F458148

General Info

Members Datasets Scaffolds Average Seq Length
517 247 1034 334

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100035593|Ga0307408_1000355934
Length 327
Sequence MGGDDAPARIIDGALAAARHLDLALILVGPSDAIQGELSNHRDTDVLGLQIVDAPDVVGMGEPPALALRRKPRASIRVAADLVAQGRADALFSAGNTGATLVAASSALGLLPGVDRPALATAIPTRQKPAVLLDAGANAECRPQHLLQFAAMGTVYAQVALGVDAPRVGLLSIGEEETKGNDLIREAHRLMKGLPRFIGNVEGRDVYAGEADVIVCDGFTGNVALKISEGLVDTIEHLLGEELQSTFTSSVGYLLSLRAFRRFRKRVDYSEYGGAPLLGVKGLCIVGHGRSSAKAIRNAIAMAHRFATQDFIRRLEQGIAAVSVHEH

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0
Rhizoplane 4.45
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100035593 3300031548 Bacteria 3495
2 Ga0065712_10068483 3300005290 Bacteria 10359
3 Ga0065712_10111073 3300005290 Bacteria 1824
4 Ga0065715_10000325 3300005293 Bacteria 14133
5 Ga0065715_10022114 3300005293 Bacteria 1940
6 Ga0070676_10028284 3300005328 Bacteria 3183
7 Ga0070683_100108054 3300005329 Bacteria 2623
8 Ga0070683_100171275 3300005329 Bacteria 2061
9 Ga0070690_100004070 3300005330 Bacteria 8097
10 Ga0070670_100014202 3300005331 Bacteria 6833
11 Ga0070670_100018161 3300005331 Bacteria 6035
12 Ga0070677_10001081 3300005333 Bacteria 8788
13 Ga0068869_100009411 3300005334 Bacteria 6340
14 Ga0070666_10004789 3300005335 Bacteria 8274
15 Ga0070680_100267536 3300005336 Bacteria 1447
16 Ga0068868_100020038 3300005338 Bacteria 5018
17 Ga0068868_100149243 3300005338 Bacteria 1924
18 Ga0070689_100022852 3300005340 Bacteria 4675
19 Ga0070689_100037792 3300005340 Bacteria 3692
20 Ga0070691_10022933 3300005341 Bacteria 2897
21 Ga0070687_100046428 3300005343 Bacteria 2223
22 Ga0070661_100057941 3300005344 Bacteria 2838
23 Ga0070661_100082015 3300005344 Bacteria 2382
24 Ga0070669_100001792 3300005353 Bacteria 15431
25 Ga0070669_100014658 3300005353 Bacteria 5580
26 Ga0070669_100018415 3300005353 Bacteria 4991
27 Ga0070669_100043754 3300005353 Bacteria 3262
28 Ga0070669_100053774 3300005353 Bacteria 2948
29 Ga0070669_100084736 3300005353 Bacteria 2366
30 Ga0070669_100257359 3300005353 Bacteria 1392
31 Ga0070669_100262791 3300005353 Bacteria 1378
32 Ga0070675_100000062 3300005354 Bacteria 66400
33 Ga0070675_100022530 3300005354 Bacteria 5035
34 Ga0070675_100037358 3300005354 Bacteria 3955
35 Ga0070675_100215767 3300005354 Bacteria 1669
36 Ga0070671_100153509 3300005355 Bacteria 1945
37 Ga0070674_100001313 3300005356 Bacteria 13069
38 Ga0070674_100003652 3300005356 Bacteria 8667
39 Ga0070674_100024606 3300005356 Bacteria 3910
40 Ga0070674_100087527 3300005356 Bacteria 2240
41 Ga0070673_100025841 3300005364 Bacteria 4329
42 Ga0070673_100054825 3300005364 Bacteria 3138
43 Ga0070673_100301298 3300005364 Bacteria 1411
44 Ga0070673_100400899 3300005364 Bacteria 1227
45 Ga0070688_100001393 3300005365 Bacteria 12037
46 Ga0070688_100006709 3300005365 Bacteria 6167
47 Ga0070688_100079386 3300005365 Bacteria 2120
48 Ga0070688_100140574 3300005365 Bacteria 1639
49 Ga0070659_100015827 3300005366 Bacteria 5655
50 Ga0070659_100019710 3300005366 Bacteria 5117
51 Ga0070659_100206230 3300005366 Bacteria 1619
52 Ga0070701_10001039 3300005438 Bacteria 10122
53 Ga0070701_10007907 3300005438 Bacteria 4571
54 Ga0070701_10106499 3300005438 Bacteria 1561
55 Ga0070711_100039075 3300005439 Unclassified 3194
56 Ga0070705_100024229 3300005440 Bacteria 3273
57 Ga0070705_100050565 3300005440 Bacteria 2418
58 Ga0070705_100143732 3300005440 Bacteria 1574
59 Ga0070700_100024696 3300005441 Bacteria 3532
60 Ga0070700_100093576 3300005441 Bacteria 1966
61 Ga0070700_100204947 3300005441 Unclassified 1388
62 Ga0070694_100001620 3300005444 Bacteria 13227
63 Ga0070681_10013065 3300005458 Bacteria 8245
64 Ga0068867_100026213 3300005459 Bacteria 4185
65 Ga0068867_100044202 3300005459 Bacteria 3262
66 Ga0068867_100052706 3300005459 Bacteria 3003
67 Ga0070685_10005190 3300005466 Bacteria 6603
68 Ga0070706_100275514 3300005467 Bacteria 1570
69 Ga0070698_100002831 3300005471 Bacteria 19089
70 Ga0070698_100074638 3300005471 Bacteria 3397
71 Ga0070698_100079617 3300005471 Bacteria 3273
72 Ga0070699_100000611 3300005518 Bacteria 33730
73 Ga0070699_100005560 3300005518 Bacteria 11051
74 Ga0070699_100123184 3300005518 Bacteria 2281
75 Ga0070699_100126521 3300005518 Bacteria 2250
76 Ga0070679_100083842 3300005530 Bacteria 3175
77 Ga0070697_100062973 3300005536 Bacteria 3028
78 Ga0068853_100445582 3300005539 Bacteria 1217
79 Ga0070672_100034103 3300005543 Bacteria 3861
80 Ga0070672_100120635 3300005543 Bacteria 2146
81 Ga0070672_100195274 3300005543 Bacteria 1691
82 Ga0070686_100052166 3300005544 Bacteria 2607
83 Ga0070686_100053036 3300005544 Bacteria 2587
84 Ga0070695_100021040 3300005545 Bacteria 3987
85 Ga0070695_100116397 3300005545 Bacteria 1822
86 Ga0070696_100034908 3300005546 Bacteria 3462
87 Ga0070696_100065300 3300005546 Bacteria 2551
88 Ga0070696_100120267 3300005546 Bacteria 1900
89 Ga0070693_100030253 3300005547 Bacteria 2959
90 Ga0070665_100067217 3300005548 Bacteria 3594
91 Ga0070665_100251813 3300005548 Bacteria 1767
92 Ga0070704_100174463 3300005549 Bacteria 1713
93 Ga0070664_100001279 3300005564 Bacteria 20137
94 Ga0070664_100033033 3300005564 Bacteria 4330
95 Ga0070664_100339169 3300005564 Bacteria 1365
96 Ga0068857_100052688 3300005577 Bacteria 3609
97 Ga0068857_100146059 3300005577 Unclassified 2140
98 Ga0070702_100003512 3300005615 Bacteria 7023
99 Ga0068852_100037812 3300005616 Bacteria 4051
100 Ga0068852_100090872 3300005616 Bacteria 2731
101 Ga0068852_100091855 3300005616 Bacteria 2718
102 Ga0068859_100048306 3300005617 Bacteria 4275
103 Ga0068859_100082750 3300005617 Bacteria 3252
104 Ga0068859_100126435 3300005617 Bacteria 2625
105 Ga0068859_100198079 3300005617 Bacteria 2093
106 Ga0068864_100003876 3300005618 Bacteria 12315
107 Ga0068866_10092934 3300005718 Bacteria 1647
108 Ga0068861_100002821 3300005719 Bacteria 11425
109 Ga0068861_100195264 3300005719 Bacteria 1695
110 Ga0068861_100277172 3300005719 Bacteria 1442
111 Ga0068870_10133077 3300005840 Bacteria 1447
112 Ga0068863_100011298 3300005841 Bacteria 8647
113 Ga0068858_100008840 3300005842 Bacteria 9661
114 Ga0068860_100018175 3300005843 Bacteria 6843
115 Ga0068860_100025169 3300005843 Bacteria 5743
116 Ga0068860_100207520 3300005843 Bacteria 1900
117 Ga0068862_100006321 3300005844 Bacteria 9850
118 Ga0068862_100150778 3300005844 Bacteria 2069
119 Ga0068862_100219040 3300005844 Bacteria 1722
120 Ga0068862_100300097 3300005844 Bacteria 1478
121 Ga0081455_10090065 3300005937 Bacteria 2488
122 Ga0081539_10000122 3300005985 Bacteria 183393
123 Ga0081539_10000251 3300005985 Bacteria 125220
124 Ga0081539_10001218 3300005985 Bacteria 45966
125 Ga0070717_10058199 3300006028 Bacteria 3196
126 Ga0075365_10032685 3300006038 Bacteria 3347
127 Ga0075368_10010274 3300006042 Bacteria 3382
128 Ga0075368_10055400 3300006042 Bacteria 1580
129 Ga0075364_10007707 3300006051 Bacteria 6407
130 Ga0075367_10009436 3300006178 Bacteria 5100
131 Ga0075366_10024419 3300006195 Bacteria 3526
132 Ga0097621_100055359 3300006237 Bacteria 3239
133 Ga0068871_100028598 3300006358 Bacteria 4372
134 Ga0068871_100092867 3300006358 Bacteria 2517
135 Ga0075428_100009840 3300006844 Bacteria 10626
136 Ga0075428_100016248 3300006844 Bacteria 8227
137 Ga0075428_100061889 3300006844 Bacteria 4099
138 Ga0075430_100062438 3300006846 Bacteria 3130
139 Ga0075430_100102277 3300006846 Bacteria 2392
140 Ga0075430_100120644 3300006846 Bacteria 2186
141 Ga0075431_100023079 3300006847 Bacteria 6361
142 Ga0075431_100026329 3300006847 Bacteria 5966
143 Ga0075431_100059914 3300006847 Bacteria 3928
144 Ga0075431_100114657 3300006847 Bacteria 2782
145 Ga0075433_10000117 3300006852 Bacteria 39826
146 Ga0075433_10001282 3300006852 Bacteria 18351
147 Ga0075433_10050216 3300006852 Bacteria 3631
148 Ga0075433_10286050 3300006852 Bacteria 1460
149 Ga0075434_100002292 3300006871 Bacteria 16732
150 Ga0075434_100007593 3300006871 Bacteria 10040
151 Ga0075434_100010983 3300006871 Bacteria 8518
152 Ga0075434_100021873 3300006871 Bacteria 6224
153 Ga0075434_100134207 3300006871 Bacteria 2495
154 Ga0075429_100054896 3300006880 Bacteria 3466
155 Ga0075429_100085418 3300006880 Bacteria 2751
156 Ga0075429_100110359 3300006880 Bacteria 2405
157 Ga0068865_100055299 3300006881 Bacteria 2761
158 Ga0068865_100068478 3300006881 Bacteria 2510
159 Ga0068865_100182618 3300006881 Bacteria 1616
160 Ga0075436_100012613 3300006914 Bacteria 5790
161 Ga0075436_100014612 3300006914 Bacteria 5381
162 Ga0075436_100038638 3300006914 Bacteria 3294
163 Ga0097620_100048302 3300006931 Bacteria 4275
164 Ga0097620_100082743 3300006931 Bacteria 3252
165 Ga0097620_100126431 3300006931 Bacteria 2625
166 Ga0097620_100198093 3300006931 Bacteria 2093
167 Ga0075435_100000213 3300007076 Bacteria 35518
168 Ga0075435_100000827 3300007076 Bacteria 19283
169 Ga0075435_100001069 3300007076 Bacteria 17407
170 Ga0075435_100012036 3300007076 Bacteria 6391
171 Ga0111539_10000058 3300009094 Bacteria 114638
172 Ga0111539_10007219 3300009094 Bacteria 14239
173 Ga0111539_10010856 3300009094 Bacteria 11461
174 Ga0111539_10035710 3300009094 Bacteria 6017
175 Ga0111539_10105828 3300009094 Bacteria 3300
176 Ga0111539_10545769 3300009094 Bacteria 1350
177 Ga0105245_10138902 3300009098 Bacteria 2287
178 Ga0105245_10144270 3300009098 Bacteria 2245
179 Ga0105245_10168478 3300009098 Bacteria 2084
180 Ga0114129_10000535 3300009147 Bacteria 46578
181 Ga0114129_10002137 3300009147 Bacteria 27257
182 Ga0114129_10006014 3300009147 Bacteria 17199
183 Ga0114129_10045936 3300009147 Bacteria 6138
184 Ga0114129_10046246 3300009147 Bacteria 6117
185 Ga0114129_10067088 3300009147 Bacteria 5004
186 Ga0114129_10141061 3300009147 Bacteria 3303
187 Ga0114129_10153230 3300009147 Bacteria 3154
188 Ga0114129_10162898 3300009147 Bacteria 3045
189 Ga0114129_10247616 3300009147 Bacteria 2394
190 Ga0105243_10199869 3300009148 Bacteria 1752
191 Ga0105243_10381646 3300009148 Bacteria 1303
192 Ga0105242_10043835 3300009176 Bacteria 3621
193 Ga0105248_10339064 3300009177 Bacteria 1692
194 Ga0105248_10643089 3300009177 Unclassified 1197
195 Ga0105249_10001171 3300009553 Bacteria 23227
196 Ga0105249_10105526 3300009553 Bacteria 2657
197 Ga0105249_10204879 3300009553 Bacteria 1932
198 Ga0163162_10036404 3300013306 Bacteria 4905
199 Ga0163162_10082174 3300013306 Bacteria 3293
200 Ga0157375_10010606 3300013308 Bacteria 8113
201 Ga0157375_10188432 3300013308 Bacteria 2217
202 Ga0163163_10127458 3300014325 Bacteria 2584
203 Ga0163163_10288420 3300014325 Bacteria 1693
204 Ga0157380_10010898 3300014326 Bacteria 6554
205 Ga0157380_10014108 3300014326 Bacteria 5840
206 Ga0157380_10039476 3300014326 Bacteria 3671
207 Ga0157380_10127682 3300014326 Bacteria 2164
208 Ga0157377_10001249 3300014745 Bacteria 10872
209 Ga0157377_10066412 3300014745 Bacteria 2073
210 Ga0157376_10082148 3300014969 Bacteria 2768
211 Ga0163161_10034260 3300017792 Bacteria 3632
212 Ga0207697_10000205 3300025315 Bacteria 31703
213 Ga0207642_10014496 3300025899 Bacteria 2911
214 Ga0207688_10001136 3300025901 Bacteria 13709
215 Ga0207688_10015008 3300025901 Bacteria 4203
216 Ga0207645_10000604 3300025907 Bacteria 29721
217 Ga0207645_10008866 3300025907 Bacteria 6986
218 Ga0207645_10018168 3300025907 Bacteria 4634
219 Ga0207643_10000334 3300025908 Bacteria 32146
220 Ga0207684_10183382 3300025910 Bacteria 1805
221 Ga0207684_10234302 3300025910 Bacteria 1584
222 Ga0207707_10010159 3300025912 Bacteria 8168
223 Ga0207660_10160507 3300025917 Bacteria 1734
224 Ga0207662_10000667 3300025918 Bacteria 15601
225 Ga0207662_10013498 3300025918 Bacteria 4568
226 Ga0207662_10031889 3300025918 Bacteria 3063
227 Ga0207662_10073744 3300025918 Bacteria 2071
228 Ga0207649_10037865 3300025920 Bacteria 2916
229 Ga0207681_10007040 3300025923 Bacteria 6903
230 Ga0207681_10013102 3300025923 Bacteria 5126
231 Ga0207681_10019398 3300025923 Bacteria 4296
232 Ga0207681_10085542 3300025923 Bacteria 2238
233 Ga0207681_10122813 3300025923 Bacteria 1907
234 Ga0207650_10015983 3300025925 Bacteria 5236
235 Ga0207650_10022225 3300025925 Bacteria 4489
236 Ga0207659_10000326 3300025926 Bacteria 28731
237 Ga0207659_10021868 3300025926 Bacteria 4253
238 Ga0207659_10024281 3300025926 Bacteria 4059
239 Ga0207659_10029703 3300025926 Bacteria 3728
240 Ga0207659_10030133 3300025926 Bacteria 3704
241 Ga0207659_10201521 3300025926 Bacteria 1590
242 Ga0207659_10262531 3300025926 Bacteria 1405
243 Ga0207687_10022631 3300025927 Bacteria 4184
244 Ga0207644_10386021 3300025931 Bacteria 1143
245 Ga0207690_10028674 3300025932 Bacteria 3529
246 Ga0207690_10149925 3300025932 Bacteria 1728
247 Ga0207706_10008688 3300025933 Bacteria 9357
248 Ga0207706_10016908 3300025933 Bacteria 6580
249 Ga0207706_10038711 3300025933 Bacteria 4230
250 Ga0207706_10163361 3300025933 Unclassified 1957
251 Ga0207706_10242851 3300025933 Bacteria 1574
252 Ga0207686_10030106 3300025934 Bacteria 3210
253 Ga0207709_10138222 3300025935 Bacteria 1671
254 Ga0207670_10108663 3300025936 Bacteria 1994
255 Ga0207670_10164802 3300025936 Bacteria 1658
256 Ga0207669_10002819 3300025937 Bacteria 7451
257 Ga0207669_10230492 3300025937 Bacteria 1366
258 Ga0207691_10011123 3300025940 Bacteria 8637
259 Ga0207691_10021456 3300025940 Bacteria 6098
260 Ga0207691_10025339 3300025940 Bacteria 5570
261 Ga0207691_10035031 3300025940 Bacteria 4664
262 Ga0207691_10041995 3300025940 Bacteria 4219
263 Ga0207691_10060422 3300025940 Bacteria 3444
264 Ga0207691_10070486 3300025940 Bacteria 3156
265 Ga0207689_10000493 3300025942 Bacteria 37382
266 Ga0207661_10087684 3300025944 Bacteria 2585
267 Ga0207679_10072449 3300025945 Bacteria 2602
268 Ga0207679_10081852 3300025945 Bacteria 2470
269 Ga0207679_10210825 3300025945 Unclassified 1629
270 Ga0207679_10263565 3300025945 Bacteria 1471
271 Ga0207651_10010783 3300025960 Bacteria 5081
272 Ga0207651_10017605 3300025960 Bacteria 4225
273 Ga0207651_10027647 3300025960 Bacteria 3566
274 Ga0207651_10047519 3300025960 Bacteria 2894
275 Ga0207712_10003379 3300025961 Bacteria 10090
276 Ga0207712_10090073 3300025961 Bacteria 2256
277 Ga0207668_10011800 3300025972 Bacteria 5324
278 Ga0207668_10222625 3300025972 Bacteria 1516
279 Ga0207640_10046375 3300025981 Bacteria 2796
280 Ga0207677_10038019 3300026023 Bacteria 3151
281 Ga0207703_10267216 3300026035 Bacteria 1548
282 Ga0207703_10377595 3300026035 Bacteria 1310
283 Ga0207708_10015032 3300026075 Bacteria 5801
284 Ga0207641_10002824 3300026088 Bacteria 15785
285 Ga0207641_10099660 3300026088 Bacteria 2557
286 Ga0207641_10394354 3300026088 Bacteria 1328
287 Ga0207648_10003160 3300026089 Bacteria 17361
288 Ga0207648_10021903 3300026089 Bacteria 5741
289 Ga0207648_10033482 3300026089 Bacteria 4533
290 Ga0207648_10077527 3300026089 Bacteria 2897
291 Ga0207648_10129601 3300026089 Bacteria 2220
292 Ga0207676_10041967 3300026095 Bacteria 3516
293 Ga0207676_10067187 3300026095 Bacteria 2863
294 Ga0207674_10022982 3300026116 Bacteria 6688
295 Ga0207674_10065267 3300026116 Bacteria 3670
296 Ga0207675_100005255 3300026118 Bacteria 12453
297 Ga0207675_100026643 3300026118 Bacteria 5381
298 Ga0207675_100109506 3300026118 Bacteria 2606
299 Ga0207675_100213769 3300026118 Bacteria 1856
300 Ga0207675_100217767 3300026118 Bacteria 1839
301 Ga0207675_100282798 3300026118 Bacteria 1612
302 Ga0207683_10013130 3300026121 Bacteria 7066
303 Ga0207683_10024122 3300026121 Bacteria 5235
304 Ga0207683_10195428 3300026121 Bacteria 1838
305 Ga0207698_10053132 3300026142 Bacteria 3108
306 Ga0209971_1003272 3300027682 Bacteria 3850
307 Ga0209813_10020575 3300027866 Bacteria 1847
308 Ga0207428_10001725 3300027907 Bacteria 22383
309 Ga0207428_10002555 3300027907 Bacteria 18177
310 Ga0207428_10030188 3300027907 Bacteria 4484
311 Ga0268266_10022834 3300028379 Bacteria 5326
312 Ga0268265_10011824 3300028380 Bacteria 5901
313 Ga0268265_10127981 3300028380 Bacteria 2105
314 Ga0268265_10237544 3300028380 Bacteria 1606
315 Ga0268265_10247757 3300028380 Bacteria 1576
316 Ga0268264_10070352 3300028381 Bacteria 2962
317 Ga0265316_10000038 3300031344 Bacteria 148947
318 Ga0307408_100128505 3300031548 Bacteria 1974
319 Ga0307405_10008417 3300031731 Bacteria 5228
320 Ga0307405_10347784 3300031731 Bacteria 1142
321 Ga0307413_10232310 3300031824 Bacteria 1355
322 Ga0307410_10057718 3300031852 Bacteria 2644
323 Ga0307410_10201644 3300031852 Bacteria 1519
324 Ga0307406_10022478 3300031901 Bacteria 3742
325 Ga0307406_10243034 3300031901 Bacteria 1351
326 Ga0307407_10009292 3300031903 Bacteria 4569
327 Ga0307407_10012909 3300031903 Bacteria 4036
328 Ga0307412_10094971 3300031911 Bacteria 2095
329 Ga0307409_100011625 3300031995 Bacteria 5563
330 Ga0307409_100012291 3300031995 Bacteria 5449
331 Ga0307416_100137965 3300032002 Bacteria 2210
332 Ga0307416_100142712 3300032002 Bacteria 2180
333 Ga0307416_100178683 3300032002 Bacteria 1986
334 Ga0307416_100428305 3300032002 Bacteria 1369
335 Ga0307414_10007490 3300032004 Bacteria 6133
336 Ga0307414_10084127 3300032004 Bacteria 2339
337 Ga0307411_10099403 3300032005 Bacteria 2053
338 Ga0307411_10141207 3300032005 Bacteria 1776
339 Ga0307415_100073514 3300032126 Bacteria 2412
340 Ga0307415_100106629 3300032126 Bacteria 2069
341 Ga0316592_1014362 3300033524 Bacteria 1642
342 Ga0373944_0053944 3300035089 Unclassified 1274
343 Ga0373949_0027473 3300035090 Bacteria 1338
344 Ga0373923_0067025 3300035111 Bacteria 1535
345 Ga0373932_0004060 3300035112 Bacteria 3480
346 Ga0373953_0044515 3300035117 Bacteria 1775
347 Ga0373954_0134227 3300035118 Bacteria 1206
348 Ga0373955_0007578 3300035172 Bacteria 4997
349 Ga0373955_0207848 3300035172 Bacteria 1167
350 Ga0373961_0037316 3300035241 Bacteria 1387
351 Ga0373962_0025860 3300035242 Bacteria 1578
352 Ga0373924_0014606 3300035410 Bacteria 2970
353 Ga0373931_0013690 3300035691 Bacteria 3954
354 Ga0373935_0006632 3300035692 Bacteria 6916
355 Ga0373947_0014829 3300035725 Bacteria 4472
356 Ga0373947_0032589 3300035725 Bacteria 3072
357 Ga0373937_0469569 3300036401 Bacteria 1195
358 Ga0373925_0043565 3300037068 Bacteria 3332
359 Ga0450920_029924 3300042122 Bacteria 1070
360 Ga0439435_0003908 3300042436 Bacteria 3156
361 Ga0439444_0013941 3300042437 Bacteria 1338
362 Ga0453684_0327436 3300044712 Bacteria 1733
363 Ga0453684_0405895 3300044712 Bacteria 1525
364 Ga0451576_0166014 3300045051 Bacteria 2304
365 Ga0451576_0302055 3300045051 Bacteria 1674
366 Ga0495603_0024184 3300046455 Bacteria 3673
367 Ga0495629_0002195 3300046459 Bacteria 15059
368 Ga0495580_0074470 3300046472 Bacteria 2370
369 Ga0495594_0150019 3300046499 Unclassified 1323
370 Ga0495630_0001984 3300046517 Bacteria 14253
371 Ga0495643_0001737 3300046522 Bacteria 18806
372 Ga0495663_0021070 3300046525 Bacteria 1875
373 Ga0495652_0080665 3300046529 Bacteria 2687
374 Ga0495587_0024336 3300046536 Bacteria 3712
375 Ga0495598_0005129 3300046537 Bacteria 2885
376 Ga0495621_0012771 3300046539 Bacteria 2625
377 Ga0495645_0115133 3300046543 Bacteria 1899
378 Ga0495656_0027806 3300046615 Bacteria 2262
379 Ga0495659_0007226 3300046664 Bacteria 3518
380 Ga0495647_0025064 3300046681 Bacteria 2176
381 Ga0495658_0046465 3300046683 Bacteria 2441
382 Ga0495669_0022154 3300046684 Bacteria 2760
383 Ga0495613_0000670 3300046689 Bacteria 27111
384 Ga0495670_0012530 3300046691 Bacteria 4172
385 Ga0495604_0013542 3300047317 Bacteria 6503
386 Ga0495604_0095198 3300047317 Bacteria 2200
387 Ga0495636_0011703 3300047318 Bacteria 3475
388 Ga0495674_0016506 3300047319 Bacteria 6888
389 Ga0495674_0183236 3300047319 Bacteria 1743
390 Ga0495684_0001265 3300047471 Bacteria 20345
391 Ga0495684_0164642 3300047471 Bacteria 1652
392 Ga0496101_0351497 3300048904 Bacteria 1158
393 Ga0496102_0158788 3300048905 Bacteria 2126
394 Ga0496104_0039638 3300048907 Bacteria 4411
395 Ga0496105_0128714 3300048908 Bacteria 2088
396 Ga0496106_0026388 3300048909 Bacteria 4326
397 Ga0496106_0073146 3300048909 Bacteria 2622
398 Ga0496107_0282155 3300048910 Unclassified 1236
399 Ga0496107_0290475 3300048910 Bacteria 1217
400 Ga0496108_0014978 3300048911 Bacteria 6329
401 Ga0496108_0158367 3300048911 Bacteria 1956
402 Ga0496109_0001043 3300048912 Bacteria 22931
403 Ga0496109_0034432 3300048912 Bacteria 4561
404 Ga0496109_0069597 3300048912 Bacteria 3228
405 Ga0496109_0102297 3300048912 Bacteria 2659
406 Ga0496110_0006861 3300048913 Bacteria 9050
407 Ga0496110_0113566 3300048913 Bacteria 2436
408 Ga0496110_0324144 3300048913 Bacteria 1403
409 Ga0496112_0001272 3300048915 Bacteria 19131
410 Ga0496112_0053427 3300048915 Bacteria 3968
411 Ga0496112_0186746 3300048915 Bacteria 2036
412 Ga0496112_0504723 3300048915 Bacteria 1145
413 Ga0496114_0024417 3300048917 Bacteria 4934
414 Ga0496114_0225028 3300048917 Bacteria 1647
415 Ga0501031_0086960 3300049568 Bacteria 2038
416 Ga0501034_0027983 3300049571 Bacteria 5732
417 Ga0501038_0296555 3300049574 Bacteria 1269
418 Ga0501039_0014541 3300049575 Bacteria 6026
419 Ga0501039_0150802 3300049575 Bacteria 1826
420 Ga0501040_0060254 3300049576 Bacteria 2608
421 Ga0501040_0073522 3300049576 Bacteria 2362
422 Ga0501041_0005873 3300049577 Bacteria 7177
423 Ga0501041_0255823 3300049577 Bacteria 1101
424 Ga0501042_0015569 3300049578 Bacteria 5209
425 Ga0501042_0027928 3300049578 Bacteria 3971
426 Ga0501046_0022878 3300049580 Bacteria 5147
427 Ga0501047_0009177 3300049581 Bacteria 9339
428 Ga0501067_0033419 3300049583 Bacteria 2854
429 Ga0501068_0051929 3300049584 Bacteria 2481
430 Ga0501068_0125305 3300049584 Bacteria 1604
431 Ga0501071_0031349 3300049587 Bacteria 3768
432 Ga0501072_0008763 3300049588 Bacteria 7680
433 Ga0501072_0025591 3300049588 Bacteria 4597
434 Ga0501072_0129376 3300049588 Bacteria 2012
435 Ga0501072_0149979 3300049588 Bacteria 1859
436 Ga0501075_0025060 3300049591 Bacteria 4380
437 Ga0501075_0037289 3300049591 Bacteria 3631
438 Ga0501076_0037053 3300049592 Bacteria 3823
439 Ga0501076_0284845 3300049592 Bacteria 1354
440 Ga0501077_0113012 3300049593 Bacteria 1722
441 Ga0501077_0115482 3300049593 Bacteria 1702
442 Ga0501079_0004415 3300049741 Bacteria 10415
443 Ga0501079_0005257 3300049741 Bacteria 9626
444 Ga0501080_0049534 3300049742 Bacteria 3910
445 Ga0501080_0205820 3300049742 Bacteria 1805
446 Ga0501081_0005698 3300049743 Bacteria 8061
447 Ga0501044_0016786 3300049823 Bacteria 7858
448 Ga0501045_0025814 3300049824 Bacteria 4224
449 Ga0501045_0147554 3300049824 Bacteria 1750
450 nmdc:mga0yw44_50130_c1 3300050492 Bacteria 2523
451 nmdc:mga0k408_19578_c1 3300050493 Bacteria 3784
452 nmdc:mga0k408_204000_c1 3300050493 Unclassified 1180
453 nmdc:mga04h51_24636_c1 3300050495 Bacteria 1845
454 nmdc:mga07m45_68464_c1 3300050496 Bacteria 2018
455 nmdc:mga05p37_12676_c1 3300050507 Bacteria 10071
456 nmdc:mga05p37_172120_c1 3300050507 Bacteria 2640
457 nmdc:mga05p37_186155_c1 3300050507 Bacteria 2524
458 nmdc:mga05p37_194792_c1 3300050507 Bacteria 2458
459 nmdc:mga05p37_32865_c1 3300050507 Bacteria 6350
460 nmdc:mga05p37_67071_c1 3300050507 Bacteria 4414
461 nmdc:mga05p37_7276_c1 3300050507 Bacteria 13060
462 nmdc:mga09592_12297_c1 3300050508 Bacteria 6969
463 nmdc:mga09592_215781_c1 3300050508 Bacteria 1662
464 nmdc:mga09592_39190_c1 3300050508 Bacteria 2341
465 nmdc:mga0qj67_6509_c1 3300050509 Bacteria 8581
466 nmdc:mga06r32_233799_c1 3300050510 Bacteria 1826
467 nmdc:mga06r32_26371_c1 3300050510 Bacteria 5417
468 nmdc:mga06r32_28874_c1 3300050510 Bacteria 5193
469 nmdc:mga06r32_59791_c1 3300050510 Bacteria 3666
470 nmdc:mga08y16_111555_c1 3300050511 Bacteria 2847
471 nmdc:mga08y16_132557_c1 3300050511 Bacteria 2591
472 nmdc:mga08y16_35905_c1 3300050511 Bacteria 5206
473 nmdc:mga08y16_51725_c1 3300050511 Bacteria 4299
474 nmdc:mga08y16_635_c1 3300050511 Bacteria 32952
475 nmdc:mga08y16_78778_c1 3300050511 Bacteria 3435
476 nmdc:mga0n895_11942_c1 3300050512 Bacteria 7773
477 nmdc:mga0n895_15313_c1 3300050512 Bacteria 6987
478 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
479 nmdc:mga0n895_55668_c1 3300050512 Bacteria 3893
480 nmdc:mga0n895_693_c1 3300050512 Bacteria 23625
481 nmdc:mga0rr50_2985_c1 3300050513 Bacteria 9671
482 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
483 nmdc:mga0rr50_60871_c1 3300050513 Bacteria 2842
484 nmdc:mga0rr50_84956_c1 3300050513 Bacteria 2452
485 nmdc:mga0rr50_9301_c1 3300050513 Bacteria 6172
486 nmdc:mga08x19_11892_c1 3300050514 Bacteria 5236
487 nmdc:mga08x19_13924_c1 3300050514 Bacteria 4872
488 nmdc:mga0a205_1202_c1 3300050515 Bacteria 21664
489 nmdc:mga0a205_163749_c1 3300050515 Bacteria 2120
490 nmdc:mga0a205_2224_c1 3300050515 Bacteria 17074
491 nmdc:mga0a205_252350_c1 3300050515 Bacteria 1643
492 nmdc:mga0a205_309314_c1 3300050515 Bacteria 1452
493 nmdc:mga0a205_47_c1 3300050515 Bacteria 65667
494 nmdc:mga0a205_64579_c1 3300050515 Bacteria 3536
495 nmdc:mga0a205_65500_c1 3300050515 Bacteria 3511
496 Ga0495601_0006207 3300053077 Bacteria 6980
497 Ga0495601_0042481 3300053077 Bacteria 2852
498 Ga0495601_0142181 3300053077 Bacteria 1565
499 Ga0495595_0014200 3300053084 Bacteria 3375
500 Ga0495619_0003773 3300053085 Bacteria 9744
501 Ga0495619_0229992 3300053085 Bacteria 1284
502 Ga0501084_0030995 3300054114 Bacteria 4472
503 Ga0501084_0072624 3300054114 Bacteria 2882
504 Ga0590071_000098 3300059421 Bacteria 24382
505 Ga0590071_027448 3300059421 Bacteria 1351
506 Ga0590074_000172 3300059423 Bacteria 7999
507 Ga0590074_001437 3300059423 Bacteria 3837
508 Ga0590075_000178 3300059424 Bacteria 17593
509 Ga0590075_001427 3300059424 Bacteria 5984
510 Ga0590075_003279 3300059424 Bacteria 3855
511 Ga0590075_007469 3300059424 Bacteria 2598
512 Ga0590077_000133 3300059426 Bacteria 20027
513 Ga0590077_000922 3300059426 Bacteria 7493
514 Ga0590077_003200 3300059426 Bacteria 3408
515 Ga0501082_0025389 3300060353 Bacteria 5106
516 Ga0501082_0106945 3300060353 Bacteria 2420
517 Ga0530510_0007138 3300061734 Bacteria 7775
518 Ga0307408_100035593
519 Ga0065712_10068483
520 Ga0065712_10111073
521 Ga0065715_10000325
522 Ga0065715_10022114
523 Ga0070676_10028284
524 Ga0070683_100108054
525 Ga0070683_100171275
526 Ga0070690_100004070
527 Ga0070670_100014202
528 Ga0070670_100018161
529 Ga0070677_10001081
530 Ga0068869_100009411
531 Ga0070666_10004789
532 Ga0070680_100267536
533 Ga0068868_100020038
534 Ga0068868_100149243
535 Ga0070689_100022852
536 Ga0070689_100037792
537 Ga0070691_10022933
538 Ga0070687_100046428
539 Ga0070661_100057941
540 Ga0070661_100082015
541 Ga0070669_100001792
542 Ga0070669_100014658
543 Ga0070669_100018415
544 Ga0070669_100043754
545 Ga0070669_100053774
546 Ga0070669_100084736
547 Ga0070669_100257359
548 Ga0070669_100262791
549 Ga0070675_100000062
550 Ga0070675_100022530
551 Ga0070675_100037358
552 Ga0070675_100215767
553 Ga0070671_100153509
554 Ga0070674_100001313
555 Ga0070674_100003652
556 Ga0070674_100024606
557 Ga0070674_100087527
558 Ga0070673_100025841
559 Ga0070673_100054825
560 Ga0070673_100301298
561 Ga0070673_100400899
562 Ga0070688_100001393
563 Ga0070688_100006709
564 Ga0070688_100079386
565 Ga0070688_100140574
566 Ga0070659_100015827
567 Ga0070659_100019710
568 Ga0070659_100206230
569 Ga0070701_10001039
570 Ga0070701_10007907
571 Ga0070701_10106499
572 Ga0070711_100039075
573 Ga0070705_100024229
574 Ga0070705_100050565
575 Ga0070705_100143732
576 Ga0070700_100024696
577 Ga0070700_100093576
578 Ga0070700_100204947
579 Ga0070694_100001620
580 Ga0070681_10013065
581 Ga0068867_100026213
582 Ga0068867_100044202
583 Ga0068867_100052706
584 Ga0070685_10005190
585 Ga0070706_100275514
586 Ga0070698_100002831
587 Ga0070698_100074638
588 Ga0070698_100079617
589 Ga0070699_100000611
590 Ga0070699_100005560
591 Ga0070699_100123184
592 Ga0070699_100126521
593 Ga0070679_100083842
594 Ga0070697_100062973
595 Ga0068853_100445582
596 Ga0070672_100034103
597 Ga0070672_100120635
598 Ga0070672_100195274
599 Ga0070686_100052166
600 Ga0070686_100053036
601 Ga0070695_100021040
602 Ga0070695_100116397
603 Ga0070696_100034908
604 Ga0070696_100065300
605 Ga0070696_100120267
606 Ga0070693_100030253
607 Ga0070665_100067217
608 Ga0070665_100251813
609 Ga0070704_100174463
610 Ga0070664_100001279
611 Ga0070664_100033033
612 Ga0070664_100339169
613 Ga0068857_100052688
614 Ga0068857_100146059
615 Ga0070702_100003512
616 Ga0068852_100037812
617 Ga0068852_100090872
618 Ga0068852_100091855
619 Ga0068859_100048306
620 Ga0068859_100082750
621 Ga0068859_100126435
622 Ga0068859_100198079
623 Ga0068864_100003876
624 Ga0068866_10092934
625 Ga0068861_100002821
626 Ga0068861_100195264
627 Ga0068861_100277172
628 Ga0068870_10133077
629 Ga0068863_100011298
630 Ga0068858_100008840
631 Ga0068860_100018175
632 Ga0068860_100025169
633 Ga0068860_100207520
634 Ga0068862_100006321
635 Ga0068862_100150778
636 Ga0068862_100219040
637 Ga0068862_100300097
638 Ga0081455_10090065
639 Ga0081539_10000122
640 Ga0081539_10000251
641 Ga0081539_10001218
642 Ga0070717_10058199
643 Ga0075365_10032685
644 Ga0075368_10010274
645 Ga0075368_10055400
646 Ga0075364_10007707
647 Ga0075367_10009436
648 Ga0075366_10024419
649 Ga0097621_100055359
650 Ga0068871_100028598
651 Ga0068871_100092867
652 Ga0075428_100009840
653 Ga0075428_100016248
654 Ga0075428_100061889
655 Ga0075430_100062438
656 Ga0075430_100102277
657 Ga0075430_100120644
658 Ga0075431_100023079
659 Ga0075431_100026329
660 Ga0075431_100059914
661 Ga0075431_100114657
662 Ga0075433_10000117
663 Ga0075433_10001282
664 Ga0075433_10050216
665 Ga0075433_10286050
666 Ga0075434_100002292
667 Ga0075434_100007593
668 Ga0075434_100010983
669 Ga0075434_100021873
670 Ga0075434_100134207
671 Ga0075429_100054896
672 Ga0075429_100085418
673 Ga0075429_100110359
674 Ga0068865_100055299
675 Ga0068865_100068478
676 Ga0068865_100182618
677 Ga0075436_100012613
678 Ga0075436_100014612
679 Ga0075436_100038638
680 Ga0097620_100048302
681 Ga0097620_100082743
682 Ga0097620_100126431
683 Ga0097620_100198093
684 Ga0075435_100000213
685 Ga0075435_100000827
686 Ga0075435_100001069
687 Ga0075435_100012036
688 Ga0111539_10000058
689 Ga0111539_10007219
690 Ga0111539_10010856
691 Ga0111539_10035710
692 Ga0111539_10105828
693 Ga0111539_10545769
694 Ga0105245_10138902
695 Ga0105245_10144270
696 Ga0105245_10168478
697 Ga0114129_10000535
698 Ga0114129_10002137
699 Ga0114129_10006014
700 Ga0114129_10045936
701 Ga0114129_10046246
702 Ga0114129_10067088
703 Ga0114129_10141061
704 Ga0114129_10153230
705 Ga0114129_10162898
706 Ga0114129_10247616
707 Ga0105243_10199869
708 Ga0105243_10381646
709 Ga0105242_10043835
710 Ga0105248_10339064
711 Ga0105248_10643089
712 Ga0105249_10001171
713 Ga0105249_10105526
714 Ga0105249_10204879
715 Ga0163162_10036404
716 Ga0163162_10082174
717 Ga0157375_10010606
718 Ga0157375_10188432
719 Ga0163163_10127458
720 Ga0163163_10288420
721 Ga0157380_10010898
722 Ga0157380_10014108
723 Ga0157380_10039476
724 Ga0157380_10127682
725 Ga0157377_10001249
726 Ga0157377_10066412
727 Ga0157376_10082148
728 Ga0163161_10034260
729 Ga0207697_10000205
730 Ga0207642_10014496
731 Ga0207688_10001136
732 Ga0207688_10015008
733 Ga0207645_10000604
734 Ga0207645_10008866
735 Ga0207645_10018168
736 Ga0207643_10000334
737 Ga0207684_10183382
738 Ga0207684_10234302
739 Ga0207707_10010159
740 Ga0207660_10160507
741 Ga0207662_10000667
742 Ga0207662_10013498
743 Ga0207662_10031889
744 Ga0207662_10073744
745 Ga0207649_10037865
746 Ga0207681_10007040
747 Ga0207681_10013102
748 Ga0207681_10019398
749 Ga0207681_10085542
750 Ga0207681_10122813
751 Ga0207650_10015983
752 Ga0207650_10022225
753 Ga0207659_10000326
754 Ga0207659_10021868
755 Ga0207659_10024281
756 Ga0207659_10029703
757 Ga0207659_10030133
758 Ga0207659_10201521
759 Ga0207659_10262531
760 Ga0207687_10022631
761 Ga0207644_10386021
762 Ga0207690_10028674
763 Ga0207690_10149925
764 Ga0207706_10008688
765 Ga0207706_10016908
766 Ga0207706_10038711
767 Ga0207706_10163361
768 Ga0207706_10242851
769 Ga0207686_10030106
770 Ga0207709_10138222
771 Ga0207670_10108663
772 Ga0207670_10164802
773 Ga0207669_10002819
774 Ga0207669_10230492
775 Ga0207691_10011123
776 Ga0207691_10021456
777 Ga0207691_10025339
778 Ga0207691_10035031
779 Ga0207691_10041995
780 Ga0207691_10060422
781 Ga0207691_10070486
782 Ga0207689_10000493
783 Ga0207661_10087684
784 Ga0207679_10072449
785 Ga0207679_10081852
786 Ga0207679_10210825
787 Ga0207679_10263565
788 Ga0207651_10010783
789 Ga0207651_10017605
790 Ga0207651_10027647
791 Ga0207651_10047519
792 Ga0207712_10003379
793 Ga0207712_10090073
794 Ga0207668_10011800
795 Ga0207668_10222625
796 Ga0207640_10046375
797 Ga0207677_10038019
798 Ga0207703_10267216
799 Ga0207703_10377595
800 Ga0207708_10015032
801 Ga0207641_10002824
802 Ga0207641_10099660
803 Ga0207641_10394354
804 Ga0207648_10003160
805 Ga0207648_10021903
806 Ga0207648_10033482
807 Ga0207648_10077527
808 Ga0207648_10129601
809 Ga0207676_10041967
810 Ga0207676_10067187
811 Ga0207674_10022982
812 Ga0207674_10065267
813 Ga0207675_100005255
814 Ga0207675_100026643
815 Ga0207675_100109506
816 Ga0207675_100213769
817 Ga0207675_100217767
818 Ga0207675_100282798
819 Ga0207683_10013130
820 Ga0207683_10024122
821 Ga0207683_10195428
822 Ga0207698_10053132
823 Ga0209971_1003272
824 Ga0209813_10020575
825 Ga0207428_10001725
826 Ga0207428_10002555
827 Ga0207428_10030188
828 Ga0268266_10022834
829 Ga0268265_10011824
830 Ga0268265_10127981
831 Ga0268265_10237544
832 Ga0268265_10247757
833 Ga0268264_10070352
834 Ga0265316_10000038
835 Ga0307408_100128505
836 Ga0307405_10008417
837 Ga0307405_10347784
838 Ga0307413_10232310
839 Ga0307410_10057718
840 Ga0307410_10201644
841 Ga0307406_10022478
842 Ga0307406_10243034
843 Ga0307407_10009292
844 Ga0307407_10012909
845 Ga0307412_10094971
846 Ga0307409_100011625
847 Ga0307409_100012291
848 Ga0307416_100137965
849 Ga0307416_100142712
850 Ga0307416_100178683
851 Ga0307416_100428305
852 Ga0307414_10007490
853 Ga0307414_10084127
854 Ga0307411_10099403
855 Ga0307411_10141207
856 Ga0307415_100073514
857 Ga0307415_100106629
858 Ga0316592_1014362
859 Ga0373944_0053944
860 Ga0373949_0027473
861 Ga0373923_0067025
862 Ga0373932_0004060
863 Ga0373953_0044515
864 Ga0373954_0134227
865 Ga0373955_0007578
866 Ga0373955_0207848
867 Ga0373961_0037316
868 Ga0373962_0025860
869 Ga0373924_0014606
870 Ga0373931_0013690
871 Ga0373935_0006632
872 Ga0373947_0014829
873 Ga0373947_0032589
874 Ga0373937_0469569
875 Ga0373925_0043565
876 Ga0450920_029924
877 Ga0439435_0003908
878 Ga0439444_0013941
879 Ga0453684_0327436
880 Ga0453684_0405895
881 Ga0451576_0166014
882 Ga0451576_0302055
883 Ga0495603_0024184
884 Ga0495629_0002195
885 Ga0495580_0074470
886 Ga0495594_0150019
887 Ga0495630_0001984
888 Ga0495643_0001737
889 Ga0495663_0021070
890 Ga0495652_0080665
891 Ga0495587_0024336
892 Ga0495598_0005129
893 Ga0495621_0012771
894 Ga0495645_0115133
895 Ga0495656_0027806
896 Ga0495659_0007226
897 Ga0495647_0025064
898 Ga0495658_0046465
899 Ga0495669_0022154
900 Ga0495613_0000670
901 Ga0495670_0012530
902 Ga0495604_0013542
903 Ga0495604_0095198
904 Ga0495636_0011703
905 Ga0495674_0016506
906 Ga0495674_0183236
907 Ga0495684_0001265
908 Ga0495684_0164642
909 Ga0496101_0351497
910 Ga0496102_0158788
911 Ga0496104_0039638
912 Ga0496105_0128714
913 Ga0496106_0026388
914 Ga0496106_0073146
915 Ga0496107_0282155
916 Ga0496107_0290475
917 Ga0496108_0014978
918 Ga0496108_0158367
919 Ga0496109_0001043
920 Ga0496109_0034432
921 Ga0496109_0069597
922 Ga0496109_0102297
923 Ga0496110_0006861
924 Ga0496110_0113566
925 Ga0496110_0324144
926 Ga0496112_0001272
927 Ga0496112_0053427
928 Ga0496112_0186746
929 Ga0496112_0504723
930 Ga0496114_0024417
931 Ga0496114_0225028
932 Ga0501031_0086960
933 Ga0501034_0027983
934 Ga0501038_0296555
935 Ga0501039_0014541
936 Ga0501039_0150802
937 Ga0501040_0060254
938 Ga0501040_0073522
939 Ga0501041_0005873
940 Ga0501041_0255823
941 Ga0501042_0015569
942 Ga0501042_0027928
943 Ga0501046_0022878
944 Ga0501047_0009177
945 Ga0501067_0033419
946 Ga0501068_0051929
947 Ga0501068_0125305
948 Ga0501071_0031349
949 Ga0501072_0008763
950 Ga0501072_0025591
951 Ga0501072_0129376
952 Ga0501072_0149979
953 Ga0501075_0025060
954 Ga0501075_0037289
955 Ga0501076_0037053
956 Ga0501076_0284845
957 Ga0501077_0113012
958 Ga0501077_0115482
959 Ga0501079_0004415
960 Ga0501079_0005257
961 Ga0501080_0049534
962 Ga0501080_0205820
963 Ga0501081_0005698
964 Ga0501044_0016786
965 Ga0501045_0025814
966 Ga0501045_0147554
967 nmdc:mga0yw44_50130_c1
968 nmdc:mga0k408_19578_c1
969 nmdc:mga0k408_204000_c1
970 nmdc:mga04h51_24636_c1
971 nmdc:mga07m45_68464_c1
972 nmdc:mga05p37_12676_c1
973 nmdc:mga05p37_172120_c1
974 nmdc:mga05p37_186155_c1
975 nmdc:mga05p37_194792_c1
976 nmdc:mga05p37_32865_c1
977 nmdc:mga05p37_67071_c1
978 nmdc:mga05p37_7276_c1
979 nmdc:mga09592_12297_c1
980 nmdc:mga09592_215781_c1
981 nmdc:mga09592_39190_c1
982 nmdc:mga0qj67_6509_c1
983 nmdc:mga06r32_233799_c1
984 nmdc:mga06r32_26371_c1
985 nmdc:mga06r32_28874_c1
986 nmdc:mga06r32_59791_c1
987 nmdc:mga08y16_111555_c1
988 nmdc:mga08y16_132557_c1
989 nmdc:mga08y16_35905_c1
990 nmdc:mga08y16_51725_c1
991 nmdc:mga08y16_635_c1
992 nmdc:mga08y16_78778_c1
993 nmdc:mga0n895_11942_c1
994 nmdc:mga0n895_15313_c1
995 nmdc:mga0n895_173_c1
996 nmdc:mga0n895_55668_c1
997 nmdc:mga0n895_693_c1
998 nmdc:mga0rr50_2985_c1
999 nmdc:mga0rr50_2_c1
1000 nmdc:mga0rr50_60871_c1
1001 nmdc:mga0rr50_84956_c1
1002 nmdc:mga0rr50_9301_c1
1003 nmdc:mga08x19_11892_c1
1004 nmdc:mga08x19_13924_c1
1005 nmdc:mga0a205_1202_c1
1006 nmdc:mga0a205_163749_c1
1007 nmdc:mga0a205_2224_c1
1008 nmdc:mga0a205_252350_c1
1009 nmdc:mga0a205_309314_c1
1010 nmdc:mga0a205_47_c1
1011 nmdc:mga0a205_64579_c1
1012 nmdc:mga0a205_65500_c1
1013 Ga0495601_0006207
1014 Ga0495601_0042481
1015 Ga0495601_0142181
1016 Ga0495595_0014200
1017 Ga0495619_0003773
1018 Ga0495619_0229992
1019 Ga0501084_0030995
1020 Ga0501084_0072624
1021 Ga0590071_000098
1022 Ga0590071_027448
1023 Ga0590074_000172
1024 Ga0590074_001437
1025 Ga0590075_000178
1026 Ga0590075_001427
1027 Ga0590075_003279
1028 Ga0590075_007469
1029 Ga0590077_000133
1030 Ga0590077_000922
1031 Ga0590077_003200
1032 Ga0501082_0025389
1033 Ga0501082_0106945
1034 Ga0530510_0007138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

1

314

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.8738 1 318
1u7n-assembly1.cif.gz_A crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.8682 1 318
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.8642 1 320
1u7n-assembly1.cif.gz_B crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.8608 1 318
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.8521 1 321
ID Description Score Start End Superfamily
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9032 1 322 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.885 1 322 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.857 2 318 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.834 2 318 3.40.718.10
1vmiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isocitrate/Isopropylmalate dehydrogenase-like 0.7683 112 232 3.40.50.10750
ID Description Score Start End GO Terms
AF-W1X8X8-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9607 112 225 GO:0005737
GO:0006633
GO:0008654
GO:0016747
AF-A0A1W9QQX5-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.956 120 220 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A661KJI9-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.955 1 323 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A2E6ZR41-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9531 2 116 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A3M1KT69-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9523 1 322 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Map