F458136

General Info

Members Datasets Scaffolds Average Seq Length
517 222 512 258

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10143511|Ga0163161_101435112
Length 294
Sequence MSNVTVIDAKRGLRPRPQADEAEVAARLRALQDKAKGRDAHGLLELALREEFPGKTAVVSSFGAESVVLLKLVAEIDPNTPILFLNTGKLFGETLRYRDRLQDVLGLGDVRSLAPTQEAREKNDPDGTLWSRSTDDCCNFRKVIPLARALEPFQAQITGRKRFQTRERAEMQPVEFSGGHYRFNPLWQWDLHQLEAYIERNNLPRHPLVEDGYPSIGCMPCTRRVQAGEDYRAGRWSGLDKDECGIHLTDGGGIRAGLLAPECVAFTRCRYELARVRLVHVAWRSCSDDQNPSP

Samples

Sample ID Description Type Environment
1 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
2 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
3 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
4 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.19
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 0
Rhizoplane 0.39
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000286 3300003214 Bacteria 64278
2 Ga0070658_10027925 3300005327 Bacteria 4529
3 Ga0070658_10252895 3300005327 Bacteria 1495
4 Ga0070690_100459187 3300005330 Bacteria 946
5 Ga0070670_100475173 3300005331 Bacteria 1110
6 Ga0070670_100633265 3300005331 Bacteria 958
7 Ga0068869_100008034 3300005334 Bacteria 6777
8 Ga0070666_10021155 3300005335 Bacteria 4214
9 Ga0070680_100000392 3300005336 Bacteria 29694
10 Ga0070680_100029574 3300005336 Bacteria 4400
11 Ga0068868_100036022 3300005338 Bacteria 3827
12 Ga0068868_100117204 3300005338 Bacteria 2169
13 Ga0068868_100303772 3300005338 Bacteria 1356
14 Ga0070660_100033748 3300005339 Bacteria 3860
15 Ga0070660_100098371 3300005339 Bacteria 2316
16 Ga0070691_10007476 3300005341 Bacteria 5010
17 Ga0070661_100147405 3300005344 Bacteria 1778
18 Ga0070675_100107965 3300005354 Bacteria 2350
19 Ga0070674_100023590 3300005356 Bacteria 3983
20 Ga0070673_100130746 3300005364 Bacteria 2106
21 Ga0070659_100009937 3300005366 Bacteria 6998
22 Ga0070659_100128691 3300005366 Bacteria 2055
23 Ga0070667_100070287 3300005367 Bacteria 2980
24 Ga0070667_100099021 3300005367 Bacteria 2516
25 Ga0070709_10001074 3300005434 Bacteria 15112
26 Ga0070714_100037554 3300005435 Bacteria 4070
27 Ga0070713_100000012 3300005436 Bacteria 137708
28 Ga0070710_10053662 3300005437 Bacteria 2272
29 Ga0070711_100007796 3300005439 Bacteria 6522
30 Ga0070711_100391904 3300005439 Bacteria 1125
31 Ga0070705_100363907 3300005440 Bacteria 1059
32 Ga0070663_100207874 3300005455 Unclassified 1531
33 Ga0070678_100070621 3300005456 Bacteria 2612
34 Ga0070678_100122022 3300005456 Bacteria 2056
35 Ga0070662_100032982 3300005457 Bacteria 3644
36 Ga0070681_10000037 3300005458 Bacteria 96087
37 Ga0070681_10088246 3300005458 Bacteria 3053
38 Ga0070681_10294509 3300005458 Bacteria 1533
39 Ga0068867_100005257 3300005459 Bacteria 9145
40 Ga0068867_100130627 3300005459 Bacteria 1951
41 Ga0068867_100450959 3300005459 Bacteria 1096
42 Ga0070679_100015664 3300005530 Bacteria 7288
43 Ga0070679_100139888 3300005530 Bacteria 2401
44 Ga0070679_100155216 3300005530 Bacteria 2264
45 Ga0070679_100513951 3300005530 Bacteria 1141
46 Ga0070684_100155405 3300005535 Bacteria 2074
47 Ga0070684_100627672 3300005535 Bacteria 1000
48 Ga0068853_100026946 3300005539 Bacteria 4829
49 Ga0068853_100282358 3300005539 Bacteria 1531
50 Ga0068853_100473664 3300005539 Unclassified 1180
51 Ga0070695_100172090 3300005545 Bacteria 1528
52 Ga0070693_100228680 3300005547 Bacteria 1222
53 Ga0070665_100003699 3300005548 Bacteria 16197
54 Ga0070665_100082257 3300005548 Bacteria 3225
55 Ga0070665_100197322 3300005548 Bacteria 2013
56 Ga0070665_100298452 3300005548 Bacteria 1614
57 Ga0068855_100000385 3300005563 Bacteria 54304
58 Ga0068855_100005971 3300005563 Bacteria 14857
59 Ga0068855_100044172 3300005563 Bacteria 5275
60 Ga0068855_100215343 3300005563 Bacteria 2156
61 Ga0068855_100233806 3300005563 Bacteria 2056
62 Ga0068857_100049001 3300005577 Bacteria 3748
63 Ga0068857_100075139 3300005577 Bacteria 3012
64 Ga0068857_100186649 3300005577 Bacteria 1888
65 Ga0068854_100066114 3300005578 Bacteria 2631
66 Ga0068856_100001032 3300005614 Bacteria 29659
67 Ga0068856_100002049 3300005614 Bacteria 20920
68 Ga0068856_100162747 3300005614 Bacteria 2242
69 Ga0068856_100437164 3300005614 Bacteria 1329
70 Ga0068856_100503507 3300005614 Bacteria 1232
71 Ga0068856_100661751 3300005614 Bacteria 1065
72 Ga0070702_100110744 3300005615 Bacteria 1702
73 Ga0068852_100022064 3300005616 Bacteria 5097
74 Ga0068852_100155263 3300005616 Bacteria 2131
75 Ga0068852_100519922 3300005616 Bacteria 1187
76 Ga0068864_100059527 3300005618 Bacteria 3305
77 Ga0068863_100084777 3300005841 Bacteria 3003
78 Ga0068858_100008177 3300005842 Bacteria 10059
79 Ga0068858_100083541 3300005842 Bacteria 2970
80 Ga0068858_100104714 3300005842 Bacteria 2640
81 Ga0068860_100028426 3300005843 Bacteria 5381
82 Ga0068862_100304958 3300005844 Bacteria 1466
83 Ga0075365_10264727 3300006038 Bacteria 1209
84 Ga0070716_100084622 3300006173 Bacteria 1903
85 Ga0070712_100002398 3300006175 Bacteria 11537
86 Ga0070712_100051263 3300006175 Bacteria 2874
87 Ga0070712_100123378 3300006175 Bacteria 1953
88 Ga0097621_100011546 3300006237 Bacteria 6509
89 Ga0097621_100014864 3300006237 Bacteria 5839
90 Ga0097621_100045160 3300006237 Bacteria 3557
91 Ga0097621_100321447 3300006237 Unclassified 1371
92 Ga0097621_100501391 3300006237 Bacteria 1099
93 Ga0068871_100024344 3300006358 Bacteria 4694
94 Ga0075434_100012728 3300006871 Bacteria 7983
95 Ga0068865_100005010 3300006881 Bacteria 8012
96 Ga0068865_100019886 3300006881 Bacteria 4350
97 Ga0075436_100001059 3300006914 Bacteria 18544
98 Ga0075436_100014771 3300006914 Bacteria 5351
99 Ga0075435_100022968 3300007076 Bacteria 4816
100 Ga0075435_100290898 3300007076 Bacteria 1396
101 Ga0105240_10004196 3300009093 Bacteria 22057
102 Ga0105240_10008695 3300009093 Bacteria 14487
103 Ga0105240_10047301 3300009093 Bacteria 5445
104 Ga0105240_10073109 3300009093 Bacteria 4235
105 Ga0105240_10201275 3300009093 Bacteria 2333
106 Ga0105240_10355307 3300009093 Bacteria 1661
107 Ga0105240_10555122 3300009093 Bacteria 1270
108 Ga0105240_10577771 3300009093 Bacteria 1240
109 Ga0105240_10646544 3300009093 Bacteria 1160
110 Ga0105245_10054260 3300009098 Bacteria 3599
111 Ga0105245_10166034 3300009098 Bacteria 2099
112 Ga0105245_10170740 3300009098 Bacteria 2071
113 Ga0105245_10338027 3300009098 Bacteria 1488
114 Ga0105247_10089914 3300009101 Bacteria 1947
115 Ga0105247_10107617 3300009101 Bacteria 1790
116 Ga0105243_10003953 3300009148 Bacteria 11830
117 Ga0105241_10011356 3300009174 Bacteria 6529
118 Ga0105241_10195751 3300009174 Bacteria 1685
119 Ga0105241_10220670 3300009174 Bacteria 1593
120 Ga0105241_10479596 3300009174 Bacteria 1105
121 Ga0105242_10014464 3300009176 Bacteria 6115
122 Ga0105242_10074353 3300009176 Bacteria 2827
123 Ga0105242_10346763 3300009176 Bacteria 1370
124 Ga0105242_10435450 3300009176 Bacteria 1232
125 Ga0105248_10000005 3300009177 Bacteria 673111
126 Ga0105248_10026644 3300009177 Bacteria 6427
127 Ga0105248_10127395 3300009177 Bacteria 2872
128 Ga0105248_10161887 3300009177 Bacteria 2524
129 Ga0105248_10708030 3300009177 Unclassified 1136
130 Ga0105237_10010713 3300009545 Bacteria 9729
131 Ga0105237_10069149 3300009545 Bacteria 3526
132 Ga0105238_10003049 3300009551 Bacteria 16704
133 Ga0105238_10014450 3300009551 Bacteria 7984
134 Ga0105238_10019040 3300009551 Bacteria 6993
135 Ga0105238_10069584 3300009551 Bacteria 3520
136 Ga0105238_10090388 3300009551 Bacteria 3049
137 Ga0105238_10375519 3300009551 Unclassified 1412
138 Ga0105238_10664688 3300009551 Bacteria 1052
139 Ga0105249_10197120 3300009553 Bacteria 1969
140 Ga0105249_10757444 3300009553 Bacteria 1033
141 Ga0105249_11152650 3300009553 Bacteria 846
142 Ga0105239_10007357 3300010375 Bacteria 12646
143 Ga0105239_10013684 3300010375 Bacteria 9009
144 Ga0105239_10031250 3300010375 Bacteria 5857
145 Ga0105239_10095593 3300010375 Bacteria 3282
146 Ga0105239_10147716 3300010375 Bacteria 2623
147 Ga0105239_10168783 3300010375 Bacteria 2447
148 Ga0105239_10567983 3300010375 Bacteria 1292
149 Ga0105246_10003749 3300011119 Bacteria 9208
150 Ga0157373_10007408 3300013100 Bacteria 8162
151 Ga0157373_10017240 3300013100 Bacteria 5259
152 Ga0157370_10003563 3300013104 Bacteria 18230
153 Ga0157370_10015499 3300013104 Bacteria 7750
154 Ga0157370_10072047 3300013104 Bacteria 3260
155 Ga0157370_10143998 3300013104 Bacteria 2220
156 Ga0157369_10032900 3300013105 Bacteria 5699
157 Ga0157369_10065531 3300013105 Bacteria 3909
158 Ga0157369_10065549 3300013105 Bacteria 3909
159 Ga0157369_10340634 3300013105 Bacteria 1558
160 Ga0157369_10457613 3300013105 Bacteria 1321
161 Ga0157369_10618029 3300013105 Bacteria 1118
162 Ga0157374_10017296 3300013296 Bacteria 6346
163 Ga0157374_10102958 3300013296 Bacteria 2739
164 Ga0157378_10059858 3300013297 Bacteria 3399
165 Ga0157378_10092124 3300013297 Bacteria 2757
166 Ga0157378_10122240 3300013297 Bacteria 2401
167 Ga0157378_10380695 3300013297 Bacteria 1386
168 Ga0157378_10568436 3300013297 Bacteria 1141
169 Ga0163162_10019121 3300013306 Bacteria 6718
170 Ga0163162_10056398 3300013306 Bacteria 3956
171 Ga0163162_10257540 3300013306 Bacteria 1877
172 Ga0157372_10024682 3300013307 Bacteria 6534
173 Ga0157372_10152455 3300013307 Bacteria 2668
174 Ga0157372_10186122 3300013307 Bacteria 2405
175 Ga0157375_10047895 3300013308 Bacteria 4177
176 Ga0163163_10000073 3300014325 Bacteria 111551
177 Ga0163163_10086476 3300014325 Bacteria 3144
178 Ga0163163_10219445 3300014325 Bacteria 1950
179 Ga0157380_10496748 3300014326 Bacteria 1184
180 Ga0157377_10065850 3300014745 Bacteria 2082
181 Ga0157379_10000138 3300014968 Bacteria 52463
182 Ga0157379_10013925 3300014968 Bacteria 7050
183 Ga0157379_10041725 3300014968 Bacteria 4095
184 Ga0157379_10048487 3300014968 Bacteria 3791
185 Ga0157379_10125682 3300014968 Bacteria 2307
186 Ga0157379_10181935 3300014968 Bacteria 1899
187 Ga0157379_10558745 3300014968 Bacteria 1065
188 Ga0157376_10348112 3300014969 Bacteria 1417
189 Ga0157376_10351257 3300014969 Bacteria 1411
190 Ga0163161_10143511 3300017792 Bacteria 1809
191 Ga0224712_10034234 3300022467 Bacteria 1866
192 Ga0209233_1000013 3300025261 Bacteria 1013785
193 Ga0209233_1012065 3300025261 Bacteria 2520
194 Ga0209758_1000013 3300025297 Bacteria 873003
195 Ga0207692_10074002 3300025898 Bacteria 1804
196 Ga0207688_10043520 3300025901 Bacteria 2501
197 Ga0207680_10013534 3300025903 Bacteria 4195
198 Ga0207699_10023111 3300025906 Bacteria 3379
199 Ga0207699_10147511 3300025906 Bacteria 1553
200 Ga0207645_10031249 3300025907 Bacteria 3428
201 Ga0207705_10000180 3300025909 Bacteria 66404
202 Ga0207705_10004034 3300025909 Bacteria 11165
203 Ga0207705_10048181 3300025909 Bacteria 3064
204 Ga0207705_10118682 3300025909 Bacteria 1961
205 Ga0207654_10045740 3300025911 Bacteria 2493
206 Ga0207654_10146439 3300025911 Unclassified 1512
207 Ga0207707_10000011 3300025912 Bacteria 282857
208 Ga0207707_10412770 3300025912 Bacteria 1158
209 Ga0207695_10000018 3300025913 Bacteria 766611
210 Ga0207695_10007174 3300025913 Bacteria 14258
211 Ga0207695_10196261 3300025913 Bacteria 1934
212 Ga0207695_10348050 3300025913 Bacteria 1369
213 Ga0207695_10394016 3300025913 Bacteria 1269
214 Ga0207671_10049492 3300025914 Bacteria 3112
215 Ga0207671_10140428 3300025914 Bacteria 1861
216 Ga0207671_10313762 3300025914 Bacteria 1240
217 Ga0207693_10004683 3300025915 Bacteria 11521
218 Ga0207693_10012582 3300025915 Bacteria 6835
219 Ga0207693_10114061 3300025915 Bacteria 2120
220 Ga0207663_10010691 3300025916 Bacteria 4896
221 Ga0207660_10000110 3300025917 Bacteria 46792
222 Ga0207660_10099010 3300025917 Bacteria 2175
223 Ga0207657_10000241 3300025919 Bacteria 57958
224 Ga0207657_10005193 3300025919 Bacteria 13658
225 Ga0207649_10000194 3300025920 Bacteria 50112
226 Ga0207649_10186684 3300025920 Bacteria 1455
227 Ga0207649_10225455 3300025920 Bacteria 1337
228 Ga0207652_10008385 3300025921 Bacteria 8315
229 Ga0207652_10219387 3300025921 Bacteria 1713
230 Ga0207694_10000010 3300025924 Bacteria 439722
231 Ga0207694_10101334 3300025924 Bacteria 2282
232 Ga0207694_10188782 3300025924 Bacteria 1673
233 Ga0207694_10305050 3300025924 Bacteria 1311
234 Ga0207659_10172637 3300025926 Bacteria 1707
235 Ga0207687_10134460 3300025927 Bacteria 1868
236 Ga0207687_10148516 3300025927 Bacteria 1786
237 Ga0207700_10000191 3300025928 Bacteria 36677
238 Ga0207700_10000295 3300025928 Bacteria 29631
239 Ga0207664_10040556 3300025929 Bacteria 3622
240 Ga0207644_10561829 3300025931 Bacteria 945
241 Ga0207690_10049378 3300025932 Bacteria 2805
242 Ga0207706_10300891 3300025933 Bacteria 1398
243 Ga0207686_10058677 3300025934 Bacteria 2427
244 Ga0207686_10171595 3300025934 Bacteria 1530
245 Ga0207686_10230637 3300025934 Bacteria 1342
246 Ga0207709_10001826 3300025935 Bacteria 14215
247 Ga0207669_10067092 3300025937 Bacteria 2234
248 Ga0207704_10210303 3300025938 Bacteria 1431
249 Ga0207704_10277401 3300025938 Bacteria 1272
250 Ga0207665_10024913 3300025939 Bacteria 3947
251 Ga0207711_10000002 3300025941 Bacteria 1228676
252 Ga0207711_10010879 3300025941 Bacteria 7561
253 Ga0207711_10144897 3300025941 Bacteria 2140
254 Ga0207711_10292005 3300025941 Bacteria 1503
255 Ga0207711_10496811 3300025941 Unclassified 1137
256 Ga0207689_10063377 3300025942 Bacteria 3041
257 Ga0207661_10401421 3300025944 Bacteria 1243
258 Ga0207679_10206395 3300025945 Bacteria 1645
259 Ga0207667_10000388 3300025949 Bacteria 59263
260 Ga0207667_10006882 3300025949 Bacteria 13736
261 Ga0207667_10026472 3300025949 Bacteria 6336
262 Ga0207667_10027680 3300025949 Bacteria 6166
263 Ga0207667_10035916 3300025949 Bacteria 5315
264 Ga0207667_10099501 3300025949 Bacteria 3000
265 Ga0207667_10114377 3300025949 Bacteria 2781
266 Ga0207667_10258162 3300025949 Bacteria 1782
267 Ga0207712_10151594 3300025961 Bacteria 1791
268 Ga0207640_10053576 3300025981 Bacteria 2634
269 Ga0207658_10052398 3300025986 Bacteria 3011
270 Ga0207658_10078172 3300025986 Bacteria 2527
271 Ga0207677_10093057 3300026023 Bacteria 2196
272 Ga0207703_10010416 3300026035 Bacteria 7271
273 Ga0207639_10040049 3300026041 Bacteria 3495
274 Ga0207639_10207683 3300026041 Bacteria 1684
275 Ga0207639_10215300 3300026041 Bacteria 1656
276 Ga0207678_10095939 3300026067 Bacteria 2534
277 Ga0207702_10000315 3300026078 Bacteria 55383
278 Ga0207702_10003407 3300026078 Bacteria 14549
279 Ga0207702_10141439 3300026078 Bacteria 2178
280 Ga0207648_10045967 3300026089 Bacteria 3828
281 Ga0207676_10053912 3300026095 Bacteria 3149
282 Ga0207674_10000904 3300026116 Bacteria 38685
283 Ga0207674_10053783 3300026116 Bacteria 4102
284 Ga0207674_10768819 3300026116 Bacteria 930
285 Ga0207675_100577197 3300026118 Bacteria 1126
286 Ga0207683_10028767 3300026121 Bacteria 4808
287 Ga0207683_10028936 3300026121 Bacteria 4794
288 Ga0207683_10051928 3300026121 Bacteria 3592
289 Ga0207683_10063865 3300026121 Bacteria 3244
290 Ga0207698_10023033 3300026142 Bacteria 4344
291 Ga0207698_10044068 3300026142 Bacteria 3348
292 Ga0268266_10000557 3300028379 Bacteria 51935
293 Ga0268266_10106860 3300028379 Bacteria 2474
294 Ga0268266_10108041 3300028379 Bacteria 2461
295 Ga0268266_10257106 3300028379 Bacteria 1617
296 Ga0268265_10064248 3300028380 Bacteria 2827
297 Ga0268265_10631911 3300028380 Bacteria 1027
298 Ga0268264_10076552 3300028381 Bacteria 2847
299 Ga0268264_10085736 3300028381 Bacteria 2704
300 Ga0265318_10000037 3300028577 Bacteria 138223
301 Ga0265338_10000017 3300028800 Bacteria 344481
302 Ga0265338_10000775 3300028800 Bacteria 54469
303 Ga0265338_10009204 3300028800 Bacteria 11825
304 Ga0265338_10026304 3300028800 Bacteria 5874
305 Ga0265338_10180840 3300028800 Bacteria 1608
306 Ga0316182_1358096 3300030745 Bacteria 1556
307 Ga0265330_10004025 3300031235 Bacteria 7541
308 Ga0265330_10081310 3300031235 Bacteria 1396
309 Ga0265330_10106927 3300031235 Unclassified 1196
310 Ga0265332_10109761 3300031238 Bacteria 1162
311 Ga0265320_10002508 3300031240 Bacteria 12774
312 Ga0265325_10000014 3300031241 Bacteria 131579
313 Ga0265325_10010992 3300031241 Bacteria 5213
314 Ga0265325_10016368 3300031241 Bacteria 4147
315 Ga0265325_10019137 3300031241 Bacteria 3790
316 Ga0265325_10032279 3300031241 Bacteria 2796
317 Ga0265325_10154561 3300031241 Bacteria 1083
318 Ga0265329_10044874 3300031242 Bacteria 1413
319 Ga0265340_10000059 3300031247 Bacteria 50238
320 Ga0265340_10009373 3300031247 Bacteria 5259
321 Ga0265340_10009858 3300031247 Bacteria 5119
322 Ga0265340_10052238 3300031247 Bacteria 1977
323 Ga0265340_10192696 3300031247 Unclassified 919
324 Ga0265339_10002935 3300031249 Bacteria 12063
325 Ga0265339_10020609 3300031249 Bacteria 3848
326 Ga0265339_10020881 3300031249 Bacteria 3820
327 Ga0265339_10037418 3300031249 Bacteria 2712
328 Ga0265339_10063164 3300031249 Bacteria 1989
329 Ga0265339_10067240 3300031249 Bacteria 1917
330 Ga0265339_10090131 3300031249 Bacteria 1608
331 Ga0265339_10127449 3300031249 Bacteria 1304
332 Ga0265331_10000186 3300031250 Bacteria 76149
333 Ga0265331_10002819 3300031250 Bacteria 11519
334 Ga0265331_10004593 3300031250 Bacteria 8585
335 Ga0265331_10028170 3300031250 Bacteria 2811
336 Ga0265331_10034687 3300031250 Bacteria 2487
337 Ga0265327_10000392 3300031251 Bacteria 82296
338 Ga0265316_10011218 3300031344 Bacteria 8106
339 Ga0265316_10070931 3300031344 Bacteria 2686
340 Ga0265316_10209448 3300031344 Bacteria 1443
341 Ga0265313_10005590 3300031595 Bacteria 9196
342 Ga0265313_10006099 3300031595 Bacteria 8676
343 Ga0265313_10006862 3300031595 Bacteria 7937
344 Ga0265313_10012843 3300031595 Bacteria 5082
345 Ga0265313_10017839 3300031595 Bacteria 4010
346 Ga0265313_10055783 3300031595 Bacteria 1870
347 Ga0265314_10001970 3300031711 Bacteria 21811
348 Ga0265314_10017968 3300031711 Bacteria 5533
349 Ga0265314_10033342 3300031711 Bacteria 3778
350 Ga0265314_10034484 3300031711 Bacteria 3699
351 Ga0265314_10048328 3300031711 Bacteria 2986
352 Ga0265314_10062206 3300031711 Bacteria 2538
353 Ga0265314_10093776 3300031711 Bacteria 1948
354 Ga0265342_10005739 3300031712 Bacteria 9380
355 Ga0265342_10042165 3300031712 Bacteria 2758
356 Ga0265342_10053557 3300031712 Bacteria 2401
357 Ga0265342_10173097 3300031712 Bacteria 1186
358 Ga0265342_10189291 3300031712 Bacteria 1124
359 Ga0307516_10038778 3300031730 Bacteria 4751
360 Ga0307516_10122926 3300031730 Bacteria 2383
361 Ga0307416_100352943 3300032002 Bacteria 1489
362 Ga0373956_0104602 3300035119 Bacteria 1315
363 Ga0373955_0173738 3300035172 Bacteria 1276
364 Ga0373931_0392153 3300035691 Bacteria 877
365 Ga0373933_0077140 3300035724 Bacteria 2036
366 Ga0373933_0252960 3300035724 Bacteria 1135
367 Ga0373937_0002620 3300036401 Bacteria 14997
368 Ga0373937_0437370 3300036401 Bacteria 1242
369 Ga0395900_0105348 3300037418 Bacteria 2897
370 Ga0395900_0284857 3300037418 Bacteria 1643
371 Ga0395898_0138495 3300037466 Bacteria 2330
372 Ga0395901_0112042 3300038443 Bacteria 2865
373 Ga0436365_0750348 3300039437 Bacteria 1351
374 Ga0436365_1490174 3300039437 Bacteria 54443
375 Ga0436365_1567081 3300039437 Bacteria 3484
376 Ga0436365_1867113 3300039437 Bacteria 1288
377 Ga0451793_0592768 3300041452 Bacteria 1066
378 Ga0466967_0018991 3300045976 Bacteria 5516
379 Ga0495580_0201076 3300046472 Bacteria 1372
380 Ga0495582_0137163 3300046473 Bacteria 1385
381 Ga0495606_0284343 3300046507 Bacteria 903
382 Ga0495630_0449334 3300046517 Bacteria 988
383 Ga0495652_0128573 3300046529 Bacteria 2009
384 Ga0495586_0048575 3300046535 Bacteria 2293
385 Ga0495645_0087571 3300046543 Bacteria 2228
386 Ga0495622_0003630 3300046557 Bacteria 7246
387 Ga0495636_0060222 3300047318 Bacteria 1604
388 Ga0495672_0231685 3300047320 Bacteria 906
389 Ga0495675_0053220 3300047444 Bacteria 2570
390 Ga0495684_0115498 3300047471 Bacteria 2024
391 Ga0495602_0203650 3300048088 Bacteria 1508
392 Ga0496111_0127917 3300048914 Bacteria 1879
393 Ga0496121_0005378 3300048924 Bacteria 16451
394 Ga0496126_0000480 3300048929 Bacteria 79257
395 Ga0495682_0001799 3300049460 Bacteria 10817
396 Ga0501031_0012708 3300049568 Bacteria 5499
397 Ga0501031_0080380 3300049568 Bacteria 2125
398 Ga0501033_0019617 3300049570 Bacteria 5110
399 Ga0501033_0021148 3300049570 Bacteria 4910
400 Ga0501033_0025016 3300049570 Bacteria 4499
401 Ga0501033_0086394 3300049570 Bacteria 2296
402 Ga0501033_0111827 3300049570 Bacteria 1987
403 Ga0501033_0119291 3300049570 Bacteria 1915
404 Ga0501033_0201230 3300049570 Bacteria 1422
405 Ga0501033_0204744 3300049570 Unclassified 1408
406 Ga0501034_0007767 3300049571 Bacteria 11409
407 Ga0501034_0086240 3300049571 Bacteria 3141
408 Ga0501034_0167584 3300049571 Bacteria 2165
409 Ga0501034_0204733 3300049571 Bacteria 1930
410 Ga0501034_0409518 3300049571 Bacteria 1278
411 Ga0501034_0584339 3300049571 Bacteria 1024
412 Ga0501036_0004972 3300049572 Bacteria 10748
413 Ga0501036_0039030 3300049572 Bacteria 4021
414 Ga0501036_0062123 3300049572 Bacteria 3164
415 Ga0501037_0019402 3300049573 Bacteria 5015
416 Ga0501037_0107593 3300049573 Bacteria 2009
417 Ga0501037_0163789 3300049573 Bacteria 1584
418 Ga0501038_0006055 3300049574 Bacteria 11189
419 Ga0501038_0038715 3300049574 Bacteria 4174
420 Ga0501038_0101438 3300049574 Bacteria 2396
421 Ga0501038_0105483 3300049574 Bacteria 2341
422 Ga0501038_0169243 3300049574 Bacteria 1770
423 Ga0501038_0231449 3300049574 Bacteria 1470
424 Ga0501038_0381017 3300049574 Bacteria 1094
425 Ga0501039_0010992 3300049575 Bacteria 6897
426 Ga0501042_0020277 3300049578 Bacteria 4626
427 Ga0501043_0008155 3300049579 Bacteria 8267
428 Ga0501043_0019473 3300049579 Bacteria 5326
429 Ga0501043_0043904 3300049579 Bacteria 3514
430 Ga0501043_0054626 3300049579 Bacteria 3137
431 Ga0501043_0081411 3300049579 Bacteria 2544
432 Ga0501043_0098661 3300049579 Bacteria 2296
433 Ga0501043_0176417 3300049579 Bacteria 1666
434 Ga0501046_0007884 3300049580 Bacteria 9330
435 Ga0501046_0067602 3300049580 Bacteria 2783
436 Ga0501046_0136936 3300049580 Bacteria 1854
437 Ga0501046_0356496 3300049580 Bacteria 1061
438 Ga0501047_0001997 3300049581 Bacteria 19557
439 Ga0501047_0004848 3300049581 Bacteria 12638
440 Ga0501047_0016074 3300049581 Bacteria 7137
441 Ga0501047_0016655 3300049581 Bacteria 7019
442 Ga0501047_0050994 3300049581 Bacteria 3996
443 Ga0501047_0085645 3300049581 Bacteria 3028
444 Ga0501047_0182708 3300049581 Bacteria 1963
445 Ga0501047_0231551 3300049581 Bacteria 1701
446 Ga0501047_0369016 3300049581 Bacteria 1270
447 Ga0501047_0408898 3300049581 Bacteria 1189
448 Ga0501047_0416915 3300049581 Bacteria 1174
449 Ga0501047_0482170 3300049581 Bacteria 1068
450 Ga0501048_0005326 3300049582 Bacteria 9792
451 Ga0501067_0001000 3300049583 Bacteria 15194
452 Ga0501067_0004955 3300049583 Bacteria 7396
453 Ga0501068_0071477 3300049584 Bacteria 2118
454 Ga0501069_0001204 3300049585 Bacteria 12605
455 Ga0501070_0008327 3300049586 Bacteria 8760
456 Ga0501070_0122812 3300049586 Bacteria 2146
457 Ga0501070_0167321 3300049586 Bacteria 1811
458 Ga0501072_0033682 3300049588 Bacteria 4014
459 Ga0501073_0012394 3300049589 Bacteria 6221
460 Ga0501073_0020526 3300049589 Bacteria 4764
461 Ga0501073_0040124 3300049589 Bacteria 3315
462 Ga0501073_0231878 3300049589 Bacteria 1275
463 Ga0501073_0331762 3300049589 Bacteria 1050
464 Ga0501074_0052888 3300049590 Bacteria 2930
465 Ga0501074_0132124 3300049590 Bacteria 1785
466 Ga0501074_0141118 3300049590 Bacteria 1723
467 Ga0501079_0019737 3300049741 Bacteria 5148
468 Ga0501080_0068141 3300049742 Bacteria 3310
469 Ga0501080_0115830 3300049742 Bacteria 2485
470 Ga0501080_0269513 3300049742 Bacteria 1550
471 Ga0501080_0459621 3300049742 Bacteria 1140
472 Ga0501083_0010092 3300049744 Bacteria 6656
473 Ga0501083_0204696 3300049744 Bacteria 1287
474 Ga0501035_0012874 3300049822 Bacteria 7724
475 Ga0501035_0052670 3300049822 Bacteria 3641
476 Ga0501035_0195316 3300049822 Bacteria 1738
477 Ga0501035_0234212 3300049822 Bacteria 1564
478 Ga0501035_0238126 3300049822 Bacteria 1549
479 Ga0501035_0263711 3300049822 Bacteria 1460
480 Ga0501035_0380356 3300049822 Bacteria 1177
481 Ga0501035_0400488 3300049822 Bacteria 1142
482 Ga0501044_0005077 3300049823 Bacteria 14687
483 Ga0501044_0008569 3300049823 Bacteria 11203
484 Ga0501044_0025305 3300049823 Bacteria 6290
485 Ga0501044_0026821 3300049823 Bacteria 6097
486 Ga0501044_0111359 3300049823 Bacteria 2745
487 Ga0501044_0317620 3300049823 Bacteria 1483
488 Ga0501044_0349711 3300049823 Bacteria 1398
489 Ga0501044_0653252 3300049823 Bacteria 940
490 Ga0501045_0600735 3300049824 Bacteria 815
491 nmdc:mga0n895_192702_c1 3300050512 Bacteria 2069
492 nmdc:mga0n895_5762_c1 3300050512 Bacteria 10398
493 nmdc:mga0rr50_17246_c1 3300050513 Bacteria 4816
494 nmdc:mga0rr50_348700_c1 3300050513 Bacteria 1245
495 nmdc:mga08x19_295437_c1 3300050514 Bacteria 1125
496 nmdc:mga08x19_6201_c1 3300050514 Bacteria 7071
497 Ga0500643_000003 3300053087 Bacteria 876659
498 Ga0500566_0168714 3300053094 Bacteria 1133
499 Ga0500555_014925 3300053103 Bacteria 2240
500 Ga0500595_011166 3300053119 Bacteria 3529
501 Ga0500595_068751 3300053119 Bacteria 1054
502 Ga0500655_002975 3300053133 Bacteria 3074
503 Ga0500655_005358 3300053133 Bacteria 2316
504 Ga0500559_0018090 3300053136 Bacteria 2979
505 Ga0500573_0000057 3300053140 Bacteria 74302
506 Ga0500619_000590 3300053154 Bacteria 6180
507 Ga0501084_0000175 3300054114 Bacteria 50123
508 Ga0501084_0025187 3300054114 Bacteria 4962
509 Ga0501084_0179287 3300054114 Bacteria 1788
510 Ga0501084_0444129 3300054114 Bacteria 1097
511 Ga0501082_0005934 3300060353 Bacteria 10593
512 Ga0501082_0248406 3300060353 Bacteria 1548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100033748 Ga0070660_1000337483 231
2 3300005455 Ga0070663_100207874 Ga0070663_1002078742 231
3 3300009551 Ga0105238_10003049 Ga0105238_100030496 231
4 3300013100 Ga0157373_10017240 Ga0157373_100172408 231
5 3300013104 Ga0157370_10015499 Ga0157370_100154993 231
6 3300013307 Ga0157372_10186122 Ga0157372_101861222 231
7 3300025909 Ga0207705_10000180 Ga0207705_1000018024 231
8 3300025917 Ga0207660_10000110 Ga0207660_1000011057 231
9 3300025919 Ga0207657_10000241 Ga0207657_1000024160 231
10 3300025932 Ga0207690_10049378 Ga0207690_100493783 231
11 3300026067 Ga0207678_10095939 Ga0207678_100959392 231
12 3300047320 Ga0495672_0231685 Ga0495672_0231685_48_743 231
13 3300025949 Ga0207667_10099501 Ga0207667_100995012 232
14 3300009553 Ga0105249_10757444 Ga0105249_107574441 233
15 3300041452 Ga0451793_0592768 Ga0451793_0592768_142_906 234
16 3300053103 Ga0500555_014925 Ga0500555_014925_392_1171 234
17 3300049824 Ga0501045_0600735 Ga0501045_0600735_10_744 237
18 3300049571 Ga0501034_0167584 Ga0501034_0167584_858_1646 238
19 3300049581 Ga0501047_0231551 Ga0501047_0231551_308_1096 238
20 3300030745 Ga0316182_1358096 Ga0316182_13580962 239
21 3300032002 Ga0307416_100352943 Ga0307416_1003529432 240
22 3300049570 Ga0501033_0111827 Ga0501033_0111827_57_845 241
23 3300049572 Ga0501036_0039030 Ga0501036_0039030_2091_2879 241
24 3300049573 Ga0501037_0163789 Ga0501037_0163789_570_1358 241
25 3300049574 Ga0501038_0105483 Ga0501038_0105483_325_1113 241
26 iso_pu_bacteria 2738541272 2738693696 241
27 iso_pu_bacteria 2738543027 2739322891 241
28 iso_pu_bacteria 2758568522 2760304628 241
29 iso_pu_bacteria 2758568621 2760621562 241
30 iso_pu_bacteria 8056579771 8056583279 241
31 3300005330 Ga0070690_100459187 Ga0070690_1004591871 242
32 3300006237 Ga0097621_100011546 Ga0097621_1000115465 242
33 3300035724 Ga0373933_0252960 Ga0373933_0252960_350_1084 242
34 3300005530 Ga0070679_100139888 Ga0070679_1001398884 243
35 3300046473 Ga0495582_0137163 Ga0495582_0137163_195_938 243
36 3300046535 Ga0495586_0048575 Ga0495586_0048575_946_1689 243
37 3300049589 Ga0501073_0231878 Ga0501073_0231878_446_1198 243
38 3300028800 Ga0265338_10026304 Ga0265338_100263048 246
39 3300031712 Ga0265342_10173097 Ga0265342_101730972 246
40 3300049570 Ga0501033_0025016 Ga0501033_0025016_3516_4265 246
41 3300049574 Ga0501038_0231449 Ga0501038_0231449_316_1065 246
42 3300049579 Ga0501043_0081411 Ga0501043_0081411_67_816 246
43 3300049581 Ga0501047_0182708 Ga0501047_0182708_559_1308 246
44 3300049822 Ga0501035_0195316 Ga0501035_0195316_460_1209 246
45 3300049823 Ga0501044_0025305 Ga0501044_0025305_2591_3340 246
46 3300010375 Ga0105239_10031250 Ga0105239_100312503 247
47 3300049582 Ga0501048_0005326 Ga0501048_0005326_2562_3350 247
48 3300005336 Ga0070680_100029574 Ga0070680_1000295746 248
49 3300005366 Ga0070659_100128691 Ga0070659_1001286912 248
50 3300005530 Ga0070679_100513951 Ga0070679_1005139512 248
51 3300005548 Ga0070665_100197322 Ga0070665_1001973224 248
52 3300005563 Ga0068855_100005971 Ga0068855_1000059717 248
53 3300005577 Ga0068857_100075139 Ga0068857_1000751396 248
54 3300005614 Ga0068856_100437164 Ga0068856_1004371642 248
55 3300009093 Ga0105240_10008695 Ga0105240_1000869511 248
56 3300009093 Ga0105240_10355307 Ga0105240_103553073 248
57 3300009174 Ga0105241_10220670 Ga0105241_102206703 248
58 3300009545 Ga0105237_10010713 Ga0105237_100107136 248
59 3300009551 Ga0105238_10014450 Ga0105238_100144509 248
60 3300009551 Ga0105238_10375519 Ga0105238_103755191 248
61 3300010375 Ga0105239_10168783 Ga0105239_101687834 248
62 3300013105 Ga0157369_10340634 Ga0157369_103406342 248
63 3300025913 Ga0207695_10007174 Ga0207695_1000717417 248
64 3300025914 Ga0207671_10140428 Ga0207671_101404284 248
65 3300025914 Ga0207671_10313762 Ga0207671_103137622 248
66 3300025917 Ga0207660_10099010 Ga0207660_100990103 248
67 3300025921 Ga0207652_10219387 Ga0207652_102193872 248
68 3300025949 Ga0207667_10006882 Ga0207667_100068825 248
69 3300026116 Ga0207674_10053783 Ga0207674_100537836 248
70 3300028379 Ga0268266_10106860 Ga0268266_101068604 248
71 3300037418 Ga0395900_0284857 Ga0395900_0284857_163_918 248
72 3300037466 Ga0395898_0138495 Ga0395898_0138495_1122_1877 248
73 3300038443 Ga0395901_0112042 Ga0395901_0112042_534_1289 248
74 3300031235 Ga0265330_10004025 Ga0265330_100040257 250
75 3300031241 Ga0265325_10154561 Ga0265325_101545611 250
76 3300031242 Ga0265329_10044874 Ga0265329_100448742 250
77 3300031247 Ga0265340_10000059 Ga0265340_1000005918 250
78 3300031247 Ga0265340_10009858 Ga0265340_100098586 250
79 3300031249 Ga0265339_10067240 Ga0265339_100672404 250
80 3300031344 Ga0265316_10011218 Ga0265316_100112186 250
81 3300031344 Ga0265316_10070931 Ga0265316_100709314 250
82 3300031595 Ga0265313_10017839 Ga0265313_100178395 250
83 3300031712 Ga0265342_10005739 Ga0265342_100057395 250
84 3300039437 Ga0436365_1867113 Ga0436365_1867113_516_1271 250
85 3300053094 Ga0500566_0168714 Ga0500566_0168714_307_1062 250
86 3300005615 Ga0070702_100110744 Ga0070702_1001107442 251
87 3300005618 Ga0068864_100059527 Ga0068864_1000595272 251
88 3300006175 Ga0070712_100123378 Ga0070712_1001233783 251
89 3300006237 Ga0097621_100321447 Ga0097621_1003214471 251
90 3300009174 Ga0105241_10011356 Ga0105241_100113567 251
91 3300011119 Ga0105246_10003749 Ga0105246_100037492 251
92 3300025911 Ga0207654_10146439 Ga0207654_101464393 251
93 3300025915 Ga0207693_10114061 Ga0207693_101140613 251
94 3300026095 Ga0207676_10053912 Ga0207676_100539124 251
95 3300026116 Ga0207674_10768819 Ga0207674_107688191 251
96 3300028381 Ga0268264_10076552 Ga0268264_100765524 251
97 3300031595 Ga0265313_10012843 Ga0265313_100128433 251
98 3300031711 Ga0265314_10033342 Ga0265314_100333422 251
99 3300039437 Ga0436365_1490174 Ga0436365_1490174_22178_22957 251
100 3300049571 Ga0501034_0086240 Ga0501034_0086240_1196_1975 251
101 3300009093 Ga0105240_10073109 Ga0105240_100731095 252
102 3300009177 Ga0105248_10000005 Ga0105248_1000000549 252
103 3300025941 Ga0207711_10000002 Ga0207711_1000000249 252
104 3300028800 Ga0265338_10000017 Ga0265338_10000017325 252
105 3300031238 Ga0265332_10109761 Ga0265332_101097612 252
106 3300031241 Ga0265325_10000014 Ga0265325_10000014104 252
107 3300031249 Ga0265339_10020881 Ga0265339_100208812 252
108 3300031250 Ga0265331_10004593 Ga0265331_100045934 252
109 3300031250 Ga0265331_10028170 Ga0265331_100281702 252
110 3300031595 Ga0265313_10005590 Ga0265313_100055901 252
111 3300031595 Ga0265313_10006099 Ga0265313_100060997 252
112 3300031712 Ga0265342_10042165 Ga0265342_100421655 252
113 3300031712 Ga0265342_10053557 Ga0265342_100535574 252
114 3300039437 Ga0436365_1567081 Ga0436365_1567081_1204_1983 252
115 3300049570 Ga0501033_0201230 Ga0501033_0201230_403_1200 252
116 3300049571 Ga0501034_0204733 Ga0501034_0204733_690_1472 252
117 3300049574 Ga0501038_0169243 Ga0501038_0169243_340_1122 252
118 3300049579 Ga0501043_0054626 Ga0501043_0054626_1553_2335 252
119 3300049579 Ga0501043_0176417 Ga0501043_0176417_311_1093 252
120 3300049580 Ga0501046_0136936 Ga0501046_0136936_663_1445 252
121 3300049580 Ga0501046_0356496 Ga0501046_0356496_128_895 252
122 3300049581 Ga0501047_0001997 Ga0501047_0001997_3283_4065 252
123 3300049581 Ga0501047_0369016 Ga0501047_0369016_248_1030 252
124 3300049581 Ga0501047_0416915 Ga0501047_0416915_77_844 252
125 3300049742 Ga0501080_0269513 Ga0501080_0269513_134_931 252
126 3300049744 Ga0501083_0204696 Ga0501083_0204696_249_1040 252
127 3300049822 Ga0501035_0238126 Ga0501035_0238126_597_1364 252
128 3300049822 Ga0501035_0400488 Ga0501035_0400488_34_831 252
129 3300053136 Ga0500559_0018090 Ga0500559_0018090_1693_2478 252
130 3300053154 Ga0500619_000590 Ga0500619_000590_3152_3934 252
131 3300005327 Ga0070658_10027925 Ga0070658_100279253 253
132 3300005327 Ga0070658_10252895 Ga0070658_102528952 253
133 3300005331 Ga0070670_100475173 Ga0070670_1004751731 253
134 3300005331 Ga0070670_100633265 Ga0070670_1006332651 253
135 3300005334 Ga0068869_100008034 Ga0068869_1000080348 253
136 3300005335 Ga0070666_10021155 Ga0070666_100211551 253
137 3300005336 Ga0070680_100000392 Ga0070680_10000039211 253
138 3300005338 Ga0068868_100036022 Ga0068868_1000360223 253
139 3300005338 Ga0068868_100117204 Ga0068868_1001172042 253
140 3300005338 Ga0068868_100303772 Ga0068868_1003037721 253
141 3300005339 Ga0070660_100098371 Ga0070660_1000983712 253
142 3300005344 Ga0070661_100147405 Ga0070661_1001474052 253
143 3300005354 Ga0070675_100107965 Ga0070675_1001079653 253
144 3300005356 Ga0070674_100023590 Ga0070674_1000235903 253
145 3300005364 Ga0070673_100130746 Ga0070673_1001307464 253
146 3300005366 Ga0070659_100009937 Ga0070659_1000099371 253
147 3300005367 Ga0070667_100070287 Ga0070667_1000702873 253
148 3300005367 Ga0070667_100099021 Ga0070667_1000990212 253
149 3300005456 Ga0070678_100070621 Ga0070678_1000706214 253
150 3300005456 Ga0070678_100122022 Ga0070678_1001220222 253
151 3300005457 Ga0070662_100032982 Ga0070662_1000329826 253
152 3300005458 Ga0070681_10000037 Ga0070681_1000003750 253
153 3300005458 Ga0070681_10088246 Ga0070681_100882465 253
154 3300005459 Ga0068867_100005257 Ga0068867_1000052576 253
155 3300005459 Ga0068867_100130627 Ga0068867_1001306272 253
156 3300005459 Ga0068867_100450959 Ga0068867_1004509592 253
157 3300005530 Ga0070679_100015664 Ga0070679_1000156641 253
158 3300005530 Ga0070679_100155216 Ga0070679_1001552162 253
159 3300005535 Ga0070684_100155405 Ga0070684_1001554054 253
160 3300005539 Ga0068853_100026946 Ga0068853_1000269467 253
161 3300005539 Ga0068853_100473664 Ga0068853_1004736641 253
162 3300005548 Ga0070665_100003699 Ga0070665_10000369915 253
163 3300005548 Ga0070665_100082257 Ga0070665_1000822574 253
164 3300005548 Ga0070665_100298452 Ga0070665_1002984523 253
165 3300005563 Ga0068855_100000385 Ga0068855_10000038543 253
166 3300005563 Ga0068855_100044172 Ga0068855_1000441721 253
167 3300005563 Ga0068855_100215343 Ga0068855_1002153434 253
168 3300005563 Ga0068855_100233806 Ga0068855_1002338061 253
169 3300005577 Ga0068857_100186649 Ga0068857_1001866494 253
170 3300005614 Ga0068856_100162747 Ga0068856_1001627473 253
171 3300005614 Ga0068856_100661751 Ga0068856_1006617512 253
172 3300005616 Ga0068852_100022064 Ga0068852_1000220645 253
173 3300005616 Ga0068852_100519922 Ga0068852_1005199222 253
174 3300005842 Ga0068858_100008177 Ga0068858_1000081774 253
175 3300005843 Ga0068860_100028426 Ga0068860_1000284267 253
176 3300006038 Ga0075365_10264727 Ga0075365_102647273 253
177 3300006237 Ga0097621_100014864 Ga0097621_1000148643 253
178 3300006237 Ga0097621_100045160 Ga0097621_1000451606 253
179 3300006237 Ga0097621_100501391 Ga0097621_1005013912 253
180 3300006358 Ga0068871_100024344 Ga0068871_1000243447 253
181 3300006881 Ga0068865_100005010 Ga0068865_10000501011 253
182 3300006881 Ga0068865_100019886 Ga0068865_1000198862 253
183 3300009093 Ga0105240_10004196 Ga0105240_1000419620 253
184 3300009093 Ga0105240_10201275 Ga0105240_102012751 253
185 3300009093 Ga0105240_10555122 Ga0105240_105551222 253
186 3300009093 Ga0105240_10577771 Ga0105240_105777711 253
187 3300009093 Ga0105240_10646544 Ga0105240_106465442 253
188 3300009098 Ga0105245_10054260 Ga0105245_100542603 253
189 3300009098 Ga0105245_10166034 Ga0105245_101660343 253
190 3300009098 Ga0105245_10170740 Ga0105245_101707404 253
191 3300009098 Ga0105245_10338027 Ga0105245_103380272 253
192 3300009101 Ga0105247_10089914 Ga0105247_100899143 253
193 3300009101 Ga0105247_10107617 Ga0105247_101076172 253
194 3300009148 Ga0105243_10003953 Ga0105243_100039539 253
195 3300009174 Ga0105241_10479596 Ga0105241_104795962 253
196 3300009176 Ga0105242_10014464 Ga0105242_100144645 253
197 3300009176 Ga0105242_10074353 Ga0105242_100743533 253
198 3300009176 Ga0105242_10346763 Ga0105242_103467632 253
199 3300009176 Ga0105242_10435450 Ga0105242_104354502 253
200 3300009177 Ga0105248_10026644 Ga0105248_100266441 253
201 3300009177 Ga0105248_10127395 Ga0105248_101273953 253
202 3300009177 Ga0105248_10161887 Ga0105248_101618872 253
203 3300009177 Ga0105248_10708030 Ga0105248_107080302 253
204 3300009551 Ga0105238_10019040 Ga0105238_100190406 253
205 3300009551 Ga0105238_10090388 Ga0105238_100903882 253
206 3300009551 Ga0105238_10664688 Ga0105238_106646882 253
207 3300009553 Ga0105249_10197120 Ga0105249_101971204 253
208 3300009553 Ga0105249_11152650 Ga0105249_111526501 253
209 3300010375 Ga0105239_10007357 Ga0105239_1000735714 253
210 3300010375 Ga0105239_10013684 Ga0105239_100136848 253
211 3300010375 Ga0105239_10147716 Ga0105239_101477162 253
212 3300010375 Ga0105239_10567983 Ga0105239_105679832 253
213 3300013104 Ga0157370_10072047 Ga0157370_100720473 253
214 3300013104 Ga0157370_10143998 Ga0157370_101439981 253
215 3300013105 Ga0157369_10032900 Ga0157369_100329002 253
216 3300013105 Ga0157369_10065549 Ga0157369_100655493 253
217 3300013105 Ga0157369_10457613 Ga0157369_104576132 253
218 3300013105 Ga0157369_10618029 Ga0157369_106180291 253
219 3300013296 Ga0157374_10102958 Ga0157374_101029584 253
220 3300013297 Ga0157378_10059858 Ga0157378_100598585 253
221 3300013297 Ga0157378_10092124 Ga0157378_100921243 253
222 3300013297 Ga0157378_10122240 Ga0157378_101222402 253
223 3300013297 Ga0157378_10380695 Ga0157378_103806951 253
224 3300013306 Ga0163162_10019121 Ga0163162_100191213 253
225 3300013306 Ga0163162_10056398 Ga0163162_100563982 253
226 3300013307 Ga0157372_10024682 Ga0157372_100246822 253
227 3300013308 Ga0157375_10047895 Ga0157375_100478952 253
228 3300014325 Ga0163163_10000073 Ga0163163_1000007325 253
229 3300014325 Ga0163163_10086476 Ga0163163_100864764 253
230 3300014325 Ga0163163_10219445 Ga0163163_102194452 253
231 3300014326 Ga0157380_10496748 Ga0157380_104967481 253
232 3300014745 Ga0157377_10065850 Ga0157377_100658503 253
233 3300014968 Ga0157379_10000138 Ga0157379_1000013818 253
234 3300014968 Ga0157379_10041725 Ga0157379_100417254 253
235 3300014968 Ga0157379_10125682 Ga0157379_101256822 253
236 3300014968 Ga0157379_10558745 Ga0157379_105587452 253
237 3300014969 Ga0157376_10348112 Ga0157376_103481122 253
238 3300014969 Ga0157376_10351257 Ga0157376_103512571 253
239 3300017792 Ga0163161_10143511 Ga0163161_101435112 253
240 3300025901 Ga0207688_10043520 Ga0207688_100435204 253
241 3300025903 Ga0207680_10013534 Ga0207680_100135342 253
242 3300025907 Ga0207645_10031249 Ga0207645_100312495 253
243 3300025909 Ga0207705_10004034 Ga0207705_100040346 253
244 3300025909 Ga0207705_10048181 Ga0207705_100481814 253
245 3300025909 Ga0207705_10118682 Ga0207705_101186822 253
246 3300025912 Ga0207707_10000011 Ga0207707_1000001150 253
247 3300025912 Ga0207707_10412770 Ga0207707_104127702 253
248 3300025913 Ga0207695_10000018 Ga0207695_1000001879 253
249 3300025913 Ga0207695_10196261 Ga0207695_101962612 253
250 3300025913 Ga0207695_10348050 Ga0207695_103480502 253
251 3300025913 Ga0207695_10394016 Ga0207695_103940162 253
252 3300025919 Ga0207657_10005193 Ga0207657_1000519313 253
253 3300025920 Ga0207649_10186684 Ga0207649_101866842 253
254 3300025920 Ga0207649_10225455 Ga0207649_102254552 253
255 3300025921 Ga0207652_10008385 Ga0207652_100083855 253
256 3300025924 Ga0207694_10000010 Ga0207694_10000010401 253
257 3300025924 Ga0207694_10101334 Ga0207694_101013344 253
258 3300025924 Ga0207694_10305050 Ga0207694_103050502 253
259 3300025926 Ga0207659_10172637 Ga0207659_101726372 253
260 3300025927 Ga0207687_10134460 Ga0207687_101344602 253
261 3300025927 Ga0207687_10148516 Ga0207687_101485162 253
262 3300025931 Ga0207644_10561829 Ga0207644_105618291 253
263 3300025933 Ga0207706_10300891 Ga0207706_103008912 253
264 3300025934 Ga0207686_10058677 Ga0207686_100586773 253
265 3300025934 Ga0207686_10171595 Ga0207686_101715952 253
266 3300025934 Ga0207686_10230637 Ga0207686_102306372 253
267 3300025935 Ga0207709_10001826 Ga0207709_100018266 253
268 3300025937 Ga0207669_10067092 Ga0207669_100670923 253
269 3300025938 Ga0207704_10210303 Ga0207704_102103032 253
270 3300025938 Ga0207704_10277401 Ga0207704_102774012 253
271 3300025941 Ga0207711_10010879 Ga0207711_1001087911 253
272 3300025941 Ga0207711_10144897 Ga0207711_101448973 253
273 3300025941 Ga0207711_10292005 Ga0207711_102920052 253
274 3300025941 Ga0207711_10496811 Ga0207711_104968112 253
275 3300025942 Ga0207689_10063377 Ga0207689_100633773 253
276 3300025944 Ga0207661_10401421 Ga0207661_104014212 253
277 3300025949 Ga0207667_10000388 Ga0207667_1000038821 253
278 3300025949 Ga0207667_10026472 Ga0207667_100264722 253
279 3300025949 Ga0207667_10035916 Ga0207667_100359164 253
280 3300025949 Ga0207667_10114377 Ga0207667_101143772 253
281 3300025949 Ga0207667_10258162 Ga0207667_102581621 253
282 3300025961 Ga0207712_10151594 Ga0207712_101515942 253
283 3300025986 Ga0207658_10052398 Ga0207658_100523983 253
284 3300025986 Ga0207658_10078172 Ga0207658_100781722 253
285 3300026023 Ga0207677_10093057 Ga0207677_100930572 253
286 3300026041 Ga0207639_10207683 Ga0207639_102076832 253
287 3300026041 Ga0207639_10215300 Ga0207639_102153002 253
288 3300026078 Ga0207702_10141439 Ga0207702_101414393 253
289 3300026089 Ga0207648_10045967 Ga0207648_100459672 253
290 3300026118 Ga0207675_100577197 Ga0207675_1005771971 253
291 3300026121 Ga0207683_10028767 Ga0207683_100287678 253
292 3300026121 Ga0207683_10028936 Ga0207683_100289365 253
293 3300026121 Ga0207683_10051928 Ga0207683_100519286 253
294 3300026121 Ga0207683_10063865 Ga0207683_100638652 253
295 3300026142 Ga0207698_10023033 Ga0207698_100230334 253
296 3300026142 Ga0207698_10044068 Ga0207698_100440684 253
297 3300028379 Ga0268266_10000557 Ga0268266_1000055749 253
298 3300028379 Ga0268266_10108041 Ga0268266_101080412 253
299 3300028379 Ga0268266_10257106 Ga0268266_102571062 253
300 3300028380 Ga0268265_10631911 Ga0268265_106319111 253
301 3300028381 Ga0268264_10085736 Ga0268264_100857363 253
302 3300028577 Ga0265318_10000037 Ga0265318_1000003759 253
303 3300028800 Ga0265338_10000775 Ga0265338_100007753 253
304 3300031235 Ga0265330_10081310 Ga0265330_100813102 253
305 3300031235 Ga0265330_10106927 Ga0265330_101069271 253
306 3300031241 Ga0265325_10032279 Ga0265325_100322791 253
307 3300031247 Ga0265340_10009373 Ga0265340_100093735 253
308 3300031249 Ga0265339_10020609 Ga0265339_100206094 253
309 3300031249 Ga0265339_10063164 Ga0265339_100631641 253
310 3300031249 Ga0265339_10127449 Ga0265339_101274492 253
311 3300031250 Ga0265331_10034687 Ga0265331_100346873 253
312 3300031711 Ga0265314_10001970 Ga0265314_100019702 253
313 3300031711 Ga0265314_10034484 Ga0265314_100344842 253
314 3300031730 Ga0307516_10038778 Ga0307516_100387785 253
315 3300035691 Ga0373931_0392153 Ga0373931_0392153_79_843 253
316 3300036401 Ga0373937_0437370 Ga0373937_0437370_304_1089 253
317 3300037418 Ga0395900_0105348 Ga0395900_0105348_35_796 253
318 3300045976 Ga0466967_0018991 Ga0466967_0018991_2748_3524 253
319 3300046507 Ga0495606_0284343 Ga0495606_0284343_43_807 253
320 3300046517 Ga0495630_0449334 Ga0495630_0449334_179_943 253
321 3300046529 Ga0495652_0128573 Ga0495652_0128573_713_1501 253
322 3300046543 Ga0495645_0087571 Ga0495645_0087571_1055_1840 253
323 3300046557 Ga0495622_0003630 Ga0495622_0003630_4608_5372 253
324 3300047318 Ga0495636_0060222 Ga0495636_0060222_617_1381 253
325 3300047444 Ga0495675_0053220 Ga0495675_0053220_722_1510 253
326 3300049460 Ga0495682_0001799 Ga0495682_0001799_6294_7076 253
327 3300049568 Ga0501031_0012708 Ga0501031_0012708_690_1478 253
328 3300049568 Ga0501031_0080380 Ga0501031_0080380_1222_2025 253
329 3300049570 Ga0501033_0021148 Ga0501033_0021148_1809_2570 253
330 3300049570 Ga0501033_0086394 Ga0501033_0086394_1027_1830 253
331 3300049570 Ga0501033_0204744 Ga0501033_0204744_57_842 253
332 3300049571 Ga0501034_0007767 Ga0501034_0007767_3778_4566 253
333 3300049571 Ga0501034_0409518 Ga0501034_0409518_332_1120 253
334 3300049572 Ga0501036_0004972 Ga0501036_0004972_4177_4965 253
335 3300049572 Ga0501036_0062123 Ga0501036_0062123_76_837 253
336 3300049573 Ga0501037_0019402 Ga0501037_0019402_445_1233 253
337 3300049573 Ga0501037_0107593 Ga0501037_0107593_72_875 253
338 3300049574 Ga0501038_0006055 Ga0501038_0006055_2032_2820 253
339 3300049574 Ga0501038_0038715 Ga0501038_0038715_203_991 253
340 3300049574 Ga0501038_0381017 Ga0501038_0381017_126_887 253
341 3300049575 Ga0501039_0010992 Ga0501039_0010992_5886_6674 253
342 3300049578 Ga0501042_0020277 Ga0501042_0020277_228_1016 253
343 3300049579 Ga0501043_0008155 Ga0501043_0008155_644_1432 253
344 3300049579 Ga0501043_0019473 Ga0501043_0019473_4378_5139 253
345 3300049579 Ga0501043_0098661 Ga0501043_0098661_723_1526 253
346 3300049580 Ga0501046_0007884 Ga0501046_0007884_8331_9119 253
347 3300049581 Ga0501047_0004848 Ga0501047_0004848_11733_12521 253
348 3300049581 Ga0501047_0016074 Ga0501047_0016074_4380_5141 253
349 3300049581 Ga0501047_0016655 Ga0501047_0016655_924_1727 253
350 3300049581 Ga0501047_0050994 Ga0501047_0050994_846_1631 253
351 3300049581 Ga0501047_0085645 Ga0501047_0085645_1543_2331 253
352 3300049581 Ga0501047_0408898 Ga0501047_0408898_105_893 253
353 3300049583 Ga0501067_0001000 Ga0501067_0001000_8391_9179 253
354 3300049583 Ga0501067_0004955 Ga0501067_0004955_5810_6598 253
355 3300049584 Ga0501068_0071477 Ga0501068_0071477_325_1113 253
356 3300049585 Ga0501069_0001204 Ga0501069_0001204_2005_2793 253
357 3300049586 Ga0501070_0008327 Ga0501070_0008327_5718_6503 253
358 3300049586 Ga0501070_0167321 Ga0501070_0167321_970_1758 253
359 3300049588 Ga0501072_0033682 Ga0501072_0033682_2662_3450 253
360 3300049589 Ga0501073_0012394 Ga0501073_0012394_1098_1886 253
361 3300049589 Ga0501073_0020526 Ga0501073_0020526_3821_4606 253
362 3300049590 Ga0501074_0052888 Ga0501074_0052888_1646_2431 253
363 3300049590 Ga0501074_0132124 Ga0501074_0132124_916_1704 253
364 3300049590 Ga0501074_0141118 Ga0501074_0141118_52_840 253
365 3300049741 Ga0501079_0019737 Ga0501079_0019737_340_1128 253
366 3300049742 Ga0501080_0115830 Ga0501080_0115830_409_1170 253
367 3300049742 Ga0501080_0459621 Ga0501080_0459621_200_985 253
368 3300049744 Ga0501083_0010092 Ga0501083_0010092_3961_4749 253
369 3300049822 Ga0501035_0012874 Ga0501035_0012874_3748_4551 253
370 3300049822 Ga0501035_0052670 Ga0501035_0052670_94_882 253
371 3300049822 Ga0501035_0234212 Ga0501035_0234212_73_834 253
372 3300049822 Ga0501035_0263711 Ga0501035_0263711_555_1340 253
373 3300049822 Ga0501035_0380356 Ga0501035_0380356_297_1085 253
374 3300049823 Ga0501044_0005077 Ga0501044_0005077_458_1243 253
375 3300049823 Ga0501044_0008569 Ga0501044_0008569_6204_6965 253
376 3300049823 Ga0501044_0026821 Ga0501044_0026821_856_1659 253
377 3300049823 Ga0501044_0111359 Ga0501044_0111359_1846_2634 253
378 3300049823 Ga0501044_0317620 Ga0501044_0317620_350_1135 253
379 3300053119 Ga0500595_011166 Ga0500595_011166_41_805 253
380 3300053133 Ga0500655_002975 Ga0500655_002975_1252_2034 253
381 3300053133 Ga0500655_005358 Ga0500655_005358_1111_1893 253
382 3300053140 Ga0500573_0000057 Ga0500573_0000057_65049_65813 253
383 3300054114 Ga0501084_0000175 Ga0501084_0000175_4697_5482 253
384 3300054114 Ga0501084_0025187 Ga0501084_0025187_4094_4882 253
385 3300054114 Ga0501084_0179287 Ga0501084_0179287_891_1676 253
386 3300054114 Ga0501084_0444129 Ga0501084_0444129_139_927 253
387 3300060353 Ga0501082_0005934 Ga0501082_0005934_9567_10355 253
388 3300003214 JGI25165J46597_1000286 JGI25165J46597_100028620 254
389 3300005341 Ga0070691_10007476 Ga0070691_100074767 254
390 3300005434 Ga0070709_10001074 Ga0070709_1000107411 254
391 3300005435 Ga0070714_100037554 Ga0070714_1000375545 254
392 3300005436 Ga0070713_100000012 Ga0070713_100000012155 254
393 3300005437 Ga0070710_10053662 Ga0070710_100536623 254
394 3300005439 Ga0070711_100007796 Ga0070711_1000077962 254
395 3300005439 Ga0070711_100391904 Ga0070711_1003919042 254
396 3300005440 Ga0070705_100363907 Ga0070705_1003639071 254
397 3300005458 Ga0070681_10294509 Ga0070681_102945092 254
398 3300005535 Ga0070684_100627672 Ga0070684_1006276721 254
399 3300005539 Ga0068853_100282358 Ga0068853_1002823582 254
400 3300005545 Ga0070695_100172090 Ga0070695_1001720903 254
401 3300005547 Ga0070693_100228680 Ga0070693_1002286802 254
402 3300005577 Ga0068857_100049001 Ga0068857_1000490013 254
403 3300005578 Ga0068854_100066114 Ga0068854_1000661142 254
404 3300005614 Ga0068856_100001032 Ga0068856_10000103242 254
405 3300005614 Ga0068856_100002049 Ga0068856_1000020492 254
406 3300005614 Ga0068856_100503507 Ga0068856_1005035072 254
407 3300005616 Ga0068852_100155263 Ga0068852_1001552633 254
408 3300005841 Ga0068863_100084777 Ga0068863_1000847774 254
409 3300005842 Ga0068858_100083541 Ga0068858_1000835413 254
410 3300005842 Ga0068858_100104714 Ga0068858_1001047143 254
411 3300005844 Ga0068862_100304958 Ga0068862_1003049581 254
412 3300006173 Ga0070716_100084622 Ga0070716_1000846222 254
413 3300006175 Ga0070712_100002398 Ga0070712_1000023982 254
414 3300006175 Ga0070712_100051263 Ga0070712_1000512632 254
415 3300006871 Ga0075434_100012728 Ga0075434_1000127286 254
416 3300006914 Ga0075436_100001059 Ga0075436_10000105919 254
417 3300006914 Ga0075436_100014771 Ga0075436_1000147716 254
418 3300007076 Ga0075435_100022968 Ga0075435_1000229685 254
419 3300007076 Ga0075435_100290898 Ga0075435_1002908981 254
420 3300009093 Ga0105240_10047301 Ga0105240_100473015 254
421 3300009174 Ga0105241_10195751 Ga0105241_101957513 254
422 3300009545 Ga0105237_10069149 Ga0105237_100691494 254
423 3300009551 Ga0105238_10069584 Ga0105238_100695843 254
424 3300010375 Ga0105239_10095593 Ga0105239_100955933 254
425 3300013100 Ga0157373_10007408 Ga0157373_100074082 254
426 3300013104 Ga0157370_10003563 Ga0157370_100035637 254
427 3300013105 Ga0157369_10065531 Ga0157369_100655315 254
428 3300013296 Ga0157374_10017296 Ga0157374_100172966 254
429 3300013297 Ga0157378_10568436 Ga0157378_105684361 254
430 3300013306 Ga0163162_10257540 Ga0163162_102575402 254
431 3300013307 Ga0157372_10152455 Ga0157372_101524552 254
432 3300014968 Ga0157379_10013925 Ga0157379_100139256 254
433 3300014968 Ga0157379_10048487 Ga0157379_100484871 254
434 3300014968 Ga0157379_10181935 Ga0157379_101819353 254
435 3300022467 Ga0224712_10034234 Ga0224712_100342342 254
436 3300025261 Ga0209233_1000013 Ga0209233_1000013770 254
437 3300025261 Ga0209233_1012065 Ga0209233_10120652 254
438 3300025297 Ga0209758_1000013 Ga0209758_1000013869 254
439 3300025898 Ga0207692_10074002 Ga0207692_100740022 254
440 3300025906 Ga0207699_10023111 Ga0207699_100231115 254
441 3300025906 Ga0207699_10147511 Ga0207699_101475112 254
442 3300025911 Ga0207654_10045740 Ga0207654_100457404 254
443 3300025914 Ga0207671_10049492 Ga0207671_100494922 254
444 3300025915 Ga0207693_10004683 Ga0207693_100046831 254
445 3300025915 Ga0207693_10012582 Ga0207693_100125821 254
446 3300025916 Ga0207663_10010691 Ga0207663_100106916 254
447 3300025920 Ga0207649_10000194 Ga0207649_1000019411 254
448 3300025924 Ga0207694_10188782 Ga0207694_101887822 254
449 3300025928 Ga0207700_10000191 Ga0207700_1000019139 254
450 3300025928 Ga0207700_10000295 Ga0207700_1000029542 254
451 3300025929 Ga0207664_10040556 Ga0207664_100405566 254
452 3300025939 Ga0207665_10024913 Ga0207665_100249135 254
453 3300025945 Ga0207679_10206395 Ga0207679_102063952 254
454 3300025949 Ga0207667_10027680 Ga0207667_100276805 254
455 3300025981 Ga0207640_10053576 Ga0207640_100535762 254
456 3300026035 Ga0207703_10010416 Ga0207703_100104166 254
457 3300026041 Ga0207639_10040049 Ga0207639_100400495 254
458 3300026078 Ga0207702_10000315 Ga0207702_100003159 254
459 3300026078 Ga0207702_10003407 Ga0207702_1000340714 254
460 3300026116 Ga0207674_10000904 Ga0207674_1000090441 254
461 3300028380 Ga0268265_10064248 Ga0268265_100642485 254
462 3300028800 Ga0265338_10009204 Ga0265338_1000920410 254
463 3300028800 Ga0265338_10180840 Ga0265338_101808402 254
464 3300031240 Ga0265320_10002508 Ga0265320_1000250811 254
465 3300031241 Ga0265325_10010992 Ga0265325_100109922 254
466 3300031241 Ga0265325_10016368 Ga0265325_100163686 254
467 3300031241 Ga0265325_10019137 Ga0265325_100191374 254
468 3300031247 Ga0265340_10052238 Ga0265340_100522381 254
469 3300031247 Ga0265340_10192696 Ga0265340_101926961 254
470 3300031249 Ga0265339_10002935 Ga0265339_100029356 254
471 3300031249 Ga0265339_10037418 Ga0265339_100374183 254
472 3300031249 Ga0265339_10090131 Ga0265339_100901312 254
473 3300031250 Ga0265331_10000186 Ga0265331_1000018680 254
474 3300031250 Ga0265331_10002819 Ga0265331_1000281911 254
475 3300031251 Ga0265327_10000392 Ga0265327_1000039278 254
476 3300031344 Ga0265316_10209448 Ga0265316_102094482 254
477 3300031595 Ga0265313_10006862 Ga0265313_100068628 254
478 3300031595 Ga0265313_10055783 Ga0265313_100557833 254
479 3300031711 Ga0265314_10017968 Ga0265314_100179687 254
480 3300031711 Ga0265314_10048328 Ga0265314_100483282 254
481 3300031711 Ga0265314_10062206 Ga0265314_100622062 254
482 3300031711 Ga0265314_10093776 Ga0265314_100937763 254
483 3300031712 Ga0265342_10189291 Ga0265342_101892911 254
484 3300031730 Ga0307516_10122926 Ga0307516_101229264 254
485 3300035119 Ga0373956_0104602 Ga0373956_0104602_320_1108 254
486 3300035172 Ga0373955_0173738 Ga0373955_0173738_274_1062 254
487 3300035724 Ga0373933_0077140 Ga0373933_0077140_55_843 254
488 3300036401 Ga0373937_0002620 Ga0373937_0002620_1946_2734 254
489 3300039437 Ga0436365_0750348 Ga0436365_0750348_216_1004 254
490 3300046472 Ga0495580_0201076 Ga0495580_0201076_244_1032 254
491 3300047471 Ga0495684_0115498 Ga0495684_0115498_156_941 254
492 3300048088 Ga0495602_0203650 Ga0495602_0203650_414_1202 254
493 3300048914 Ga0496111_0127917 Ga0496111_0127917_661_1449 254
494 3300048924 Ga0496121_0005378 Ga0496121_0005378_3926_4717 254
495 3300048929 Ga0496126_0000480 Ga0496126_0000480_47356_48141 254
496 3300049570 Ga0501033_0019617 Ga0501033_0019617_3705_4499 254
497 3300049570 Ga0501033_0119291 Ga0501033_0119291_55_843 254
498 3300049571 Ga0501034_0584339 Ga0501034_0584339_176_970 254
499 3300049574 Ga0501038_0101438 Ga0501038_0101438_1545_2333 254
500 3300049579 Ga0501043_0043904 Ga0501043_0043904_204_992 254
501 3300049580 Ga0501046_0067602 Ga0501046_0067602_148_936 254
502 3300049581 Ga0501047_0482170 Ga0501047_0482170_77_889 254
503 3300049586 Ga0501070_0122812 Ga0501070_0122812_873_1667 254
504 3300049589 Ga0501073_0040124 Ga0501073_0040124_2042_2830 254
505 3300049589 Ga0501073_0331762 Ga0501073_0331762_126_890 254
506 3300049742 Ga0501080_0068141 Ga0501080_0068141_1619_2407 254
507 3300049823 Ga0501044_0349711 Ga0501044_0349711_223_1017 254
508 3300049823 Ga0501044_0653252 Ga0501044_0653252_77_889 254
509 3300050512 nmdc:mga0n895_192702_c1 nmdc:mga0n895_192702_c1_1269_2057 254
510 3300050512 nmdc:mga0n895_5762_c1 nmdc:mga0n895_5762_c1_6726_7514 254
511 3300050513 nmdc:mga0rr50_17246_c1 nmdc:mga0rr50_17246_c1_3192_3980 254
512 3300050513 nmdc:mga0rr50_348700_c1 nmdc:mga0rr50_348700_c1_77_865 254
513 3300050514 nmdc:mga08x19_295437_c1 nmdc:mga08x19_295437_c1_148_936 254
514 3300050514 nmdc:mga08x19_6201_c1 nmdc:mga08x19_6201_c1_148_936 254
515 3300053087 Ga0500643_000003 Ga0500643_000003_46971_47750 254
516 3300053119 Ga0500595_068751 Ga0500595_068751_114_899 254
517 3300060353 Ga0501082_0248406 Ga0501082_0248406_164_928 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

55

224

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2goy-assembly2.cif.gz_E crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound aps 0.8898 28 237
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.8571 26 225
1sur-assembly1.cif.gz_A-2 phospho-adenylyl-sulfate reductase 0.85 22 218
6vpu-assembly8.cif.gz_H 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus 0.848 22 229
2oq2-assembly2.cif.gz_C crystal structure of yeast paps reductase with pap, a product complex 0.8469 26 247
ID Description Score Start End Superfamily
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8898 28 237 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8677 26 248 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8441 22 219 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8412 28 237 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8266 26 249 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1Q3JDT9-F1-model_v4 deleted 0.958 21 254
AF-A0A5R2N3D8-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9543 68 230 GO:0004604
GO:0005737
GO:0019379
AF-W9H941-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9514 28 250 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814
AF-A0A545B7B6-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9514 24 247 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814
AF-A0A4S2H3T5-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9508 22 247 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814

Feature Viewer

pLDDT pTM Quality
80.33 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map