F458172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 517 | 298 | 1034 | 379 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0000220|Ga0496102_0000220_59612_60742 |
| Length | 376 |
| Sequence | MTPELEDLRDAVRRFIDSEITPHQQRFKEQQHVDRALWNKAGELGVLLADIPEQYGGSGGTFAHQCVVFEELGYAGDMAFGIHVHAIVAHYILNQGTEAQKRKYLPLLASGEMVGAIAMSEPGAGSDLKGIRTTAAAGKGDNGGYRVNGSKTFISNGYLADLILVVVKTDPNAGARGVSLLLLETKDNPGFRVGRILDKVGQKGQDTCELFFDGAHVPTENVLGGVEGQGFAQLMTELPYERTILGVTGVAAIERALKLTVEYTRERKAFGQALIEMQNTRFVLAEIKTEATIARIFIDRCIEDMIAGRMDTVQASMAKYWISDLQCKVVDQCVQLFGGYGYMLEYPIAQMYVDARVQRIYGGANEIMKEIIARAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 51 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 71 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 120 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 129 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 148 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 149 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 150 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 151 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 152 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 155 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 159 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 160 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 161 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 162 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 163 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 261 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 262 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 263 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 264 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 265 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 266 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 267 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 268 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 269 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 270 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 271 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 272 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 273 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 274 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 275 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 276 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 277 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 278 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 279 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 280 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 281 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 282 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 283 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 284 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 285 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 286 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 287 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 288 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 289 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 290 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 291 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 292 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 293 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 294 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 295 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 296 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 297 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 298 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.23 |
| Metatranscriptomes | 0.19 |
| Isolates | 6.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.54 |
| Nodule | 1.93 |
| Rhizoplane | 3.87 |
| Rhizosphere | 67.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0000220 | 3300048905 | Bacteria | 75547 |
| 2 | JGI25152J39213_1008597 | 3300002773 | Bacteria | 2518 |
| 3 | JGI25150J39212_1001405 | 3300002774 | Bacteria | 6796 |
| 4 | JGI25151J46595_10001530 | 3300003187 | Bacteria | 15453 |
| 5 | JGI25151J46595_10002902 | 3300003187 | Bacteria | 9822 |
| 6 | JGI25151J46595_10003256 | 3300003187 | Bacteria | 9031 |
| 7 | JGI25160J50197_1001521 | 3300003354 | Bacteria | 11499 |
| 8 | JGI25161J50226_1001622 | 3300003374 | Bacteria | 6531 |
| 9 | Ga0006562J51391_1089035 | 3300003578 | Bacteria | 4790 |
| 10 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 11 | Ga0055535_1000289 | 3300003761 | Bacteria | 53058 |
| 12 | Ga0055542_1000036 | 3300003762 | Bacteria | 227346 |
| 13 | Ga0055526_1003439 | 3300003771 | Bacteria | 10049 |
| 14 | Ga0055526_1006235 | 3300003771 | Bacteria | 6539 |
| 15 | Ga0055537_1003054 | 3300003773 | Bacteria | 5278 |
| 16 | Ga0055524_1000771 | 3300003775 | Bacteria | 21556 |
| 17 | Ga0055524_1004361 | 3300003775 | Bacteria | 6539 |
| 18 | Ga0055536_1002854 | 3300003781 | Bacteria | 9519 |
| 19 | Ga0055534_1000063 | 3300003784 | Bacteria | 81542 |
| 20 | Ga0055528_1000070 | 3300003790 | Bacteria | 81542 |
| 21 | Ga0055528_1006539 | 3300003790 | Bacteria | 5278 |
| 22 | Ga0055530_10000581 | 3300003791 | Bacteria | 31658 |
| 23 | Ga0055530_10001245 | 3300003791 | Bacteria | 19396 |
| 24 | Ga0055530_10003045 | 3300003791 | Bacteria | 10005 |
| 25 | Ga0055540_1000173 | 3300003792 | Bacteria | 63434 |
| 26 | Ga0055540_1000846 | 3300003792 | Bacteria | 20496 |
| 27 | Ga0055531_10001130 | 3300003794 | Bacteria | 20640 |
| 28 | Ga0055543_1006615 | 3300004625 | Bacteria | 2773 |
| 29 | Ga0065165_1001179 | 3300005262 | Bacteria | 30342 |
| 30 | Ga0065165_1003596 | 3300005262 | Bacteria | 10665 |
| 31 | Ga0065704_10024074 | 3300005289 | Bacteria | 1810 |
| 32 | Ga0065712_10079742 | 3300005290 | Bacteria | 3183 |
| 33 | Ga0065715_10097032 | 3300005293 | Bacteria | 3774 |
| 34 | Ga0070658_10021034 | 3300005327 | Bacteria | 5226 |
| 35 | Ga0070670_100004704 | 3300005331 | Bacteria | 11455 |
| 36 | Ga0070677_10005309 | 3300005333 | Bacteria | 4243 |
| 37 | Ga0070668_100069400 | 3300005347 | Bacteria | 2741 |
| 38 | Ga0070669_100030326 | 3300005353 | Bacteria | 3902 |
| 39 | Ga0070669_100159761 | 3300005353 | Bacteria | 1750 |
| 40 | Ga0070675_100001028 | 3300005354 | Bacteria | 20060 |
| 41 | Ga0070671_100039358 | 3300005355 | Bacteria | 3924 |
| 42 | Ga0070671_100121553 | 3300005355 | Bacteria | 2198 |
| 43 | Ga0070674_100002691 | 3300005356 | Bacteria | 9829 |
| 44 | Ga0070673_100002873 | 3300005364 | Bacteria | 10594 |
| 45 | Ga0070667_100006144 | 3300005367 | Bacteria | 9978 |
| 46 | Ga0070694_100055354 | 3300005444 | Bacteria | 2690 |
| 47 | Ga0070662_100012264 | 3300005457 | Bacteria | 5676 |
| 48 | Ga0070662_100086751 | 3300005457 | Bacteria | 2341 |
| 49 | Ga0068867_100002600 | 3300005459 | Bacteria | 12728 |
| 50 | Ga0068867_100011000 | 3300005459 | Bacteria | 6380 |
| 51 | Ga0068853_100008120 | 3300005539 | Bacteria | 8425 |
| 52 | Ga0070672_100001033 | 3300005543 | Bacteria | 16943 |
| 53 | Ga0070672_100004165 | 3300005543 | Bacteria | 9442 |
| 54 | Ga0068855_100055632 | 3300005563 | Bacteria | 4646 |
| 55 | Ga0068855_100104789 | 3300005563 | Bacteria | 3253 |
| 56 | Ga0068851_10007481 | 3300005834 | Bacteria | 5016 |
| 57 | Ga0068862_100100238 | 3300005844 | Bacteria | 2533 |
| 58 | Ga0075366_10023959 | 3300006195 | Bacteria | 3558 |
| 59 | Ga0097621_100103614 | 3300006237 | Bacteria | 2397 |
| 60 | Ga0075370_10000693 | 3300006353 | Bacteria | 13254 |
| 61 | Ga0075370_10014319 | 3300006353 | Bacteria | 4230 |
| 62 | Ga0068871_100133615 | 3300006358 | Bacteria | 2105 |
| 63 | Ga0075428_100164721 | 3300006844 | Bacteria | 2405 |
| 64 | Ga0075430_100008063 | 3300006846 | Bacteria | 8902 |
| 65 | Ga0068865_100007039 | 3300006881 | Bacteria | 6903 |
| 66 | Ga0079104_1000025 | 3300006946 | Bacteria | 218785 |
| 67 | Ga0079104_1000294 | 3300006946 | Bacteria | 63150 |
| 68 | Ga0099826_10000077 | 3300006948 | Bacteria | 51489 |
| 69 | Ga0105244_10003127 | 3300009036 | Bacteria | 12057 |
| 70 | Ga0111539_10011890 | 3300009094 | Bacteria | 10909 |
| 71 | Ga0105243_10002241 | 3300009148 | Bacteria | 16253 |
| 72 | Ga0105243_10007944 | 3300009148 | Bacteria | 8148 |
| 73 | Ga0105243_10019541 | 3300009148 | Bacteria | 5136 |
| 74 | Ga0105243_10043274 | 3300009148 | Bacteria | 3529 |
| 75 | Ga0105241_10019464 | 3300009174 | Bacteria | 5006 |
| 76 | Ga0105242_10209502 | 3300009176 | Bacteria | 1736 |
| 77 | Ga0105238_10064361 | 3300009551 | Bacteria | 3667 |
| 78 | Ga0157371_10075509 | 3300013102 | Bacteria | 2387 |
| 79 | Ga0157370_10001911 | 3300013104 | Bacteria | 25636 |
| 80 | Ga0157369_10033925 | 3300013105 | Bacteria | 5605 |
| 81 | Ga0157374_10150705 | 3300013296 | Bacteria | 2261 |
| 82 | Ga0163162_10086132 | 3300013306 | Bacteria | 3219 |
| 83 | Ga0157372_10039064 | 3300013307 | Bacteria | 5239 |
| 84 | Ga0157375_10106277 | 3300013308 | Bacteria | 2899 |
| 85 | Ga0182008_10000332 | 3300014497 | Bacteria | 37231 |
| 86 | Ga0182008_10002652 | 3300014497 | Bacteria | 11106 |
| 87 | Ga0182008_10066845 | 3300014497 | Bacteria | 1769 |
| 88 | Ga0157376_10052021 | 3300014969 | Bacteria | 3404 |
| 89 | Ga0182006_1001149 | 3300015261 | Bacteria | 16762 |
| 90 | Ga0182007_10001747 | 3300015262 | Bacteria | 11426 |
| 91 | Ga0163161_10000244 | 3300017792 | Bacteria | 49165 |
| 92 | Ga0213872_10000036 | 3300021361 | Bacteria | 129233 |
| 93 | Ga0209672_100508 | 3300025228 | Bacteria | 21501 |
| 94 | Ga0209147_100380 | 3300025229 | Bacteria | 30888 |
| 95 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 96 | Ga0209258_100091 | 3300025242 | Bacteria | 227454 |
| 97 | Ga0207425_1000183 | 3300025245 | Bacteria | 51638 |
| 98 | Ga0207425_1005689 | 3300025245 | Bacteria | 3516 |
| 99 | Ga0209677_100830 | 3300025253 | Bacteria | 15396 |
| 100 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 101 | Ga0209148_1000310 | 3300025254 | Bacteria | 69517 |
| 102 | Ga0209129_1000091 | 3300025258 | Bacteria | 175716 |
| 103 | Ga0209129_1000853 | 3300025258 | Bacteria | 19107 |
| 104 | Ga0209129_1002459 | 3300025258 | Bacteria | 9072 |
| 105 | Ga0209129_1003670 | 3300025258 | Bacteria | 6533 |
| 106 | Ga0209565_1000130 | 3300025263 | Bacteria | 108121 |
| 107 | Ga0209565_1000270 | 3300025263 | Bacteria | 52764 |
| 108 | Ga0209565_1000822 | 3300025263 | Bacteria | 17647 |
| 109 | Ga0209565_1002231 | 3300025263 | Bacteria | 7230 |
| 110 | Ga0209565_1014449 | 3300025263 | Bacteria | 1813 |
| 111 | Ga0209673_1000106 | 3300025273 | Bacteria | 185426 |
| 112 | Ga0209673_1000154 | 3300025273 | Bacteria | 146394 |
| 113 | Ga0209673_1001319 | 3300025273 | Bacteria | 24986 |
| 114 | Ga0209673_1007185 | 3300025273 | Bacteria | 5197 |
| 115 | Ga0209130_1000140 | 3300025284 | Bacteria | 115434 |
| 116 | Ga0209130_1000203 | 3300025284 | Bacteria | 80023 |
| 117 | Ga0209675_1000058 | 3300025291 | Bacteria | 185426 |
| 118 | Ga0209675_1000447 | 3300025291 | Bacteria | 32004 |
| 119 | Ga0209675_1002260 | 3300025291 | Bacteria | 10046 |
| 120 | Ga0209675_1005069 | 3300025291 | Bacteria | 5629 |
| 121 | Ga0209675_1012696 | 3300025291 | Bacteria | 2693 |
| 122 | Ga0209676_1000088 | 3300025292 | Bacteria | 263010 |
| 123 | Ga0209676_1000966 | 3300025292 | Bacteria | 34669 |
| 124 | Ga0209676_1006871 | 3300025292 | Bacteria | 5506 |
| 125 | Ga0209025_1000207 | 3300025294 | Bacteria | 140774 |
| 126 | Ga0209025_1000244 | 3300025294 | Bacteria | 127938 |
| 127 | Ga0209025_1000356 | 3300025294 | Bacteria | 98547 |
| 128 | Ga0209025_1001327 | 3300025294 | Bacteria | 33484 |
| 129 | Ga0209025_1002931 | 3300025294 | Bacteria | 16979 |
| 130 | Ga0209025_1013396 | 3300025294 | Bacteria | 5158 |
| 131 | Ga0209564_1000103 | 3300025295 | Bacteria | 221166 |
| 132 | Ga0209564_1000530 | 3300025295 | Bacteria | 62121 |
| 133 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 134 | Ga0209758_1004583 | 3300025297 | Bacteria | 11388 |
| 135 | Ga0209758_1005932 | 3300025297 | Bacteria | 9074 |
| 136 | Ga0209050_1000110 | 3300025298 | Bacteria | 216664 |
| 137 | Ga0209050_1000916 | 3300025298 | Bacteria | 38869 |
| 138 | Ga0209050_1000983 | 3300025298 | Bacteria | 36304 |
| 139 | Ga0209050_1010828 | 3300025298 | Bacteria | 4427 |
| 140 | Ga0209050_1011823 | 3300025298 | Bacteria | 4083 |
| 141 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 142 | Ga0209256_1000065 | 3300025299 | Bacteria | 248104 |
| 143 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 144 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 145 | Ga0207426_1000124 | 3300025302 | Bacteria | 218145 |
| 146 | Ga0209051_1000069 | 3300025303 | Bacteria | 219208 |
| 147 | Ga0209051_1000379 | 3300025303 | Bacteria | 63486 |
| 148 | Ga0209051_1000685 | 3300025303 | Bacteria | 37585 |
| 149 | Ga0209257_1000093 | 3300025304 | Bacteria | 263088 |
| 150 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 151 | Ga0209257_1000575 | 3300025304 | Bacteria | 61759 |
| 152 | Ga0209257_1002147 | 3300025304 | Bacteria | 20535 |
| 153 | Ga0207697_10016154 | 3300025315 | Bacteria | 3078 |
| 154 | Ga0207655_1001639 | 3300025728 | Bacteria | 19857 |
| 155 | Ga0207682_10001251 | 3300025893 | Bacteria | 11736 |
| 156 | Ga0207680_10096101 | 3300025903 | Bacteria | 1895 |
| 157 | Ga0207645_10000882 | 3300025907 | Bacteria | 24904 |
| 158 | Ga0207645_10121357 | 3300025907 | Bacteria | 1696 |
| 159 | Ga0207643_10005642 | 3300025908 | Bacteria | 6690 |
| 160 | Ga0207654_10011377 | 3300025911 | Bacteria | 4539 |
| 161 | Ga0207649_10181701 | 3300025920 | Bacteria | 1473 |
| 162 | Ga0207681_10051620 | 3300025923 | Bacteria | 2786 |
| 163 | Ga0207694_10200741 | 3300025924 | Bacteria | 1622 |
| 164 | Ga0207650_10001012 | 3300025925 | Bacteria | 21110 |
| 165 | Ga0207659_10001055 | 3300025926 | Bacteria | 16343 |
| 166 | Ga0207644_10089505 | 3300025931 | Bacteria | 2291 |
| 167 | Ga0207706_10004566 | 3300025933 | Bacteria | 12995 |
| 168 | Ga0207706_10005643 | 3300025933 | Bacteria | 11659 |
| 169 | Ga0207709_10000159 | 3300025935 | Bacteria | 91803 |
| 170 | Ga0207709_10000740 | 3300025935 | Bacteria | 25909 |
| 171 | Ga0207709_10001906 | 3300025935 | Bacteria | 13754 |
| 172 | Ga0207709_10061810 | 3300025935 | Bacteria | 2342 |
| 173 | Ga0207669_10008500 | 3300025937 | Bacteria | 4823 |
| 174 | Ga0207704_10112583 | 3300025938 | Bacteria | 1843 |
| 175 | Ga0207691_10002053 | 3300025940 | Bacteria | 19685 |
| 176 | Ga0207691_10003721 | 3300025940 | Bacteria | 14797 |
| 177 | Ga0207691_10027526 | 3300025940 | Bacteria | 5328 |
| 178 | Ga0207691_10126267 | 3300025940 | Bacteria | 2263 |
| 179 | Ga0207689_10136701 | 3300025942 | Bacteria | 2018 |
| 180 | Ga0207679_10002533 | 3300025945 | Bacteria | 11260 |
| 181 | Ga0207667_10036690 | 3300025949 | Bacteria | 5249 |
| 182 | Ga0207667_10195237 | 3300025949 | Bacteria | 2077 |
| 183 | Ga0207651_10007642 | 3300025960 | Bacteria | 5771 |
| 184 | Ga0207668_10065687 | 3300025972 | Bacteria | 2569 |
| 185 | Ga0207658_10229569 | 3300025986 | Bacteria | 1566 |
| 186 | Ga0207648_10002575 | 3300026089 | Bacteria | 19427 |
| 187 | Ga0207676_10011673 | 3300026095 | Bacteria | 6284 |
| 188 | Ga0207683_10016157 | 3300026121 | Bacteria | 6353 |
| 189 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 190 | Ga0209281_1000423 | 3300027111 | Bacteria | 63126 |
| 191 | Ga0209982_1001062 | 3300027552 | Bacteria | 3659 |
| 192 | Ga0209970_1007651 | 3300027614 | Bacteria | 1771 |
| 193 | Ga0210002_1000336 | 3300027617 | Bacteria | 6445 |
| 194 | Ga0209983_1007331 | 3300027665 | Bacteria | 2261 |
| 195 | Ga0209282_1000223 | 3300027666 | Bacteria | 29527 |
| 196 | Ga0209998_10000573 | 3300027717 | Bacteria | 9893 |
| 197 | Ga0268265_10059714 | 3300028380 | Bacteria | 2919 |
| 198 | Ga0265338_10127474 | 3300028800 | Bacteria | 2017 |
| 199 | Ga0316177_1053015 | 3300030731 | Bacteria | 7911 |
| 200 | Ga0265328_10017566 | 3300031239 | Bacteria | 2770 |
| 201 | Ga0265327_10000178 | 3300031251 | Bacteria | 135732 |
| 202 | Ga0265327_10001131 | 3300031251 | Bacteria | 36638 |
| 203 | Ga0307408_100089111 | 3300031548 | Bacteria | 2325 |
| 204 | Ga0307410_10038399 | 3300031852 | Bacteria | 3136 |
| 205 | Ga0307410_10113280 | 3300031852 | Bacteria | 1966 |
| 206 | Ga0307406_10005704 | 3300031901 | Bacteria | 6816 |
| 207 | Ga0307412_10004356 | 3300031911 | Bacteria | 7893 |
| 208 | Ga0307409_100001827 | 3300031995 | Bacteria | 10808 |
| 209 | Ga0307416_100042429 | 3300032002 | Bacteria | 3551 |
| 210 | Ga0307414_10007017 | 3300032004 | Bacteria | 6313 |
| 211 | Ga0307411_10000366 | 3300032005 | Bacteria | 15314 |
| 212 | Ga0373955_0060595 | 3300035172 | Bacteria | 2088 |
| 213 | Ga0373935_0101910 | 3300035692 | Bacteria | 1894 |
| 214 | Ga0373937_0001606 | 3300036401 | Bacteria | 18984 |
| 215 | Ga0395899_0002181 | 3300037312 | Bacteria | 16076 |
| 216 | Ga0395899_0005496 | 3300037312 | Bacteria | 9819 |
| 217 | Ga0395900_0000729 | 3300037418 | Bacteria | 43752 |
| 218 | Ga0395900_0013154 | 3300037418 | Bacteria | 8456 |
| 219 | Ga0395900_0073997 | 3300037418 | Bacteria | 3503 |
| 220 | Ga0395900_0091418 | 3300037418 | Bacteria | 3127 |
| 221 | Ga0395900_0124103 | 3300037418 | Bacteria | 2648 |
| 222 | Ga0395898_0014471 | 3300037466 | Bacteria | 8103 |
| 223 | Ga0395898_0051762 | 3300037466 | Bacteria | 4014 |
| 224 | Ga0395898_0097771 | 3300037466 | Bacteria | 2819 |
| 225 | Ga0395898_0248803 | 3300037466 | Bacteria | 1695 |
| 226 | Ga0395898_0265369 | 3300037466 | Bacteria | 1637 |
| 227 | Ga0395898_0434077 | 3300037466 | Bacteria | 1251 |
| 228 | Ga0395905_0001374 | 3300037471 | Bacteria | 29523 |
| 229 | Ga0395905_0016632 | 3300037471 | Bacteria | 6992 |
| 230 | Ga0395905_0020360 | 3300037471 | Bacteria | 6284 |
| 231 | Ga0395905_0085132 | 3300037471 | Bacteria | 2962 |
| 232 | Ga0395905_0131539 | 3300037471 | Bacteria | 2353 |
| 233 | Ga0395901_0069688 | 3300038443 | Bacteria | 3662 |
| 234 | Ga0395901_0103554 | 3300038443 | Bacteria | 2986 |
| 235 | Ga0395901_0295949 | 3300038443 | Bacteria | 1678 |
| 236 | Ga0436360_0819426 | 3300039438 | Bacteria | 1605 |
| 237 | Ga0436361_0136966 | 3300039447 | Bacteria | 21375 |
| 238 | Ga0436362_0178613 | 3300039453 | Bacteria | 1939 |
| 239 | Ga0450911_002864 | 3300042115 | Bacteria | 3219 |
| 240 | Ga0450904_000065 | 3300042139 | Bacteria | 23701 |
| 241 | Ga0439458_0009004 | 3300042157 | Bacteria | 2226 |
| 242 | Ga0451577_0012774 | 3300042876 | Bacteria | 7878 |
| 243 | Ga0466969_0054802 | 3300044656 | Bacteria | 1952 |
| 244 | Ga0466972_0004271 | 3300044658 | Bacteria | 7137 |
| 245 | Ga0466965_0004221 | 3300044683 | Bacteria | 6384 |
| 246 | Ga0466965_0024640 | 3300044683 | Bacteria | 2911 |
| 247 | Ga0466965_0151537 | 3300044683 | Bacteria | 1212 |
| 248 | Ga0466961_0048054 | 3300044693 | Bacteria | 2727 |
| 249 | Ga0466964_0020142 | 3300044706 | Bacteria | 2567 |
| 250 | Ga0466964_0031898 | 3300044706 | Bacteria | 2091 |
| 251 | Ga0453684_0019345 | 3300044712 | Bacteria | 10372 |
| 252 | Ga0453684_0049806 | 3300044712 | Bacteria | 5518 |
| 253 | Ga0466971_0101180 | 3300044719 | Bacteria | 1324 |
| 254 | Ga0466968_0014824 | 3300044735 | Bacteria | 3084 |
| 255 | Ga0466957_0001605 | 3300044842 | Bacteria | 11870 |
| 256 | Ga0466960_0037200 | 3300044901 | Bacteria | 2283 |
| 257 | Ga0451576_0025438 | 3300045051 | Bacteria | 6376 |
| 258 | Ga0466958_0022291 | 3300045836 | Bacteria | 3708 |
| 259 | Ga0466958_0066609 | 3300045836 | Bacteria | 2199 |
| 260 | Ga0466967_0032697 | 3300045976 | Bacteria | 4396 |
| 261 | Ga0495617_002907 | 3300046452 | Bacteria | 6584 |
| 262 | Ga0495627_005096 | 3300046453 | Bacteria | 5368 |
| 263 | Ga0495627_005254 | 3300046453 | Bacteria | 5251 |
| 264 | Ga0495603_0011247 | 3300046455 | Bacteria | 5421 |
| 265 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 266 | Ga0495590_0021610 | 3300046457 | Bacteria | 2280 |
| 267 | Ga0495591_000039 | 3300046458 | Bacteria | 156460 |
| 268 | Ga0495629_0014496 | 3300046459 | Bacteria | 5672 |
| 269 | Ga0495638_0003255 | 3300046460 | Bacteria | 12816 |
| 270 | Ga0495638_0087331 | 3300046460 | Bacteria | 1884 |
| 271 | Ga0495650_0006474 | 3300046471 | Bacteria | 7284 |
| 272 | Ga0495650_0023353 | 3300046471 | Bacteria | 2946 |
| 273 | Ga0495605_0000085 | 3300046474 | Bacteria | 121011 |
| 274 | Ga0495605_0007201 | 3300046474 | Bacteria | 6328 |
| 275 | Ga0495605_0045164 | 3300046474 | Bacteria | 2172 |
| 276 | Ga0495605_0071772 | 3300046474 | Bacteria | 1634 |
| 277 | Ga0495584_0000022 | 3300046491 | Bacteria | 128471 |
| 278 | Ga0495584_0000160 | 3300046491 | Bacteria | 47133 |
| 279 | Ga0495584_0000282 | 3300046491 | Bacteria | 35813 |
| 280 | Ga0495584_0001939 | 3300046491 | Bacteria | 11899 |
| 281 | Ga0495584_0006959 | 3300046491 | Bacteria | 5906 |
| 282 | Ga0495584_0020143 | 3300046491 | Bacteria | 3389 |
| 283 | Ga0495585_0000004 | 3300046492 | Bacteria | 348260 |
| 284 | Ga0495585_0000172 | 3300046492 | Bacteria | 69900 |
| 285 | Ga0495585_0000398 | 3300046492 | Bacteria | 42060 |
| 286 | Ga0495585_0019987 | 3300046492 | Bacteria | 3852 |
| 287 | Ga0495585_0033540 | 3300046492 | Bacteria | 2905 |
| 288 | Ga0495585_0033991 | 3300046492 | Bacteria | 2882 |
| 289 | Ga0495594_0030182 | 3300046499 | Bacteria | 2931 |
| 290 | Ga0495596_0000186 | 3300046500 | Bacteria | 43253 |
| 291 | Ga0495596_0000686 | 3300046500 | Bacteria | 21047 |
| 292 | Ga0495596_0003028 | 3300046500 | Bacteria | 8701 |
| 293 | Ga0495596_0003609 | 3300046500 | Bacteria | 7778 |
| 294 | Ga0495596_0011499 | 3300046500 | Bacteria | 3816 |
| 295 | Ga0495607_0001053 | 3300046501 | Bacteria | 25182 |
| 296 | Ga0495607_0005317 | 3300046501 | Bacteria | 9256 |
| 297 | Ga0495607_0009832 | 3300046501 | Bacteria | 6455 |
| 298 | Ga0495607_0070596 | 3300046501 | Bacteria | 1951 |
| 299 | Ga0495583_0000257 | 3300046506 | Bacteria | 87964 |
| 300 | Ga0495583_0000442 | 3300046506 | Bacteria | 62158 |
| 301 | Ga0495583_0002083 | 3300046506 | Bacteria | 18045 |
| 302 | Ga0495583_0006453 | 3300046506 | Bacteria | 7667 |
| 303 | Ga0495583_0025616 | 3300046506 | Bacteria | 2943 |
| 304 | Ga0495583_0028927 | 3300046506 | Bacteria | 2717 |
| 305 | Ga0495583_0088387 | 3300046506 | Bacteria | 1337 |
| 306 | Ga0495606_0005965 | 3300046507 | Bacteria | 11428 |
| 307 | Ga0495606_0011250 | 3300046507 | Bacteria | 7322 |
| 308 | Ga0495606_0013467 | 3300046507 | Bacteria | 6456 |
| 309 | Ga0495606_0030661 | 3300046507 | Bacteria | 3753 |
| 310 | Ga0495606_0040540 | 3300046507 | Bacteria | 3130 |
| 311 | Ga0495606_0067110 | 3300046507 | Bacteria | 2272 |
| 312 | Ga0495610_0003618 | 3300046512 | Bacteria | 11926 |
| 313 | Ga0495616_0000127 | 3300046513 | Bacteria | 66628 |
| 314 | Ga0495616_0000145 | 3300046513 | Bacteria | 62415 |
| 315 | Ga0495616_0002100 | 3300046513 | Bacteria | 13389 |
| 316 | Ga0495616_0003135 | 3300046513 | Bacteria | 10682 |
| 317 | Ga0495616_0064411 | 3300046513 | Bacteria | 1788 |
| 318 | Ga0495620_0004327 | 3300046515 | Bacteria | 8025 |
| 319 | Ga0495631_0002994 | 3300046518 | Bacteria | 9347 |
| 320 | Ga0495631_0011559 | 3300046518 | Bacteria | 4338 |
| 321 | Ga0495631_0019069 | 3300046518 | Bacteria | 3221 |
| 322 | Ga0495631_0041154 | 3300046518 | Bacteria | 2045 |
| 323 | Ga0495631_0058771 | 3300046518 | Bacteria | 1672 |
| 324 | Ga0495632_0000669 | 3300046519 | Bacteria | 31343 |
| 325 | Ga0495632_0003042 | 3300046519 | Bacteria | 12206 |
| 326 | Ga0495632_0004184 | 3300046519 | Bacteria | 9873 |
| 327 | Ga0495632_0054438 | 3300046519 | Bacteria | 1961 |
| 328 | Ga0495637_0000006 | 3300046520 | Bacteria | 435763 |
| 329 | Ga0495643_0000183 | 3300046522 | Bacteria | 100113 |
| 330 | Ga0495644_0006591 | 3300046523 | Bacteria | 4499 |
| 331 | Ga0495644_0069579 | 3300046523 | Bacteria | 1322 |
| 332 | Ga0495648_0000044 | 3300046524 | Bacteria | 175587 |
| 333 | Ga0495648_0007342 | 3300046524 | Bacteria | 8828 |
| 334 | Ga0495648_0022157 | 3300046524 | Bacteria | 4382 |
| 335 | Ga0495648_0035839 | 3300046524 | Bacteria | 3211 |
| 336 | Ga0495648_0102060 | 3300046524 | Bacteria | 1581 |
| 337 | Ga0495663_0003407 | 3300046525 | Bacteria | 4589 |
| 338 | Ga0495663_0004300 | 3300046525 | Bacteria | 4014 |
| 339 | Ga0495642_0000542 | 3300046528 | Bacteria | 19018 |
| 340 | Ga0495642_0000705 | 3300046528 | Bacteria | 16617 |
| 341 | Ga0495642_0018330 | 3300046528 | Bacteria | 2740 |
| 342 | Ga0495654_0003148 | 3300046530 | Bacteria | 10236 |
| 343 | Ga0495654_0013161 | 3300046530 | Bacteria | 4431 |
| 344 | Ga0495654_0096048 | 3300046530 | Bacteria | 1370 |
| 345 | Ga0495640_0221113 | 3300046533 | Bacteria | 1194 |
| 346 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 347 | Ga0495609_0002681 | 3300046538 | Bacteria | 10754 |
| 348 | Ga0495609_0010729 | 3300046538 | Bacteria | 4383 |
| 349 | Ga0495609_0013676 | 3300046538 | Bacteria | 3829 |
| 350 | Ga0495609_0017340 | 3300046538 | Bacteria | 3343 |
| 351 | Ga0495609_0024555 | 3300046538 | Bacteria | 2765 |
| 352 | Ga0495609_0049324 | 3300046538 | Bacteria | 1879 |
| 353 | Ga0495621_0031026 | 3300046539 | Bacteria | 1831 |
| 354 | Ga0495597_0002413 | 3300046542 | Bacteria | 11894 |
| 355 | Ga0495597_0025604 | 3300046542 | Bacteria | 2715 |
| 356 | Ga0495645_0062380 | 3300046543 | Bacteria | 2700 |
| 357 | Ga0495633_0002260 | 3300046558 | Bacteria | 13787 |
| 358 | Ga0495633_0002302 | 3300046558 | Bacteria | 13615 |
| 359 | Ga0495633_0005644 | 3300046558 | Bacteria | 7584 |
| 360 | Ga0495633_0013664 | 3300046558 | Bacteria | 4269 |
| 361 | Ga0495633_0030826 | 3300046558 | Bacteria | 2603 |
| 362 | Ga0495656_0003616 | 3300046615 | Bacteria | 5238 |
| 363 | Ga0495668_0004411 | 3300046616 | Bacteria | 10005 |
| 364 | Ga0495668_0006449 | 3300046616 | Bacteria | 7679 |
| 365 | Ga0495668_0018461 | 3300046616 | Bacteria | 4030 |
| 366 | Ga0495668_0024602 | 3300046616 | Bacteria | 3424 |
| 367 | Ga0495611_0030488 | 3300046648 | Bacteria | 2371 |
| 368 | Ga0495611_0058685 | 3300046648 | Bacteria | 1745 |
| 369 | Ga0495625_0156084 | 3300046660 | Bacteria | 1531 |
| 370 | Ga0495661_0000271 | 3300046665 | Bacteria | 59543 |
| 371 | Ga0495661_0002644 | 3300046665 | Bacteria | 13711 |
| 372 | Ga0495661_0011473 | 3300046665 | Bacteria | 6013 |
| 373 | Ga0495661_0024666 | 3300046665 | Bacteria | 3892 |
| 374 | Ga0495661_0031507 | 3300046665 | Bacteria | 3363 |
| 375 | Ga0495588_0000135 | 3300046674 | Bacteria | 117387 |
| 376 | Ga0495588_0004836 | 3300046674 | Bacteria | 5966 |
| 377 | Ga0495588_0024376 | 3300046674 | Bacteria | 3005 |
| 378 | Ga0495588_0027063 | 3300046674 | Bacteria | 2865 |
| 379 | Ga0495657_0025278 | 3300046675 | Bacteria | 4221 |
| 380 | Ga0495623_0039623 | 3300046679 | Bacteria | 3010 |
| 381 | Ga0495669_0001801 | 3300046684 | Bacteria | 8754 |
| 382 | Ga0495669_0015305 | 3300046684 | Bacteria | 3285 |
| 383 | Ga0495613_0074676 | 3300046689 | Bacteria | 2469 |
| 384 | Ga0495624_0017524 | 3300046690 | Bacteria | 4807 |
| 385 | Ga0495670_0000327 | 3300046691 | Bacteria | 22730 |
| 386 | Ga0495670_0035321 | 3300046691 | Bacteria | 2491 |
| 387 | Ga0495670_0115694 | 3300046691 | Bacteria | 1390 |
| 388 | Ga0495671_0006547 | 3300046692 | Bacteria | 6719 |
| 389 | Ga0495671_0007982 | 3300046692 | Bacteria | 5983 |
| 390 | Ga0495671_0035645 | 3300046692 | Bacteria | 2525 |
| 391 | Ga0495589_0000030 | 3300046794 | Bacteria | 170254 |
| 392 | Ga0495589_0000146 | 3300046794 | Bacteria | 65628 |
| 393 | Ga0495589_0000700 | 3300046794 | Bacteria | 21833 |
| 394 | Ga0495600_0104142 | 3300046809 | Bacteria | 1849 |
| 395 | Ga0495660_0000103 | 3300046810 | Bacteria | 91169 |
| 396 | Ga0495660_0046121 | 3300046810 | Bacteria | 2390 |
| 397 | Ga0495581_0027790 | 3300047315 | Bacteria | 3281 |
| 398 | Ga0495604_0003298 | 3300047317 | Bacteria | 12886 |
| 399 | Ga0495604_0095681 | 3300047317 | Bacteria | 2193 |
| 400 | Ga0495636_0030701 | 3300047318 | Bacteria | 2198 |
| 401 | Ga0495674_0001746 | 3300047319 | Bacteria | 21389 |
| 402 | Ga0495672_0000118 | 3300047320 | Bacteria | 124396 |
| 403 | Ga0495672_0002945 | 3300047320 | Bacteria | 15006 |
| 404 | Ga0495672_0005158 | 3300047320 | Bacteria | 10426 |
| 405 | Ga0495672_0068721 | 3300047320 | Bacteria | 2013 |
| 406 | Ga0495672_0087474 | 3300047320 | Bacteria | 1720 |
| 407 | Ga0495683_0000492 | 3300047323 | Bacteria | 30566 |
| 408 | Ga0495683_0001944 | 3300047323 | Bacteria | 12907 |
| 409 | Ga0495683_0006662 | 3300047323 | Bacteria | 6295 |
| 410 | Ga0495683_0020196 | 3300047323 | Bacteria | 3438 |
| 411 | Ga0495683_0065714 | 3300047323 | Bacteria | 1788 |
| 412 | Ga0495683_0079323 | 3300047323 | Bacteria | 1603 |
| 413 | Ga0495687_000047 | 3300047443 | Bacteria | 206452 |
| 414 | Ga0495687_000112 | 3300047443 | Bacteria | 124725 |
| 415 | Ga0495687_003286 | 3300047443 | Bacteria | 11899 |
| 416 | Ga0495675_0024662 | 3300047444 | Bacteria | 3835 |
| 417 | Ga0495677_0000044 | 3300047445 | Bacteria | 74340 |
| 418 | Ga0495677_0002379 | 3300047445 | Bacteria | 7392 |
| 419 | Ga0495677_0004766 | 3300047445 | Bacteria | 5169 |
| 420 | Ga0495679_009052 | 3300047446 | Bacteria | 4011 |
| 421 | Ga0495681_0000860 | 3300047470 | Bacteria | 23362 |
| 422 | Ga0495681_0006816 | 3300047470 | Bacteria | 7427 |
| 423 | Ga0495593_0050629 | 3300047673 | Bacteria | 2200 |
| 424 | Ga0495602_0011830 | 3300048088 | Bacteria | 9010 |
| 425 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 426 | Ga0495626_0000266 | 3300048091 | Bacteria | 59029 |
| 427 | Ga0495626_0001873 | 3300048091 | Bacteria | 15758 |
| 428 | Ga0495626_0006582 | 3300048091 | Bacteria | 6588 |
| 429 | Ga0496100_0219910 | 3300048903 | Bacteria | 1393 |
| 430 | Ga0496101_0319156 | 3300048904 | Bacteria | 1219 |
| 431 | Ga0496102_0000074 | 3300048905 | Bacteria | 148938 |
| 432 | Ga0496102_0000508 | 3300048905 | Bacteria | 42696 |
| 433 | Ga0496102_0011405 | 3300048905 | Bacteria | 7659 |
| 434 | Ga0496102_0086422 | 3300048905 | Bacteria | 2896 |
| 435 | Ga0496103_0124198 | 3300048906 | Bacteria | 1645 |
| 436 | Ga0496104_0287479 | 3300048907 | Bacteria | 1557 |
| 437 | Ga0496106_0008808 | 3300048909 | Bacteria | 7456 |
| 438 | Ga0496107_0155437 | 3300048910 | Bacteria | 1693 |
| 439 | Ga0496110_0000369 | 3300048913 | Bacteria | 30095 |
| 440 | Ga0496110_0144897 | 3300048913 | Bacteria | 2148 |
| 441 | Ga0496113_0115572 | 3300048916 | Bacteria | 2093 |
| 442 | Ga0496114_0008112 | 3300048917 | Bacteria | 8320 |
| 443 | Ga0496114_0159456 | 3300048917 | Bacteria | 1961 |
| 444 | Ga0496115_0086807 | 3300048918 | Bacteria | 2553 |
| 445 | Ga0496117_0013588 | 3300048920 | Bacteria | 7090 |
| 446 | Ga0496117_0013627 | 3300048920 | Bacteria | 7080 |
| 447 | Ga0496118_0005148 | 3300048921 | Bacteria | 14990 |
| 448 | Ga0496118_0030110 | 3300048921 | Bacteria | 4539 |
| 449 | Ga0496121_0003212 | 3300048924 | Bacteria | 23519 |
| 450 | Ga0496121_0117414 | 3300048924 | Bacteria | 2016 |
| 451 | Ga0496122_0012026 | 3300048925 | Bacteria | 8676 |
| 452 | Ga0496123_0005152 | 3300048926 | Bacteria | 13304 |
| 453 | Ga0496123_0066829 | 3300048926 | Bacteria | 2275 |
| 454 | Ga0496124_0013346 | 3300048927 | Bacteria | 8027 |
| 455 | Ga0496124_0084102 | 3300048927 | Bacteria | 2610 |
| 456 | Ga0496124_0193375 | 3300048927 | Bacteria | 1554 |
| 457 | Ga0496125_0001798 | 3300048928 | Bacteria | 29631 |
| 458 | Ga0496125_0003328 | 3300048928 | Bacteria | 19628 |
| 459 | Ga0496125_0016244 | 3300048928 | Bacteria | 7156 |
| 460 | Ga0496125_0036527 | 3300048928 | Bacteria | 4287 |
| 461 | Ga0496125_0057178 | 3300048928 | Bacteria | 3161 |
| 462 | Ga0496126_0025019 | 3300048929 | Bacteria | 5754 |
| 463 | Ga0496126_0201639 | 3300048929 | Bacteria | 1680 |
| 464 | Ga0495678_000113 | 3300049459 | Bacteria | 96866 |
| 465 | Ga0495678_011861 | 3300049459 | Bacteria | 4155 |
| 466 | Ga0495682_0053393 | 3300049460 | Bacteria | 1467 |
| 467 | Ga0501039_0155410 | 3300049575 | Bacteria | 1797 |
| 468 | Ga0501075_0145638 | 3300049591 | Bacteria | 1805 |
| 469 | Ga0501081_0035566 | 3300049743 | Bacteria | 3391 |
| 470 | Ga0501044_0140724 | 3300049823 | Bacteria | 2401 |
| 471 | Ga0501045_0008406 | 3300049824 | Bacteria | 7195 |
| 472 | nmdc:mga07m45_2812_c1 | 3300050496 | Bacteria | 8235 |
| 473 | nmdc:mga07m45_6121_c1 | 3300050496 | Bacteria | 6063 |
| 474 | nmdc:mga07m45_70985_c1 | 3300050496 | Bacteria | 1981 |
| 475 | nmdc:mga07m45_840_c1 | 3300050496 | Bacteria | 13313 |
| 476 | nmdc:mga06r32_55041_c1 | 3300050510 | Bacteria | 3816 |
| 477 | nmdc:mga08y16_183830_c1 | 3300050511 | Bacteria | 2170 |
| 478 | Ga0500571_000935 | 3300053110 | Bacteria | 12820 |
| 479 | Ga0500593_001648 | 3300053117 | Bacteria | 8049 |
| 480 | Ga0500607_009515 | 3300053121 | Bacteria | 5841 |
| 481 | Ga0500608_001188 | 3300053122 | Bacteria | 9292 |
| 482 | Ga0500634_0031818 | 3300053161 | Bacteria | 2879 |
| 483 | Ga0530510_0077980 | 3300061734 | Bacteria | 2408 |
| 484 | 2513721386 | 2513237104 | Bacteria | 10034502 |
| 485 | 2524442595 | 2524023205 | Bacteria | 8918781 |
| 486 | 2599626210 | 2599185214 | Bacteria | 8209958 |
| 487 | 2599675849 | 2599185226 | Bacteria | 8233575 |
| 488 | 2599682267 | 2599185227 | Bacteria | 8246414 |
| 489 | 2599695918 | 2599185229 | Bacteria | 8216126 |
| 490 | 2643797837 | 2643221556 | Bacteria | 7251154 |
| 491 | 2644029213 | 2643221603 | Bacteria | 6147767 |
| 492 | 2644326812 | 2643221658 | Bacteria | 6064537 |
| 493 | 2644399931 | 2643221672 | Bacteria | 6322190 |
| 494 | 2644473015 | 2643221684 | Bacteria | 7145183 |
| 495 | 2722882686 | 2721755523 | Bacteria | 6430384 |
| 496 | 2738721506 | 2738541277 | Bacteria | 7458140 |
| 497 | 2738880849 | 2738541307 | Bacteria | 8606193 |
| 498 | 2739281175 | 2738543019 | Bacteria | 7459457 |
| 499 | 2745074689 | 2744054633 | Bacteria | 8678936 |
| 500 | 2819601484 | 2818991446 | Bacteria | 7757362 |
| 501 | 2831272250 | 2831265667 | Bacteria | 7184833 |
| 502 | 2838059416 | 2838054893 | Bacteria | 7451788 |
| 503 | 2839142931 | 2839138175 | Bacteria | 6549354 |
| 504 | 2885202841 | 2885198086 | Bacteria | 7212419 |
| 505 | 2885216762 | 2885211737 | Bacteria | 7212420 |
| 506 | 2894025089 | 2894023352 | Bacteria | 5167372 |
| 507 | 2899930969 | 2899924645 | Bacteria | 7487985 |
| 508 | 2904544190 | 2904541872 | Bacteria | 8915136 |
| 509 | 2928040796 | 2928037797 | Bacteria | 7273642 |
| 510 | 2928047638 | 2928044640 | Bacteria | 7271509 |
| 511 | 2928055416 | 2928051484 | Bacteria | 7773759 |
| 512 | 2928069519 | 2928064002 | Bacteria | 7419480 |
| 513 | 2928075540 | 2928070936 | Bacteria | 8062541 |
| 514 | 2929162238 | 2929160207 | Bacteria | 9075316 |
| 515 | 2945909614 | 2945909444 | Bacteria | 7065066 |
| 516 | 2945988410 | 2945984333 | Bacteria | 7358892 |
| 517 | 8047677837 | 8047673197 | Bacteria | 7395230 |
| 518 | Ga0496102_0000220 | |||
| 519 | JGI25152J39213_1008597 | |||
| 520 | JGI25150J39212_1001405 | |||
| 521 | JGI25151J46595_10001530 | |||
| 522 | JGI25151J46595_10002902 | |||
| 523 | JGI25151J46595_10003256 | |||
| 524 | JGI25160J50197_1001521 | |||
| 525 | JGI25161J50226_1001622 | |||
| 526 | Ga0006562J51391_1089035 | |||
| 527 | Ga0055525_1000009 | |||
| 528 | Ga0055535_1000289 | |||
| 529 | Ga0055542_1000036 | |||
| 530 | Ga0055526_1003439 | |||
| 531 | Ga0055526_1006235 | |||
| 532 | Ga0055537_1003054 | |||
| 533 | Ga0055524_1000771 | |||
| 534 | Ga0055524_1004361 | |||
| 535 | Ga0055536_1002854 | |||
| 536 | Ga0055534_1000063 | |||
| 537 | Ga0055528_1000070 | |||
| 538 | Ga0055528_1006539 | |||
| 539 | Ga0055530_10000581 | |||
| 540 | Ga0055530_10001245 | |||
| 541 | Ga0055530_10003045 | |||
| 542 | Ga0055540_1000173 | |||
| 543 | Ga0055540_1000846 | |||
| 544 | Ga0055531_10001130 | |||
| 545 | Ga0055543_1006615 | |||
| 546 | Ga0065165_1001179 | |||
| 547 | Ga0065165_1003596 | |||
| 548 | Ga0065704_10024074 | |||
| 549 | Ga0065712_10079742 | |||
| 550 | Ga0065715_10097032 | |||
| 551 | Ga0070658_10021034 | |||
| 552 | Ga0070670_100004704 | |||
| 553 | Ga0070677_10005309 | |||
| 554 | Ga0070668_100069400 | |||
| 555 | Ga0070669_100030326 | |||
| 556 | Ga0070669_100159761 | |||
| 557 | Ga0070675_100001028 | |||
| 558 | Ga0070671_100039358 | |||
| 559 | Ga0070671_100121553 | |||
| 560 | Ga0070674_100002691 | |||
| 561 | Ga0070673_100002873 | |||
| 562 | Ga0070667_100006144 | |||
| 563 | Ga0070694_100055354 | |||
| 564 | Ga0070662_100012264 | |||
| 565 | Ga0070662_100086751 | |||
| 566 | Ga0068867_100002600 | |||
| 567 | Ga0068867_100011000 | |||
| 568 | Ga0068853_100008120 | |||
| 569 | Ga0070672_100001033 | |||
| 570 | Ga0070672_100004165 | |||
| 571 | Ga0068855_100055632 | |||
| 572 | Ga0068855_100104789 | |||
| 573 | Ga0068851_10007481 | |||
| 574 | Ga0068862_100100238 | |||
| 575 | Ga0075366_10023959 | |||
| 576 | Ga0097621_100103614 | |||
| 577 | Ga0075370_10000693 | |||
| 578 | Ga0075370_10014319 | |||
| 579 | Ga0068871_100133615 | |||
| 580 | Ga0075428_100164721 | |||
| 581 | Ga0075430_100008063 | |||
| 582 | Ga0068865_100007039 | |||
| 583 | Ga0079104_1000025 | |||
| 584 | Ga0079104_1000294 | |||
| 585 | Ga0099826_10000077 | |||
| 586 | Ga0105244_10003127 | |||
| 587 | Ga0111539_10011890 | |||
| 588 | Ga0105243_10002241 | |||
| 589 | Ga0105243_10007944 | |||
| 590 | Ga0105243_10019541 | |||
| 591 | Ga0105243_10043274 | |||
| 592 | Ga0105241_10019464 | |||
| 593 | Ga0105242_10209502 | |||
| 594 | Ga0105238_10064361 | |||
| 595 | Ga0157371_10075509 | |||
| 596 | Ga0157370_10001911 | |||
| 597 | Ga0157369_10033925 | |||
| 598 | Ga0157374_10150705 | |||
| 599 | Ga0163162_10086132 | |||
| 600 | Ga0157372_10039064 | |||
| 601 | Ga0157375_10106277 | |||
| 602 | Ga0182008_10000332 | |||
| 603 | Ga0182008_10002652 | |||
| 604 | Ga0182008_10066845 | |||
| 605 | Ga0157376_10052021 | |||
| 606 | Ga0182006_1001149 | |||
| 607 | Ga0182007_10001747 | |||
| 608 | Ga0163161_10000244 | |||
| 609 | Ga0213872_10000036 | |||
| 610 | Ga0209672_100508 | |||
| 611 | Ga0209147_100380 | |||
| 612 | Ga0209563_100015 | |||
| 613 | Ga0209258_100091 | |||
| 614 | Ga0207425_1000183 | |||
| 615 | Ga0207425_1005689 | |||
| 616 | Ga0209677_100830 | |||
| 617 | Ga0209148_1000033 | |||
| 618 | Ga0209148_1000310 | |||
| 619 | Ga0209129_1000091 | |||
| 620 | Ga0209129_1000853 | |||
| 621 | Ga0209129_1002459 | |||
| 622 | Ga0209129_1003670 | |||
| 623 | Ga0209565_1000130 | |||
| 624 | Ga0209565_1000270 | |||
| 625 | Ga0209565_1000822 | |||
| 626 | Ga0209565_1002231 | |||
| 627 | Ga0209565_1014449 | |||
| 628 | Ga0209673_1000106 | |||
| 629 | Ga0209673_1000154 | |||
| 630 | Ga0209673_1001319 | |||
| 631 | Ga0209673_1007185 | |||
| 632 | Ga0209130_1000140 | |||
| 633 | Ga0209130_1000203 | |||
| 634 | Ga0209675_1000058 | |||
| 635 | Ga0209675_1000447 | |||
| 636 | Ga0209675_1002260 | |||
| 637 | Ga0209675_1005069 | |||
| 638 | Ga0209675_1012696 | |||
| 639 | Ga0209676_1000088 | |||
| 640 | Ga0209676_1000966 | |||
| 641 | Ga0209676_1006871 | |||
| 642 | Ga0209025_1000207 | |||
| 643 | Ga0209025_1000244 | |||
| 644 | Ga0209025_1000356 | |||
| 645 | Ga0209025_1001327 | |||
| 646 | Ga0209025_1002931 | |||
| 647 | Ga0209025_1013396 | |||
| 648 | Ga0209564_1000103 | |||
| 649 | Ga0209564_1000530 | |||
| 650 | Ga0209758_1000092 | |||
| 651 | Ga0209758_1004583 | |||
| 652 | Ga0209758_1005932 | |||
| 653 | Ga0209050_1000110 | |||
| 654 | Ga0209050_1000916 | |||
| 655 | Ga0209050_1000983 | |||
| 656 | Ga0209050_1010828 | |||
| 657 | Ga0209050_1011823 | |||
| 658 | Ga0209256_1000036 | |||
| 659 | Ga0209256_1000065 | |||
| 660 | Ga0209256_1000094 | |||
| 661 | Ga0207426_1000084 | |||
| 662 | Ga0207426_1000124 | |||
| 663 | Ga0209051_1000069 | |||
| 664 | Ga0209051_1000379 | |||
| 665 | Ga0209051_1000685 | |||
| 666 | Ga0209257_1000093 | |||
| 667 | Ga0209257_1000141 | |||
| 668 | Ga0209257_1000575 | |||
| 669 | Ga0209257_1002147 | |||
| 670 | Ga0207697_10016154 | |||
| 671 | Ga0207655_1001639 | |||
| 672 | Ga0207682_10001251 | |||
| 673 | Ga0207680_10096101 | |||
| 674 | Ga0207645_10000882 | |||
| 675 | Ga0207645_10121357 | |||
| 676 | Ga0207643_10005642 | |||
| 677 | Ga0207654_10011377 | |||
| 678 | Ga0207649_10181701 | |||
| 679 | Ga0207681_10051620 | |||
| 680 | Ga0207694_10200741 | |||
| 681 | Ga0207650_10001012 | |||
| 682 | Ga0207659_10001055 | |||
| 683 | Ga0207644_10089505 | |||
| 684 | Ga0207706_10004566 | |||
| 685 | Ga0207706_10005643 | |||
| 686 | Ga0207709_10000159 | |||
| 687 | Ga0207709_10000740 | |||
| 688 | Ga0207709_10001906 | |||
| 689 | Ga0207709_10061810 | |||
| 690 | Ga0207669_10008500 | |||
| 691 | Ga0207704_10112583 | |||
| 692 | Ga0207691_10002053 | |||
| 693 | Ga0207691_10003721 | |||
| 694 | Ga0207691_10027526 | |||
| 695 | Ga0207691_10126267 | |||
| 696 | Ga0207689_10136701 | |||
| 697 | Ga0207679_10002533 | |||
| 698 | Ga0207667_10036690 | |||
| 699 | Ga0207667_10195237 | |||
| 700 | Ga0207651_10007642 | |||
| 701 | Ga0207668_10065687 | |||
| 702 | Ga0207658_10229569 | |||
| 703 | Ga0207648_10002575 | |||
| 704 | Ga0207676_10011673 | |||
| 705 | Ga0207683_10016157 | |||
| 706 | Ga0209281_1000007 | |||
| 707 | Ga0209281_1000423 | |||
| 708 | Ga0209982_1001062 | |||
| 709 | Ga0209970_1007651 | |||
| 710 | Ga0210002_1000336 | |||
| 711 | Ga0209983_1007331 | |||
| 712 | Ga0209282_1000223 | |||
| 713 | Ga0209998_10000573 | |||
| 714 | Ga0268265_10059714 | |||
| 715 | Ga0265338_10127474 | |||
| 716 | Ga0316177_1053015 | |||
| 717 | Ga0265328_10017566 | |||
| 718 | Ga0265327_10000178 | |||
| 719 | Ga0265327_10001131 | |||
| 720 | Ga0307408_100089111 | |||
| 721 | Ga0307410_10038399 | |||
| 722 | Ga0307410_10113280 | |||
| 723 | Ga0307406_10005704 | |||
| 724 | Ga0307412_10004356 | |||
| 725 | Ga0307409_100001827 | |||
| 726 | Ga0307416_100042429 | |||
| 727 | Ga0307414_10007017 | |||
| 728 | Ga0307411_10000366 | |||
| 729 | Ga0373955_0060595 | |||
| 730 | Ga0373935_0101910 | |||
| 731 | Ga0373937_0001606 | |||
| 732 | Ga0395899_0002181 | |||
| 733 | Ga0395899_0005496 | |||
| 734 | Ga0395900_0000729 | |||
| 735 | Ga0395900_0013154 | |||
| 736 | Ga0395900_0073997 | |||
| 737 | Ga0395900_0091418 | |||
| 738 | Ga0395900_0124103 | |||
| 739 | Ga0395898_0014471 | |||
| 740 | Ga0395898_0051762 | |||
| 741 | Ga0395898_0097771 | |||
| 742 | Ga0395898_0248803 | |||
| 743 | Ga0395898_0265369 | |||
| 744 | Ga0395898_0434077 | |||
| 745 | Ga0395905_0001374 | |||
| 746 | Ga0395905_0016632 | |||
| 747 | Ga0395905_0020360 | |||
| 748 | Ga0395905_0085132 | |||
| 749 | Ga0395905_0131539 | |||
| 750 | Ga0395901_0069688 | |||
| 751 | Ga0395901_0103554 | |||
| 752 | Ga0395901_0295949 | |||
| 753 | Ga0436360_0819426 | |||
| 754 | Ga0436361_0136966 | |||
| 755 | Ga0436362_0178613 | |||
| 756 | Ga0450911_002864 | |||
| 757 | Ga0450904_000065 | |||
| 758 | Ga0439458_0009004 | |||
| 759 | Ga0451577_0012774 | |||
| 760 | Ga0466969_0054802 | |||
| 761 | Ga0466972_0004271 | |||
| 762 | Ga0466965_0004221 | |||
| 763 | Ga0466965_0024640 | |||
| 764 | Ga0466965_0151537 | |||
| 765 | Ga0466961_0048054 | |||
| 766 | Ga0466964_0020142 | |||
| 767 | Ga0466964_0031898 | |||
| 768 | Ga0453684_0019345 | |||
| 769 | Ga0453684_0049806 | |||
| 770 | Ga0466971_0101180 | |||
| 771 | Ga0466968_0014824 | |||
| 772 | Ga0466957_0001605 | |||
| 773 | Ga0466960_0037200 | |||
| 774 | Ga0451576_0025438 | |||
| 775 | Ga0466958_0022291 | |||
| 776 | Ga0466958_0066609 | |||
| 777 | Ga0466967_0032697 | |||
| 778 | Ga0495617_002907 | |||
| 779 | Ga0495627_005096 | |||
| 780 | Ga0495627_005254 | |||
| 781 | Ga0495603_0011247 | |||
| 782 | Ga0495590_0000007 | |||
| 783 | Ga0495590_0021610 | |||
| 784 | Ga0495591_000039 | |||
| 785 | Ga0495629_0014496 | |||
| 786 | Ga0495638_0003255 | |||
| 787 | Ga0495638_0087331 | |||
| 788 | Ga0495650_0006474 | |||
| 789 | Ga0495650_0023353 | |||
| 790 | Ga0495605_0000085 | |||
| 791 | Ga0495605_0007201 | |||
| 792 | Ga0495605_0045164 | |||
| 793 | Ga0495605_0071772 | |||
| 794 | Ga0495584_0000022 | |||
| 795 | Ga0495584_0000160 | |||
| 796 | Ga0495584_0000282 | |||
| 797 | Ga0495584_0001939 | |||
| 798 | Ga0495584_0006959 | |||
| 799 | Ga0495584_0020143 | |||
| 800 | Ga0495585_0000004 | |||
| 801 | Ga0495585_0000172 | |||
| 802 | Ga0495585_0000398 | |||
| 803 | Ga0495585_0019987 | |||
| 804 | Ga0495585_0033540 | |||
| 805 | Ga0495585_0033991 | |||
| 806 | Ga0495594_0030182 | |||
| 807 | Ga0495596_0000186 | |||
| 808 | Ga0495596_0000686 | |||
| 809 | Ga0495596_0003028 | |||
| 810 | Ga0495596_0003609 | |||
| 811 | Ga0495596_0011499 | |||
| 812 | Ga0495607_0001053 | |||
| 813 | Ga0495607_0005317 | |||
| 814 | Ga0495607_0009832 | |||
| 815 | Ga0495607_0070596 | |||
| 816 | Ga0495583_0000257 | |||
| 817 | Ga0495583_0000442 | |||
| 818 | Ga0495583_0002083 | |||
| 819 | Ga0495583_0006453 | |||
| 820 | Ga0495583_0025616 | |||
| 821 | Ga0495583_0028927 | |||
| 822 | Ga0495583_0088387 | |||
| 823 | Ga0495606_0005965 | |||
| 824 | Ga0495606_0011250 | |||
| 825 | Ga0495606_0013467 | |||
| 826 | Ga0495606_0030661 | |||
| 827 | Ga0495606_0040540 | |||
| 828 | Ga0495606_0067110 | |||
| 829 | Ga0495610_0003618 | |||
| 830 | Ga0495616_0000127 | |||
| 831 | Ga0495616_0000145 | |||
| 832 | Ga0495616_0002100 | |||
| 833 | Ga0495616_0003135 | |||
| 834 | Ga0495616_0064411 | |||
| 835 | Ga0495620_0004327 | |||
| 836 | Ga0495631_0002994 | |||
| 837 | Ga0495631_0011559 | |||
| 838 | Ga0495631_0019069 | |||
| 839 | Ga0495631_0041154 | |||
| 840 | Ga0495631_0058771 | |||
| 841 | Ga0495632_0000669 | |||
| 842 | Ga0495632_0003042 | |||
| 843 | Ga0495632_0004184 | |||
| 844 | Ga0495632_0054438 | |||
| 845 | Ga0495637_0000006 | |||
| 846 | Ga0495643_0000183 | |||
| 847 | Ga0495644_0006591 | |||
| 848 | Ga0495644_0069579 | |||
| 849 | Ga0495648_0000044 | |||
| 850 | Ga0495648_0007342 | |||
| 851 | Ga0495648_0022157 | |||
| 852 | Ga0495648_0035839 | |||
| 853 | Ga0495648_0102060 | |||
| 854 | Ga0495663_0003407 | |||
| 855 | Ga0495663_0004300 | |||
| 856 | Ga0495642_0000542 | |||
| 857 | Ga0495642_0000705 | |||
| 858 | Ga0495642_0018330 | |||
| 859 | Ga0495654_0003148 | |||
| 860 | Ga0495654_0013161 | |||
| 861 | Ga0495654_0096048 | |||
| 862 | Ga0495640_0221113 | |||
| 863 | Ga0495609_0000002 | |||
| 864 | Ga0495609_0002681 | |||
| 865 | Ga0495609_0010729 | |||
| 866 | Ga0495609_0013676 | |||
| 867 | Ga0495609_0017340 | |||
| 868 | Ga0495609_0024555 | |||
| 869 | Ga0495609_0049324 | |||
| 870 | Ga0495621_0031026 | |||
| 871 | Ga0495597_0002413 | |||
| 872 | Ga0495597_0025604 | |||
| 873 | Ga0495645_0062380 | |||
| 874 | Ga0495633_0002260 | |||
| 875 | Ga0495633_0002302 | |||
| 876 | Ga0495633_0005644 | |||
| 877 | Ga0495633_0013664 | |||
| 878 | Ga0495633_0030826 | |||
| 879 | Ga0495656_0003616 | |||
| 880 | Ga0495668_0004411 | |||
| 881 | Ga0495668_0006449 | |||
| 882 | Ga0495668_0018461 | |||
| 883 | Ga0495668_0024602 | |||
| 884 | Ga0495611_0030488 | |||
| 885 | Ga0495611_0058685 | |||
| 886 | Ga0495625_0156084 | |||
| 887 | Ga0495661_0000271 | |||
| 888 | Ga0495661_0002644 | |||
| 889 | Ga0495661_0011473 | |||
| 890 | Ga0495661_0024666 | |||
| 891 | Ga0495661_0031507 | |||
| 892 | Ga0495588_0000135 | |||
| 893 | Ga0495588_0004836 | |||
| 894 | Ga0495588_0024376 | |||
| 895 | Ga0495588_0027063 | |||
| 896 | Ga0495657_0025278 | |||
| 897 | Ga0495623_0039623 | |||
| 898 | Ga0495669_0001801 | |||
| 899 | Ga0495669_0015305 | |||
| 900 | Ga0495613_0074676 | |||
| 901 | Ga0495624_0017524 | |||
| 902 | Ga0495670_0000327 | |||
| 903 | Ga0495670_0035321 | |||
| 904 | Ga0495670_0115694 | |||
| 905 | Ga0495671_0006547 | |||
| 906 | Ga0495671_0007982 | |||
| 907 | Ga0495671_0035645 | |||
| 908 | Ga0495589_0000030 | |||
| 909 | Ga0495589_0000146 | |||
| 910 | Ga0495589_0000700 | |||
| 911 | Ga0495600_0104142 | |||
| 912 | Ga0495660_0000103 | |||
| 913 | Ga0495660_0046121 | |||
| 914 | Ga0495581_0027790 | |||
| 915 | Ga0495604_0003298 | |||
| 916 | Ga0495604_0095681 | |||
| 917 | Ga0495636_0030701 | |||
| 918 | Ga0495674_0001746 | |||
| 919 | Ga0495672_0000118 | |||
| 920 | Ga0495672_0002945 | |||
| 921 | Ga0495672_0005158 | |||
| 922 | Ga0495672_0068721 | |||
| 923 | Ga0495672_0087474 | |||
| 924 | Ga0495683_0000492 | |||
| 925 | Ga0495683_0001944 | |||
| 926 | Ga0495683_0006662 | |||
| 927 | Ga0495683_0020196 | |||
| 928 | Ga0495683_0065714 | |||
| 929 | Ga0495683_0079323 | |||
| 930 | Ga0495687_000047 | |||
| 931 | Ga0495687_000112 | |||
| 932 | Ga0495687_003286 | |||
| 933 | Ga0495675_0024662 | |||
| 934 | Ga0495677_0000044 | |||
| 935 | Ga0495677_0002379 | |||
| 936 | Ga0495677_0004766 | |||
| 937 | Ga0495679_009052 | |||
| 938 | Ga0495681_0000860 | |||
| 939 | Ga0495681_0006816 | |||
| 940 | Ga0495593_0050629 | |||
| 941 | Ga0495602_0011830 | |||
| 942 | Ga0495626_0000006 | |||
| 943 | Ga0495626_0000266 | |||
| 944 | Ga0495626_0001873 | |||
| 945 | Ga0495626_0006582 | |||
| 946 | Ga0496100_0219910 | |||
| 947 | Ga0496101_0319156 | |||
| 948 | Ga0496102_0000074 | |||
| 949 | Ga0496102_0000508 | |||
| 950 | Ga0496102_0011405 | |||
| 951 | Ga0496102_0086422 | |||
| 952 | Ga0496103_0124198 | |||
| 953 | Ga0496104_0287479 | |||
| 954 | Ga0496106_0008808 | |||
| 955 | Ga0496107_0155437 | |||
| 956 | Ga0496110_0000369 | |||
| 957 | Ga0496110_0144897 | |||
| 958 | Ga0496113_0115572 | |||
| 959 | Ga0496114_0008112 | |||
| 960 | Ga0496114_0159456 | |||
| 961 | Ga0496115_0086807 | |||
| 962 | Ga0496117_0013588 | |||
| 963 | Ga0496117_0013627 | |||
| 964 | Ga0496118_0005148 | |||
| 965 | Ga0496118_0030110 | |||
| 966 | Ga0496121_0003212 | |||
| 967 | Ga0496121_0117414 | |||
| 968 | Ga0496122_0012026 | |||
| 969 | Ga0496123_0005152 | |||
| 970 | Ga0496123_0066829 | |||
| 971 | Ga0496124_0013346 | |||
| 972 | Ga0496124_0084102 | |||
| 973 | Ga0496124_0193375 | |||
| 974 | Ga0496125_0001798 | |||
| 975 | Ga0496125_0003328 | |||
| 976 | Ga0496125_0016244 | |||
| 977 | Ga0496125_0036527 | |||
| 978 | Ga0496125_0057178 | |||
| 979 | Ga0496126_0025019 | |||
| 980 | Ga0496126_0201639 | |||
| 981 | Ga0495678_000113 | |||
| 982 | Ga0495678_011861 | |||
| 983 | Ga0495682_0053393 | |||
| 984 | Ga0501039_0155410 | |||
| 985 | Ga0501075_0145638 | |||
| 986 | Ga0501081_0035566 | |||
| 987 | Ga0501044_0140724 | |||
| 988 | Ga0501045_0008406 | |||
| 989 | nmdc:mga07m45_2812_c1 | |||
| 990 | nmdc:mga07m45_6121_c1 | |||
| 991 | nmdc:mga07m45_70985_c1 | |||
| 992 | nmdc:mga07m45_840_c1 | |||
| 993 | nmdc:mga06r32_55041_c1 | |||
| 994 | nmdc:mga08y16_183830_c1 | |||
| 995 | Ga0500571_000935 | |||
| 996 | Ga0500593_001648 | |||
| 997 | Ga0500607_009515 | |||
| 998 | Ga0500608_001188 | |||
| 999 | Ga0500634_0031818 | |||
| 1000 | Ga0530510_0077980 | |||
| 1001 | 2513721386 | |||
| 1002 | 2524442595 | |||
| 1003 | 2599626210 | |||
| 1004 | 2599675849 | |||
| 1005 | 2599682267 | |||
| 1006 | 2599695918 | |||
| 1007 | 2643797837 | |||
| 1008 | 2644029213 | |||
| 1009 | 2644326812 | |||
| 1010 | 2644399931 | |||
| 1011 | 2644473015 | |||
| 1012 | 2722882686 | |||
| 1013 | 2738721506 | |||
| 1014 | 2738880849 | |||
| 1015 | 2739281175 | |||
| 1016 | 2745074689 | |||
| 1017 | 2819601484 | |||
| 1018 | 2831272250 | |||
| 1019 | 2838059416 | |||
| 1020 | 2839142931 | |||
| 1021 | 2885202841 | |||
| 1022 | 2885216762 | |||
| 1023 | 2894025089 | |||
| 1024 | 2899930969 | |||
| 1025 | 2904544190 | |||
| 1026 | 2928040796 | |||
| 1027 | 2928047638 | |||
| 1028 | 2928055416 | |||
| 1029 | 2928069519 | |||
| 1030 | 2928075540 | |||
| 1031 | 2929162238 | |||
| 1032 | 2945909614 | |||
| 1033 | 2945988410 | |||
| 1034 | 8047677837 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pg0-assembly1.cif.gz_A | crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus | 0.9572 | 6 | 381 |
| 1ivh-assembly1.cif.gz_B | structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity | 0.9506 | 9 | 381 |
| 5lnx-assembly2.cif.gz_E | crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. | 0.9495 | 14 | 381 |
| 5lnx-assembly1.cif.gz_C | crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. | 0.9494 | 18 | 381 |
| 2dvl-assembly1.cif.gz_A | crystal structure of project tt0160 from thermus thermophilus hb8 | 0.949 | 10 | 381 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P28330_285_428_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9773 | 241 | 381 | 1.20.140.10 |
| 4n5fB02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.976 | 124 | 230 | 2.40.110.10 |
| af_O33229_243_386_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9712 | 241 | 381 | 1.20.140.10 |
| af_M0RAD8_170_241_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9639 | 124 | 192 | 2.40.110.10 |
| af_Q6NWF0_171_282_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9638 | 126 | 237 | 2.40.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J2TNM5-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9901 | 1 | 208 |
GO:0006552
GO:0008470 GO:0050660 |
| AF-A0A5B8BFN9-F1-model_v4 | Acyl-[acyl-carrier-protein] dehydrogenase MbtN (Mycobactin synthase protein N) | 0.9846 | 17 | 382 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A807AT07-F1-model_v4 | deleted | 0.9846 | 17 | 382 |
|
| AF-A0A849C9G4-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9838 | 10 | 382 |
GO:0003995
GO:0050660 |
| AF-A0A1H4L011-F1-model_v4 | Acyl-[acyl-carrier-protein] dehydrogenase MbtN (Mycobactin synthase protein N) | 0.9819 | 12 | 382 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |