709_10001906
689 Ga0207709_10061810
690 Ga0207669_10008500
691 Ga0207704_10112583
692 Ga0207691_10002053
693 Ga0207691_10003721
694 Ga0207691_10027526
695 Ga0207691_10126267
696 Ga0207689_10136701
697 Ga0207679_10002533
698 Ga0207667_10036690
699 Ga0207667_10195237
700 Ga0207651_10007642
701 Ga0207668_10065687
702 Ga0207658_10229569
703 Ga0207648_10002575
704 Ga0207676_10011673
705 Ga0207683_10016157
706 Ga0209281_1000007
707 Ga0209281_1000423
708 Ga0209982_1001062
709 Ga0209970_1007651
710 Ga0210002_1000336
711 Ga0209983_1007331
712 Ga0209282_1000223
713 Ga0209998_10000573
714 Ga0268265_10059714
715 Ga0265338_10127474
716 Ga0316177_1053015
717 Ga0265328_10017566
718 Ga0265327_10000178
719 Ga0265327_10001131
720 Ga0307408_100089111
721 Ga0307410_10038399
722 Ga0307410_10113280
723 Ga0307406_10005704
724 Ga0307412_10004356
725 Ga0307409_100001827
726 Ga0307416_100042429
727 Ga0307414_10007017
728 Ga0307411_10000366
729 Ga0373955_0060595
730 Ga0373935_0101910
731 Ga0373937_0001606
732 Ga0395899_0002181
733 Ga0395899_0005496
734 Ga0395900_0000729
735 Ga0395900_0013154
736 Ga0395900_0073997
737 Ga0395900_0091418
738 Ga0395900_0124103
739 Ga0395898_0014471
740 Ga0395898_0051762
741 Ga0395898_0097771
742 Ga0395898_0248803
743 Ga0395898_0265369
744 Ga0395898_0434077
745 Ga0395905_0001374
746 Ga0395905_0016632
747 Ga0395905_0020360
748 Ga0395905_0085132
749 Ga0395905_0131539
750 Ga0395901_0069688
751 Ga0395901_0103554
752 Ga0395901_0295949
753 Ga0436360_0819426
754 Ga0436361_0136966
755 Ga0436362_0178613
756 Ga0450911_002864
757 Ga0450904_000065
758 Ga0439458_0009004
759 Ga0451577_0012774
760 Ga0466969_0054802
761 Ga0466972_0004271
762 Ga0466965_0004221
763 Ga0466965_0024640
764 Ga0466965_0151537
765 Ga0466961_0048054
766 Ga0466964_0020142
767 Ga0466964_0031898
768 Ga0453684_0019345
769 Ga0453684_0049806
770 Ga0466971_0101180
771 Ga0466968_0014824
772 Ga0466957_0001605
773 Ga0466960_0037200
774 Ga0451576_0025438
775 Ga0466958_0022291
776 Ga0466958_0066609
777 Ga0466967_0032697
778 Ga0495617_002907
779 Ga0495627_005096
780 Ga0495627_005254
781 Ga0495603_0011247
782 Ga0495590_0000007
783 Ga0495590_0021610
784 Ga0495591_000039
785 Ga0495629_0014496
786 Ga0495638_0003255
787 Ga0495638_0087331
788 Ga0495650_0006474
789 Ga0495650_0023353
790 Ga0495605_0000085
791 Ga0495605_0007201
792 Ga0495605_0045164
793 Ga0495605_0071772
794 Ga0495584_0000022
795 Ga0495584_0000160
796 Ga0495584_0000282
797 Ga0495584_0001939
798 Ga0495584_0006959
799 Ga0495584_0020143
800 Ga0495585_0000004
801 Ga0495585_0000172
802 Ga0495585_0000398
803 Ga0495585_0019987
804 Ga0495585_0033540
805 Ga0495585_0033991
806 Ga0495594_0030182
807 Ga0495596_0000186
808 Ga0495596_0000686
809 Ga0495596_0003028
810 Ga0495596_0003609
811 Ga0495596_0011499
812 Ga0495607_0001053
813 Ga0495607_0005317
814 Ga0495607_0009832
815 Ga0495607_0070596
816 Ga0495583_0000257
817 Ga0495583_0000442
818 Ga0495583_0002083
819 Ga0495583_0006453
820 Ga0495583_0025616
821 Ga0495583_0028927
822 Ga0495583_0088387
823 Ga0495606_0005965
824 Ga0495606_0011250
825 Ga0495606_0013467
826 Ga0495606_0030661
827 Ga0495606_0040540
828 Ga0495606_0067110
829 Ga0495610_0003618
830 Ga0495616_0000127
831 Ga0495616_0000145
832 Ga0495616_0002100
833 Ga0495616_0003135
834 Ga0495616_0064411
835 Ga0495620_0004327
836 Ga0495631_0002994
837 Ga0495631_0011559
838 Ga0495631_0019069
839 Ga0495631_0041154
840 Ga0495631_0058771
841 Ga0495632_0000669
842 Ga0495632_0003042
843 Ga0495632_0004184
844 Ga0495632_0054438
845 Ga0495637_0000006
846 Ga0495643_0000183
847 Ga0495644_0006591
848 Ga0495644_0069579
849 Ga0495648_0000044
850 Ga0495648_0007342
851 Ga0495648_0022157
852 Ga0495648_0035839
853 Ga0495648_0102060
854 Ga0495663_0003407
855 Ga0495663_0004300
856 Ga0495642_0000542
857 Ga0495642_0000705
858 Ga0495642_0018330
859 Ga0495654_0003148
860 Ga0495654_0013161
861 Ga0495654_0096048
862 Ga0495640_0221113
863 Ga0495609_0000002
864 Ga0495609_0002681
865 Ga0495609_0010729
866 Ga0495609_0013676
867 Ga0495609_0017340
868 Ga0495609_0024555
869 Ga0495609_0049324
870 Ga0495621_0031026
871 Ga0495597_0002413
872 Ga0495597_0025604
873 Ga0495645_0062380
874 Ga0495633_0002260
875 Ga0495633_0002302
876 Ga0495633_0005644
877 Ga0495633_0013664
878 Ga0495633_0030826
879 Ga0495656_0003616
880 Ga0495668_0004411
881 Ga0495668_0006449
882 Ga0495668_0018461
883 Ga0495668_0024602
884 Ga0495611_0030488
885 Ga0495611_0058685
886 Ga0495625_0156084
887 Ga0495661_0000271
888 Ga0495661_0002644
889 Ga0495661_0011473
890 Ga0495661_0024666
891 Ga0495661_0031507
892 Ga0495588_0000135
893 Ga0495588_0004836
894 Ga0495588_0024376
895 Ga0495588_0027063
896 Ga0495657_0025278
897 Ga0495623_0039623
898 Ga0495669_0001801
899 Ga0495669_0015305
900 Ga0495613_0074676
901 Ga0495624_0017524
902 Ga0495670_0000327
903 Ga0495670_0035321
904 Ga0495670_0115694
905 Ga0495671_0006547
906 Ga0495671_0007982
907 Ga0495671_0035645
908 Ga0495589_0000030
909 Ga0495589_0000146
910 Ga0495589_0000700
911 Ga0495600_0104142
912 Ga0495660_0000103
913 Ga0495660_0046121
914 Ga0495581_0027790
915 Ga0495604_0003298
916 Ga0495604_0095681
917 Ga0495636_0030701
918 Ga0495674_0001746
919 Ga0495672_0000118
920 Ga0495672_0002945
921 Ga0495672_0005158
922 Ga0495672_0068721
923 Ga0495672_0087474
924 Ga0495683_0000492
925 Ga0495683_0001944
926 Ga0495683_0006662
927 Ga0495683_0020196
928 Ga0495683_0065714
929 Ga0495683_0079323
930 Ga0495687_000047
931 Ga0495687_000112
932 Ga0495687_003286
933 Ga0495675_0024662
934 Ga0495677_0000044
935 Ga0495677_0002379
936 Ga0495677_0004766
937 Ga0495679_009052
938 Ga0495681_0000860
939 Ga0495681_0006816
940 Ga0495593_0050629
941 Ga0495602_0011830
942 Ga0495626_0000006
943 Ga0495626_0000266
944 Ga0495626_0001873
945 Ga0495626_0006582
946 Ga0496100_0219910
947 Ga0496101_0319156
948 Ga0496102_0000074
949 Ga0496102_0000508
950 Ga0496102_0011405
951 Ga0496102_0086422
952 Ga0496103_0124198
953 Ga0496104_0287479
954 Ga0496106_0008808
955 Ga0496107_0155437
956 Ga0496110_0000369
957 Ga0496110_0144897
958 Ga0496113_0115572
959 Ga0496114_0008112
960 Ga0496114_0159456
961 Ga0496115_0086807
962 Ga0496117_0013588
963 Ga0496117_0013627
964 Ga0496118_0005148
965 Ga0496118_0030110
966 Ga0496121_0003212
967 Ga0496121_0117414
968 Ga0496122_0012026
969 Ga0496123_0005152
970 Ga0496123_0066829
971 Ga0496124_0013346
972 Ga0496124_0084102
973 Ga0496124_0193375
974 Ga0496125_0001798
975 Ga0496125_0003328
976 Ga0496125_0016244
977 Ga0496125_0036527
978 Ga0496125_0057178
979 Ga0496126_0025019
980 Ga0496126_0201639
981 Ga0495678_000113
982 Ga0495678_011861
983 Ga0495682_0053393
984 Ga0501039_0155410
985 Ga0501075_0145638
986 Ga0501081_0035566
987 Ga0501044_0140724
988 Ga0501045_0008406
989 nmdc:mga07m45_2812_c1
990 nmdc:mga07m45_6121_c1
991 nmdc:mga07m45_70985_c1
992 nmdc:mga07m45_840_c1
993 nmdc:mga06r32_55041_c1
994 nmdc:mga08y16_183830_c1
995 Ga0500571_000935
996 Ga0500593_001648
997 Ga0500607_009515
998 Ga0500608_001188
999 Ga0500634_0031818
1000 Ga0530510_0077980
1001 2513721386
1002 2524442595
1003 2599626210
1004 2599675849
1005 2599682267
1006 2599695918
1007 2643797837
1008 2644029213
1009 2644326812
1010 2644399931
1011 2644473015
1012 2722882686
1013 2738721506
1014 2738880849
1015 2739281175
1016 2745074689
1017 2819601484
1018 2831272250
1019 2838059416
1020 2839142931
1021 2885202841
1022 2885216762
1023 2894025089
1024 2899930969
1025 2904544190
1026 2928040796
1027 2928047638
1028 2928055416
1029 2928069519
1030 2928075540
1031 2929162238
1032 2945909614
1033 2945988410
1034 8047677837

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

228

376

0.99

PF22924

ACOX_C_alpha1

Acyl-CoA oxidase, C-alpha1 domain

308

376

0.95

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

2

112

0.94

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

116

215

0.9

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

244

366

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pg0-assembly1.cif.gz_A crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus 0.9572 6 381
1ivh-assembly1.cif.gz_B structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity 0.9506 9 381
5lnx-assembly2.cif.gz_E crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9495 14 381
5lnx-assembly1.cif.gz_C crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9494 18 381
2dvl-assembly1.cif.gz_A crystal structure of project tt0160 from thermus thermophilus hb8 0.949 10 381
ID Description Score Start End Superfamily
af_P28330_285_428_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9773 241 381 1.20.140.10
4n5fB02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.976 124 230 2.40.110.10
af_O33229_243_386_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9712 241 381 1.20.140.10
af_M0RAD8_170_241_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9639 124 192 2.40.110.10
af_Q6NWF0_171_282_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9638 126 237 2.40.110.10
ID Description Score Start End GO Terms
AF-J2TNM5-F1-model_v4 Acyl-CoA dehydrogenase 0.9901 1 208 GO:0006552
GO:0008470
GO:0050660
AF-A0A5B8BFN9-F1-model_v4 Acyl-[acyl-carrier-protein] dehydrogenase MbtN (Mycobactin synthase protein N) 0.9846 17 382 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A807AT07-F1-model_v4 deleted 0.9846 17 382
AF-A0A849C9G4-F1-model_v4 Acyl-CoA dehydrogenase 0.9838 10 382 GO:0003995
GO:0050660
AF-A0A1H4L011-F1-model_v4 Acyl-[acyl-carrier-protein] dehydrogenase MbtN (Mycobactin synthase protein N) 0.9819 12 382 GO:0003995
GO:0005737
GO:0033539
GO:0050660

Map