F458111

General Info

Members Datasets Scaffolds Average Seq Length
517 243 1034 171

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100032343|Ga0068860_1000323435
Length 200
Sequence MLHSCNACAIIAKLSIKSNSVKEIHMSTSTAASTNNIASALVAEMEQEAAVARKCLERVPAEKFDWKPHEKSMTFVRLASHVAEMFGWTPPTLEHPELDFSKMDYKPAEPKTTEELVEILDKNVTEAIACLKNTRDETFMEDWTMRNGEQVYFTMPKIAVMRSFVMNHIVHHRGQLSVYLRLNDIPVPAMYGPSADEGKM

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
208 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
209 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
215 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
216 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
217 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
220 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
221 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
229 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
230 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
231 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
232 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
233 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
234 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.39
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 19.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100032343 3300005843 Bacteria 5026
2 MBSR1b_contig_3852737 2162886012 Bacteria 976
3 Ga0065712_10088161 3300005290 Bacteria 2535
4 Ga0065715_10024599 3300005293 Bacteria 1690
5 Ga0065715_10137837 3300005293 Unclassified 1901
6 Ga0065707_10322053 3300005295 Bacteria 964
7 Ga0070658_10003502 3300005327 Bacteria 12897
8 Ga0070658_10020504 3300005327 Bacteria 5299
9 Ga0070690_100020866 3300005330 Bacteria 3995
10 Ga0070670_100008804 3300005331 Bacteria 8615
11 Ga0070670_100015788 3300005331 Bacteria 6483
12 Ga0070670_100140474 3300005331 Bacteria 2088
13 Ga0070670_100909382 3300005331 Bacteria 798
14 Ga0070677_10140522 3300005333 Bacteria 1113
15 Ga0070677_10190439 3300005333 Bacteria 983
16 Ga0070677_10424589 3300005333 Bacteria 706
17 Ga0068869_101111969 3300005334 Bacteria 692
18 Ga0068869_101470660 3300005334 Unclassified 604
19 Ga0070666_10015212 3300005335 Bacteria 4906
20 Ga0070680_101207952 3300005336 Unclassified 654
21 Ga0068868_100012363 3300005338 Bacteria 6237
22 Ga0068868_100167216 3300005338 Bacteria 1819
23 Ga0068868_100604488 3300005338 Bacteria 972
24 Ga0070660_100079707 3300005339 Bacteria 2569
25 Ga0070660_100128287 3300005339 Unclassified 2028
26 Ga0070660_100837927 3300005339 Bacteria 774
27 Ga0070689_100069465 3300005340 Bacteria 2748
28 Ga0070687_100011444 3300005343 Bacteria 3881
29 Ga0070687_100016723 3300005343 Bacteria 3355
30 Ga0070661_100005085 3300005344 Bacteria 9074
31 Ga0070661_100042597 3300005344 Unclassified 3314
32 Ga0070661_100117206 3300005344 Bacteria 1992
33 Ga0070661_100257501 3300005344 Bacteria 1348
34 Ga0070668_100184231 3300005347 Bacteria 1707
35 Ga0070669_100374940 3300005353 Bacteria 1159
36 Ga0070675_100050544 3300005354 Bacteria 3413
37 Ga0070675_100140952 3300005354 Bacteria 2061
38 Ga0070675_100357078 3300005354 Unclassified 1297
39 Ga0070671_100136695 3300005355 Bacteria 2066
40 Ga0070674_100164503 3300005356 Bacteria 1686
41 Ga0070674_100292479 3300005356 Bacteria 1295
42 Ga0070673_100034014 3300005364 Unclassified 3852
43 Ga0070673_100233408 3300005364 Bacteria 1597
44 Ga0070688_100138306 3300005365 Unclassified 1651
45 Ga0070667_100232352 3300005367 Bacteria 1645
46 Ga0070703_10132167 3300005406 Bacteria 918
47 Ga0070709_10376588 3300005434 Bacteria 1054
48 Ga0070713_100000906 3300005436 Bacteria 18934
49 Ga0070710_10711275 3300005437 Bacteria 710
50 Ga0070701_10289276 3300005438 Bacteria 1003
51 Ga0070701_10398831 3300005438 Unclassified 871
52 Ga0070711_100200318 3300005439 Bacteria 1540
53 Ga0070705_100022117 3300005440 Bacteria 3393
54 Ga0070694_100107216 3300005444 Bacteria 1985
55 Ga0070694_100340764 3300005444 Bacteria 1159
56 Ga0070694_100478004 3300005444 Unclassified 988
57 Ga0070708_100934895 3300005445 Bacteria 814
58 Ga0070663_100011280 3300005455 Bacteria 5603
59 Ga0070678_100203752 3300005456 Bacteria 1635
60 Ga0070662_100032017 3300005457 Bacteria 3695
61 Ga0070662_100165506 3300005457 Bacteria 1733
62 Ga0070662_100378777 3300005457 Bacteria 1164
63 Ga0070681_10053788 3300005458 Bacteria 4011
64 Ga0068867_100145816 3300005459 Bacteria 1855
65 Ga0068867_100306503 3300005459 Unclassified 1311
66 Ga0068867_100554912 3300005459 Unclassified 996
67 Ga0068867_101066931 3300005459 Bacteria 736
68 Ga0070685_10004270 3300005466 Bacteria 7216
69 Ga0070685_10244984 3300005466 Unclassified 1185
70 Ga0070707_100911797 3300005468 Unclassified 843
71 Ga0070707_100990628 3300005468 Unclassified 806
72 Ga0070698_100407767 3300005471 Bacteria 1293
73 Ga0070698_100471087 3300005471 Unclassified 1192
74 Ga0070698_100635881 3300005471 Bacteria 1008
75 Ga0070679_100049596 3300005530 Unclassified 4181
76 Ga0070679_100386077 3300005530 Unclassified 1347
77 Ga0070684_100350010 3300005535 Bacteria 1359
78 Ga0070684_100658245 3300005535 Bacteria 975
79 Ga0070697_100041951 3300005536 Bacteria 3704
80 Ga0070697_100109718 3300005536 Unclassified 2298
81 Ga0068853_100002139 3300005539 Bacteria 14707
82 Ga0068853_100003218 3300005539 Bacteria 12483
83 Ga0068853_100028402 3300005539 Unclassified 4705
84 Ga0068853_100107058 3300005539 Bacteria 2479
85 Ga0068853_100293942 3300005539 Bacteria 1500
86 Ga0068853_101160321 3300005539 Unclassified 745
87 Ga0070672_100012397 3300005543 Bacteria 5983
88 Ga0070672_100261477 3300005543 Bacteria 1459
89 Ga0070672_101190270 3300005543 Unclassified 679
90 Ga0070686_100019250 3300005544 Bacteria 4019
91 Ga0070695_100060908 3300005545 Bacteria 2447
92 Ga0070695_100095860 3300005545 Viruses 1989
93 Ga0070696_100484797 3300005546 Bacteria 981
94 Ga0070696_100906900 3300005546 Unclassified 731
95 Ga0070693_100043442 3300005547 Bacteria 2538
96 Ga0070693_100347990 3300005547 Bacteria 1013
97 Ga0070665_100000090 3300005548 Bacteria 175078
98 Ga0070665_100059582 3300005548 Bacteria 3827
99 Ga0070704_100021035 3300005549 Bacteria 4222
100 Ga0070704_100175770 3300005549 Bacteria 1708
101 Ga0070704_100288621 3300005549 Bacteria 1362
102 Ga0068855_100129386 3300005563 Bacteria 2884
103 Ga0068855_100357463 3300005563 Bacteria 1608
104 Ga0068855_100449218 3300005563 Bacteria 1407
105 Ga0070664_100007104 3300005564 Bacteria 9032
106 Ga0070664_100018597 3300005564 Bacteria 5712
107 Ga0070664_100026722 3300005564 Bacteria 4791
108 Ga0070664_100093779 3300005564 Bacteria 2602
109 Ga0070664_100314750 3300005564 Bacteria 1417
110 Ga0070664_100463857 3300005564 Bacteria 1164
111 Ga0068857_100000991 3300005577 Bacteria 21791
112 Ga0068857_100007220 3300005577 Bacteria 9566
113 Ga0068857_100257772 3300005577 Bacteria 1600
114 Ga0068857_100785717 3300005577 Bacteria 908
115 Ga0068854_100027672 3300005578 Unclassified 3910
116 Ga0068854_100263226 3300005578 Bacteria 1381
117 Ga0068856_100011595 3300005614 Bacteria 8550
118 Ga0068856_100113415 3300005614 Bacteria 2709
119 Ga0070702_100034460 3300005615 Bacteria 2791
120 Ga0068852_100162641 3300005616 Bacteria 2085
121 Ga0068852_100311216 3300005616 Bacteria 1527
122 Ga0068859_100037576 3300005617 Bacteria 4859
123 Ga0068859_100089289 3300005617 Bacteria 3132
124 Ga0068859_100435466 3300005617 Bacteria 1407
125 Ga0068859_100675363 3300005617 Bacteria 1124
126 Ga0068859_100826426 3300005617 Bacteria 1013
127 Ga0068859_101616527 3300005617 Unclassified 716
128 Ga0068864_100123676 3300005618 Bacteria 2316
129 Ga0068864_100142162 3300005618 Unclassified 2166
130 Ga0068864_100171083 3300005618 Bacteria 1981
131 Ga0068864_100415761 3300005618 Bacteria 1280
132 Ga0068864_100845520 3300005618 Bacteria 901
133 Ga0068866_10022986 3300005718 Bacteria 2894
134 Ga0068861_100083276 3300005719 Unclassified 2509
135 Ga0068861_100182682 3300005719 Bacteria 1747
136 Ga0068861_100665849 3300005719 Unclassified 963
137 Ga0068870_10036380 3300005840 Bacteria 2533
138 Ga0068870_10067283 3300005840 Bacteria 1943
139 Ga0068870_10130256 3300005840 Unclassified 1460
140 Ga0068870_10299684 3300005840 Bacteria 1014
141 Ga0068870_10691018 3300005840 Unclassified 703
142 Ga0068863_100033399 3300005841 Bacteria 4901
143 Ga0068863_100044433 3300005841 Bacteria 4217
144 Ga0068863_100119258 3300005841 Bacteria 2515
145 Ga0068863_100319735 3300005841 Unclassified 1507
146 Ga0068863_100584501 3300005841 Bacteria 1104
147 Ga0068858_100103767 3300005842 Bacteria 2653
148 Ga0068858_100193179 3300005842 Bacteria 1923
149 Ga0068860_100033171 3300005843 Bacteria 4956
150 Ga0068860_100062662 3300005843 Bacteria 3533
151 Ga0068860_100078246 3300005843 Unclassified 3145
152 Ga0068860_101135183 3300005843 Bacteria 801
153 Ga0068862_100075083 3300005844 Bacteria 2923
154 Ga0068862_100149046 3300005844 Bacteria 2081
155 Ga0068862_100167878 3300005844 Bacteria 1963
156 Ga0081455_10129462 3300005937 Bacteria 1976
157 Ga0081540_1203485 3300005983 Unclassified 718
158 Ga0070717_10014761 3300006028 Bacteria 6009
159 Ga0070717_10816180 3300006028 Unclassified 849
160 Ga0070716_100194493 3300006173 Bacteria 1343
161 Ga0070712_100211711 3300006175 Bacteria 1529
162 Ga0070712_100559588 3300006175 Bacteria 964
163 Ga0097621_100034223 3300006237 Unclassified 4052
164 Ga0097621_100042424 3300006237 Bacteria 3664
165 Ga0097621_100052912 3300006237 Bacteria 3308
166 Ga0097621_100578648 3300006237 Bacteria 1024
167 Ga0068871_100015323 3300006358 Bacteria 5734
168 Ga0068871_100049180 3300006358 Bacteria 3407
169 Ga0068871_100381780 3300006358 Bacteria 1252
170 Ga0068871_100722935 3300006358 Unclassified 914
171 Ga0075431_100108106 3300006847 Bacteria 2870
172 Ga0075431_100476388 3300006847 Bacteria 1241
173 Ga0075433_10611485 3300006852 Bacteria 956
174 Ga0075434_100310660 3300006871 Bacteria 1597
175 Ga0075434_100453875 3300006871 Bacteria 1303
176 Ga0075429_100360459 3300006880 Bacteria 1273
177 Ga0068865_100016027 3300006881 Bacteria 4788
178 Ga0068865_100124602 3300006881 Bacteria 1921
179 Ga0097620_100037578 3300006931 Bacteria 4859
180 Ga0097620_100089290 3300006931 Bacteria 3132
181 Ga0097620_100435481 3300006931 Bacteria 1407
182 Ga0097620_100675264 3300006931 Bacteria 1124
183 Ga0097620_100826465 3300006931 Bacteria 1013
184 Ga0097620_101616261 3300006931 Unclassified 716
185 Ga0105240_10242970 3300009093 Bacteria 2086
186 Ga0111539_10096593 3300009094 Bacteria 3471
187 Ga0111539_10205386 3300009094 Bacteria 2296
188 Ga0111539_10382767 3300009094 Bacteria 1638
189 Ga0111539_10445585 3300009094 Bacteria 1508
190 Ga0111539_10487405 3300009094 Bacteria 1436
191 Ga0111539_10940967 3300009094 Unclassified 1005
192 Ga0105245_10019789 3300009098 Bacteria 5900
193 Ga0105245_10735892 3300009098 Bacteria 1021
194 Ga0105245_10791392 3300009098 Bacteria 986
195 Ga0105247_10028466 3300009101 Bacteria 3381
196 Ga0114129_11261780 3300009147 Bacteria 917
197 Ga0105243_10255097 3300009148 Bacteria 1568
198 Ga0105243_10313912 3300009148 Bacteria 1426
199 Ga0105241_10094121 3300009174 Bacteria 2369
200 Ga0105242_10049526 3300009176 Bacteria 3419
201 Ga0105242_10056133 3300009176 Bacteria 3222
202 Ga0105242_10090598 3300009176 Bacteria 2573
203 Ga0105248_10025984 3300009177 Bacteria 6513
204 Ga0105248_10681640 3300009177 Bacteria 1160
205 Ga0105237_10862569 3300009545 Bacteria 912
206 Ga0105238_10124277 3300009551 Bacteria 2560
207 Ga0105249_10271083 3300009553 Bacteria 1691
208 Ga0105249_10645247 3300009553 Bacteria 1116
209 Ga0105249_11143418 3300009553 Unclassified 849
210 Ga0105239_10003819 3300010375 Bacteria 18311
211 Ga0105239_10233516 3300010375 Bacteria 2064
212 Ga0105239_11761225 3300010375 Bacteria 717
213 Ga0105246_10017355 3300011119 Bacteria 4573
214 Ga0157373_10009669 3300013100 Bacteria 7116
215 Ga0157373_10018710 3300013100 Bacteria 5042
216 Ga0157373_10032917 3300013100 Bacteria 3731
217 Ga0157371_11110863 3300013102 Bacteria 607
218 Ga0157370_10250424 3300013104 Bacteria 1638
219 Ga0157370_10259676 3300013104 Bacteria 1605
220 Ga0157369_10011209 3300013105 Bacteria 10189
221 Ga0157369_10105381 3300013105 Bacteria 3002
222 Ga0157369_10818228 3300013105 Bacteria 957
223 Ga0157374_10007960 3300013296 Bacteria 9053
224 Ga0157374_10222015 3300013296 Bacteria 1854
225 Ga0157374_10685603 3300013296 Unclassified 1037
226 Ga0157378_10041386 3300013297 Bacteria 4087
227 Ga0157378_10122729 3300013297 Bacteria 2397
228 Ga0157378_10473904 3300013297 Unclassified 1246
229 Ga0163162_10329950 3300013306 Bacteria 1658
230 Ga0163162_10494435 3300013306 Bacteria 1354
231 Ga0163162_10671214 3300013306 Unclassified 1159
232 Ga0157372_10025772 3300013307 Bacteria 6396
233 Ga0157372_10401970 3300013307 Bacteria 1596
234 Ga0157372_10507110 3300013307 Bacteria 1407
235 Ga0157372_10603646 3300013307 Bacteria 1279
236 Ga0157372_10666362 3300013307 Bacteria 1211
237 Ga0157375_10207631 3300013308 Bacteria 2115
238 Ga0157375_10518350 3300013308 Bacteria 1355
239 Ga0157375_10519532 3300013308 Bacteria 1354
240 Ga0163163_10005833 3300014325 Bacteria 10708
241 Ga0163163_10009110 3300014325 Bacteria 8844
242 Ga0163163_10021621 3300014325 Bacteria 6075
243 Ga0163163_10243743 3300014325 Bacteria 1847
244 Ga0163163_11536415 3300014325 Bacteria 727
245 Ga0163163_11840322 3300014325 Unclassified 665
246 Ga0157380_10030762 3300014326 Bacteria 4114
247 Ga0157380_10034742 3300014326 Bacteria 3890
248 Ga0157380_10046147 3300014326 Bacteria 3421
249 Ga0157380_10343005 3300014326 Bacteria 1394
250 Ga0157380_10731703 3300014326 Unclassified 998
251 Ga0182008_10141312 3300014497 Bacteria 1204
252 Ga0157377_10049945 3300014745 Bacteria 2353
253 Ga0157379_10022698 3300014968 Bacteria 5561
254 Ga0157379_11292251 3300014968 Bacteria 704
255 Ga0157376_10023099 3300014969 Bacteria 4862
256 Ga0157376_10128955 3300014969 Bacteria 2254
257 Ga0157376_10130736 3300014969 Bacteria 2240
258 Ga0157376_10697193 3300014969 Bacteria 1020
259 Ga0157376_11031656 3300014969 Unclassified 846
260 Ga0157376_12573044 3300014969 Unclassified 549
261 Ga0163161_10000630 3300017792 Bacteria 28107
262 Ga0163161_10062960 3300017792 Bacteria 2703
263 Ga0207697_10007048 3300025315 Bacteria 5033
264 Ga0207653_10198302 3300025885 Bacteria 756
265 Ga0207682_10181191 3300025893 Bacteria 962
266 Ga0207682_10344865 3300025893 Unclassified 701
267 Ga0207642_10050271 3300025899 Bacteria 1879
268 Ga0207647_10434008 3300025904 Unclassified 737
269 Ga0207699_10054620 3300025906 Unclassified 2373
270 Ga0207699_10202475 3300025906 Bacteria 1346
271 Ga0207643_10023627 3300025908 Bacteria 3390
272 Ga0207643_10800130 3300025908 Bacteria 611
273 Ga0207705_10022755 3300025909 Unclassified 4469
274 Ga0207654_10129595 3300025911 Bacteria 1595
275 Ga0207654_10150296 3300025911 Bacteria 1494
276 Ga0207707_10044638 3300025912 Unclassified 3864
277 Ga0207707_10088368 3300025912 Bacteria 2707
278 Ga0207695_10216114 3300025913 Bacteria 1826
279 Ga0207693_10165742 3300025915 Bacteria 1739
280 Ga0207693_10319293 3300025915 Bacteria 1216
281 Ga0207663_10179857 3300025916 Bacteria 1509
282 Ga0207660_11018503 3300025917 Unclassified 675
283 Ga0207662_10001441 3300025918 Bacteria 11539
284 Ga0207662_10013360 3300025918 Bacteria 4591
285 Ga0207657_10223614 3300025919 Bacteria 1507
286 Ga0207649_10016218 3300025920 Unclassified 4196
287 Ga0207649_10118415 3300025920 Bacteria 1782
288 Ga0207649_10255996 3300025920 Bacteria 1263
289 Ga0207649_10280602 3300025920 Bacteria 1211
290 Ga0207681_10055109 3300025923 Bacteria 2706
291 Ga0207650_10092999 3300025925 Archaea 2307
292 Ga0207650_10493156 3300025925 Bacteria 1023
293 Ga0207659_10293126 3300025926 Unclassified 1334
294 Ga0207659_10538883 3300025926 Bacteria 991
295 Ga0207687_10168614 3300025927 Bacteria 1686
296 Ga0207687_10196970 3300025927 Bacteria 1572
297 Ga0207700_10000532 3300025928 Bacteria 22353
298 Ga0207700_10379711 3300025928 Unclassified 1235
299 Ga0207664_10004681 3300025929 Bacteria 9285
300 Ga0207644_10612852 3300025931 Bacteria 904
301 Ga0207706_10059713 3300025933 Bacteria 3358
302 Ga0207706_10187993 3300025933 Bacteria 1813
303 Ga0207686_10013848 3300025934 Unclassified 4474
304 Ga0207686_10029351 3300025934 Bacteria 3243
305 Ga0207709_10064913 3300025935 Bacteria 2294
306 Ga0207670_10048007 3300025936 Bacteria 2846
307 Ga0207669_10013462 3300025937 Bacteria 4064
308 Ga0207704_10707633 3300025938 Bacteria 834
309 Ga0207691_10017311 3300025940 Bacteria 6835
310 Ga0207691_10266481 3300025940 Unclassified 1476
311 Ga0207689_10005192 3300025942 Bacteria 11689
312 Ga0207689_10742707 3300025942 Unclassified 828
313 Ga0207679_10006639 3300025945 Bacteria 7321
314 Ga0207679_10028359 3300025945 Bacteria 3883
315 Ga0207679_10218244 3300025945 Bacteria 1603
316 Ga0207679_10275397 3300025945 Bacteria 1441
317 Ga0207679_10879440 3300025945 Bacteria 819
318 Ga0207667_10067457 3300025949 Bacteria 3726
319 Ga0207667_10310055 3300025949 Bacteria 1612
320 Ga0207667_11437037 3300025949 Unclassified 662
321 Ga0207651_10072366 3300025960 Bacteria 2447
322 Ga0207712_10008332 3300025961 Bacteria 6554
323 Ga0207712_10826486 3300025961 Bacteria 816
324 Ga0207712_10884556 3300025961 Unclassified 789
325 Ga0207712_10975286 3300025961 Unclassified 751
326 Ga0207668_10447934 3300025972 Bacteria 1101
327 Ga0207668_10824623 3300025972 Unclassified 822
328 Ga0207640_10089123 3300025981 Bacteria 2132
329 Ga0207640_10182560 3300025981 Bacteria 1574
330 Ga0207640_10500706 3300025981 Bacteria 1012
331 Ga0207703_10161879 3300026035 Bacteria 1961
332 Ga0207703_10334324 3300026035 Bacteria 1390
333 Ga0207639_10001381 3300026041 Bacteria 16383
334 Ga0207639_10013144 3300026041 Bacteria 5784
335 Ga0207639_10020532 3300026041 Unclassified 4729
336 Ga0207639_10535232 3300026041 Bacteria 1074
337 Ga0207639_10637913 3300026041 Unclassified 985
338 Ga0207678_10343174 3300026067 Bacteria 1287
339 Ga0207708_10396498 3300026075 Bacteria 1140
340 Ga0207702_10015412 3300026078 Bacteria 6332
341 Ga0207702_10792644 3300026078 Bacteria 936
342 Ga0207641_10001538 3300026088 Bacteria 22573
343 Ga0207641_10067841 3300026088 Bacteria 3057
344 Ga0207641_10076435 3300026088 Bacteria 2895
345 Ga0207641_10405856 3300026088 Unclassified 1309
346 Ga0207648_10223325 3300026089 Bacteria 1675
347 Ga0207648_10292169 3300026089 Unclassified 1459
348 Ga0207648_10292513 3300026089 Unclassified 1459
349 Ga0207648_10583421 3300026089 Unclassified 1029
350 Ga0207648_10676867 3300026089 Bacteria 955
351 Ga0207676_10056961 3300026095 Bacteria 3076
352 Ga0207676_10107751 3300026095 Bacteria 2325
353 Ga0207676_10159125 3300026095 Bacteria 1954
354 Ga0207676_10383812 3300026095 Bacteria 1308
355 Ga0207674_10000098 3300026116 Bacteria 98523
356 Ga0207674_10001791 3300026116 Bacteria 27406
357 Ga0207674_10008635 3300026116 Bacteria 11738
358 Ga0207674_10135182 3300026116 Bacteria 2427
359 Ga0207674_11280743 3300026116 Bacteria 702
360 Ga0207675_100028658 3300026118 Bacteria 5187
361 Ga0207675_100057090 3300026118 Bacteria 3642
362 Ga0207675_100325608 3300026118 Bacteria 1501
363 Ga0207675_100539326 3300026118 Bacteria 1165
364 Ga0207675_100856890 3300026118 Bacteria 924
365 Ga0207683_10502562 3300026121 Bacteria 1120
366 Ga0207698_10392821 3300026142 Bacteria 1323
367 Ga0207428_10144347 3300027907 Bacteria 1815
368 Ga0207428_10160667 3300027907 Bacteria 1706
369 Ga0268266_10002164 3300028379 Bacteria 21564
370 Ga0268265_10066585 3300028380 Bacteria 2785
371 Ga0268265_10085716 3300028380 Bacteria 2501
372 Ga0268264_10001877 3300028381 Bacteria 19081
373 Ga0268264_10202413 3300028381 Bacteria 1817
374 Ga0268264_10360501 3300028381 Bacteria 1386
375 Ga0265325_10051028 3300031241 Bacteria 2128
376 Ga0307408_100008376 3300031548 Bacteria 6829
377 Ga0307408_100044811 3300031548 Bacteria 3155
378 Ga0307408_100125742 3300031548 Bacteria 1993
379 Ga0307408_100236887 3300031548 Bacteria 1498
380 Ga0307408_100436161 3300031548 Bacteria 1133
381 Ga0265342_10123348 3300031712 Bacteria 1457
382 Ga0307516_10195955 3300031730 Unclassified 1743
383 Ga0307405_10026794 3300031731 Unclassified 3331
384 Ga0307405_10071765 3300031731 Bacteria 2229
385 Ga0307405_10211481 3300031731 Bacteria 1416
386 Ga0307413_10001509 3300031824 Bacteria 8910
387 Ga0307413_10183222 3300031824 Bacteria 1495
388 Ga0307413_10309672 3300031824 Unclassified 1201
389 Ga0307413_10348396 3300031824 Bacteria 1142
390 Ga0307410_10002216 3300031852 Bacteria 9265
391 Ga0307410_10117208 3300031852 Bacteria 1936
392 Ga0307410_11364704 3300031852 Unclassified 621
393 Ga0307406_10004976 3300031901 Bacteria 7241
394 Ga0307406_10014626 3300031901 Bacteria 4518
395 Ga0307406_10049434 3300031901 Bacteria 2661
396 Ga0307406_10166421 3300031901 Bacteria 1591
397 Ga0307406_10175128 3300031901 Archaea 1556
398 Ga0307406_10235019 3300031901 Bacteria 1371
399 Ga0307407_10001376 3300031903 Bacteria 8752
400 Ga0307407_10003549 3300031903 Bacteria 6435
401 Ga0307407_10003868 3300031903 Bacteria 6240
402 Ga0307407_10017168 3300031903 Bacteria 3624
403 Ga0307407_10112634 3300031903 Bacteria 1710
404 Ga0307407_11052845 3300031903 Bacteria 631
405 Ga0307412_10022441 3300031911 Bacteria 3869
406 Ga0307412_10026226 3300031911 Bacteria 3620
407 Ga0307412_10313274 3300031911 Unclassified 1245
408 Ga0307412_10380070 3300031911 Bacteria 1143
409 Ga0307412_10633152 3300031911 Bacteria 910
410 Ga0307409_100022778 3300031995 Bacteria 4323
411 Ga0307409_100056371 3300031995 Bacteria 3038
412 Ga0307409_100064309 3300031995 Bacteria 2881
413 Ga0307409_100130003 3300031995 Bacteria 2150
414 Ga0307409_100164807 3300031995 Bacteria 1943
415 Ga0307409_100561319 3300031995 Unclassified 1122
416 Ga0307409_101061107 3300031995 Unclassified 830
417 Ga0307409_101470326 3300031995 Bacteria 708
418 Ga0307409_101632087 3300031995 Unclassified 673
419 Ga0307416_100016106 3300032002 Bacteria 5183
420 Ga0307416_100041644 3300032002 Bacteria 3579
421 Ga0307416_100193146 3300032002 Unclassified 1922
422 Ga0307416_100551842 3300032002 Bacteria 1226
423 Ga0307416_100628305 3300032002 Unclassified 1157
424 Ga0307416_100823160 3300032002 Bacteria 1025
425 Ga0307416_101084504 3300032002 Bacteria 905
426 Ga0307416_101231470 3300032002 Unclassified 854
427 Ga0307414_10020323 3300032004 Bacteria 4137
428 Ga0307414_10038640 3300032004 Bacteria 3207
429 Ga0307414_11292305 3300032004 Unclassified 677
430 Ga0307411_10002856 3300032005 Bacteria 7801
431 Ga0307411_10004336 3300032005 Bacteria 6774
432 Ga0307411_10019832 3300032005 Bacteria 3894
433 Ga0307411_10063964 3300032005 Bacteria 2461
434 Ga0307411_10073501 3300032005 Bacteria 2326
435 Ga0307411_10156459 3300032005 Archaea 1701
436 Ga0307415_100027967 3300032126 Bacteria 3580
437 Ga0307415_100417459 3300032126 Bacteria 1150
438 Ga0307415_100595178 3300032126 Unclassified 983
439 Ga0373958_0022572 3300034819 Bacteria 1177
440 Ga0373934_0033086 3300035086 Bacteria 2029
441 Ga0373949_0122813 3300035090 Unclassified 731
442 Ga0373954_0013054 3300035118 Bacteria 3698
443 Ga0373954_0459623 3300035118 Unclassified 630
444 Ga0373955_0132645 3300035172 Bacteria 1455
445 Ga0373961_0136675 3300035241 Unclassified 825
446 Ga0373961_0159781 3300035241 Bacteria 773
447 Ga0373935_0028144 3300035692 Bacteria 3474
448 Ga0373935_0140365 3300035692 Bacteria 1632
449 Ga0373927_0254329 3300035695 Unclassified 1155
450 Ga0373927_0276197 3300035695 Unclassified 1105
451 Ga0373947_0054464 3300035725 Bacteria 2414
452 Ga0373937_0019809 3300036401 Bacteria 6025
453 Ga0373937_0029398 3300036401 Bacteria 4977
454 Ga0373925_0060552 3300037068 Bacteria 2843
455 Ga0436363_0684184 3300039450 Unclassified 572
456 Ga0451791_1692457 3300041451 Unclassified 747
457 Ga0451837_0482289 3300041494 Unclassified 1617
458 Ga0439434_0024453 3300042435 Bacteria 1822
459 Ga0495580_0002609 3300046472 Bacteria 15656
460 Ga0495608_0362410 3300046511 Unclassified 891
461 Ga0495621_0049028 3300046539 Bacteria 1506
462 Ga0495667_0108462 3300046559 Unclassified 1794
463 Ga0495656_0416797 3300046615 Unclassified 704
464 Ga0495635_0078517 3300046663 Bacteria 2260
465 Ga0495659_0124391 3300046664 Bacteria 1018
466 Ga0495623_0200699 3300046679 Bacteria 1147
467 Ga0495684_0289249 3300047471 Unclassified 1180
468 Ga0496115_0031218 3300048918 Unclassified 4196
469 Ga0501042_0611075 3300049578 Unclassified 793
470 Ga0501201_007889 3300049651 Bacteria 1021
471 Ga0501209_020607 3300049656 Bacteria 1556
472 Ga0501216_017950 3300049660 Bacteria 1214
473 Ga0501217_042951 3300049661 Bacteria 1156
474 Ga0501223_011728 3300049663 Bacteria 1758
475 Ga0501224_032297 3300049664 Bacteria 785
476 Ga0501227_067680 3300049665 Unclassified 923
477 Ga0501236_009167 3300049670 Bacteria 1272
478 Ga0501239_002617 3300049672 Bacteria 1649
479 Ga0501242_004362 3300049674 Bacteria 1567
480 Ga0501247_001481 3300049677 Bacteria 2276
481 Ga0501249_001562 3300049679 Bacteria 4689
482 Ga0501250_000717 3300049680 Unclassified 2407
483 Ga0501252_007654 3300049682 Unclassified 1227
484 Ga0501253_009578 3300049683 Unclassified 1432
485 Ga0501257_002533 3300049686 Bacteria 3853
486 Ga0501257_199761 3300049686 Bacteria 574
487 Ga0501258_002920 3300049687 Bacteria 1536
488 Ga0501259_023636 3300049688 Bacteria 1113
489 Ga0501261_016260 3300049690 Unclassified 1031
490 Ga0501221_036819 3300049704 Bacteria 1050
491 Ga0501225_0057039 3300049705 Bacteria 1094
492 Ga0501234_012402 3300049707 Bacteria 1335
493 Ga0501263_006980 3300049760 Bacteria 1318
494 Ga0501266_009565 3300049763 Bacteria 1229
495 Ga0501268_000134 3300049765 Bacteria 6459
496 Ga0501268_063654 3300049765 Unclassified 735
497 Ga0501270_002071 3300049767 Bacteria 2012
498 Ga0501272_002228 3300049769 Bacteria 1909
499 Ga0501275_010692 3300049772 Unclassified 984
500 nmdc:mga05p37_1329697_c1 3300050507 Bacteria 730
501 nmdc:mga05p37_31786_c1 3300050507 Bacteria 6450
502 nmdc:mga09592_1056888_c1 3300050508 Bacteria 676
503 nmdc:mga06r32_394234_c1 3300050510 Bacteria 1367
504 nmdc:mga06r32_962546_c1 3300050510 Bacteria 808
505 nmdc:mga08y16_302353_c1 3300050511 Bacteria 1649
506 nmdc:mga08y16_438171_c1 3300050511 Bacteria 1334
507 nmdc:mga08y16_58639_c1 3300050511 Bacteria 4022
508 nmdc:mga08y16_59599_c1 3300050511 Bacteria 3987
509 nmdc:mga0n895_1122542_c1 3300050512 Bacteria 763
510 nmdc:mga0n895_262589_c1 3300050512 Bacteria 1752
511 nmdc:mga0n895_915504_c1 3300050512 Bacteria 862
512 nmdc:mga0a205_244028_c1 3300050515 Bacteria 1677
513 nmdc:mga0a205_26857_c1 3300050515 Bacteria 5494
514 Ga0501084_0176615 3300054114 Bacteria 1803
515 Ga0501084_0405779 3300054114 Bacteria 1152
516 Ga0587066_134784 3300059490 Bacteria 597
517 Ga0501082_0794137 3300060353 Bacteria 828
518 Ga0068860_100032343
519 MBSR1b_contig_3852737
520 Ga0065712_10088161
521 Ga0065715_10024599
522 Ga0065715_10137837
523 Ga0065707_10322053
524 Ga0070658_10003502
525 Ga0070658_10020504
526 Ga0070690_100020866
527 Ga0070670_100008804
528 Ga0070670_100015788
529 Ga0070670_100140474
530 Ga0070670_100909382
531 Ga0070677_10140522
532 Ga0070677_10190439
533 Ga0070677_10424589
534 Ga0068869_101111969
535 Ga0068869_101470660
536 Ga0070666_10015212
537 Ga0070680_101207952
538 Ga0068868_100012363
539 Ga0068868_100167216
540 Ga0068868_100604488
541 Ga0070660_100079707
542 Ga0070660_100128287
543 Ga0070660_100837927
544 Ga0070689_100069465
545 Ga0070687_100011444
546 Ga0070687_100016723
547 Ga0070661_100005085
548 Ga0070661_100042597
549 Ga0070661_100117206
550 Ga0070661_100257501
551 Ga0070668_100184231
552 Ga0070669_100374940
553 Ga0070675_100050544
554 Ga0070675_100140952
555 Ga0070675_100357078
556 Ga0070671_100136695
557 Ga0070674_100164503
558 Ga0070674_100292479
559 Ga0070673_100034014
560 Ga0070673_100233408
561 Ga0070688_100138306
562 Ga0070667_100232352
563 Ga0070703_10132167
564 Ga0070709_10376588
565 Ga0070713_100000906
566 Ga0070710_10711275
567 Ga0070701_10289276
568 Ga0070701_10398831
569 Ga0070711_100200318
570 Ga0070705_100022117
571 Ga0070694_100107216
572 Ga0070694_100340764
573 Ga0070694_100478004
574 Ga0070708_100934895
575 Ga0070663_100011280
576 Ga0070678_100203752
577 Ga0070662_100032017
578 Ga0070662_100165506
579 Ga0070662_100378777
580 Ga0070681_10053788
581 Ga0068867_100145816
582 Ga0068867_100306503
583 Ga0068867_100554912
584 Ga0068867_101066931
585 Ga0070685_10004270
586 Ga0070685_10244984
587 Ga0070707_100911797
588 Ga0070707_100990628
589 Ga0070698_100407767
590 Ga0070698_100471087
591 Ga0070698_100635881
592 Ga0070679_100049596
593 Ga0070679_100386077
594 Ga0070684_100350010
595 Ga0070684_100658245
596 Ga0070697_100041951
597 Ga0070697_100109718
598 Ga0068853_100002139
599 Ga0068853_100003218
600 Ga0068853_100028402
601 Ga0068853_100107058
602 Ga0068853_100293942
603 Ga0068853_101160321
604 Ga0070672_100012397
605 Ga0070672_100261477
606 Ga0070672_101190270
607 Ga0070686_100019250
608 Ga0070695_100060908
609 Ga0070695_100095860
610 Ga0070696_100484797
611 Ga0070696_100906900
612 Ga0070693_100043442
613 Ga0070693_100347990
614 Ga0070665_100000090
615 Ga0070665_100059582
616 Ga0070704_100021035
617 Ga0070704_100175770
618 Ga0070704_100288621
619 Ga0068855_100129386
620 Ga0068855_100357463
621 Ga0068855_100449218
622 Ga0070664_100007104
623 Ga0070664_100018597
624 Ga0070664_100026722
625 Ga0070664_100093779
626 Ga0070664_100314750
627 Ga0070664_100463857
628 Ga0068857_100000991
629 Ga0068857_100007220
630 Ga0068857_100257772
631 Ga0068857_100785717
632 Ga0068854_100027672
633 Ga0068854_100263226
634 Ga0068856_100011595
635 Ga0068856_100113415
636 Ga0070702_100034460
637 Ga0068852_100162641
638 Ga0068852_100311216
639 Ga0068859_100037576
640 Ga0068859_100089289
641 Ga0068859_100435466
642 Ga0068859_100675363
643 Ga0068859_100826426
644 Ga0068859_101616527
645 Ga0068864_100123676
646 Ga0068864_100142162
647 Ga0068864_100171083
648 Ga0068864_100415761
649 Ga0068864_100845520
650 Ga0068866_10022986
651 Ga0068861_100083276
652 Ga0068861_100182682
653 Ga0068861_100665849
654 Ga0068870_10036380
655 Ga0068870_10067283
656 Ga0068870_10130256
657 Ga0068870_10299684
658 Ga0068870_10691018
659 Ga0068863_100033399
660 Ga0068863_100044433
661 Ga0068863_100119258
662 Ga0068863_100319735
663 Ga0068863_100584501
664 Ga0068858_100103767
665 Ga0068858_100193179
666 Ga0068860_100033171
667 Ga0068860_100062662
668 Ga0068860_100078246
669 Ga0068860_101135183
670 Ga0068862_100075083
671 Ga0068862_100149046
672 Ga0068862_100167878
673 Ga0081455_10129462
674 Ga0081540_1203485
675 Ga0070717_10014761
676 Ga0070717_10816180
677 Ga0070716_100194493
678 Ga0070712_100211711
679 Ga0070712_100559588
680 Ga0097621_100034223
681 Ga0097621_100042424
682 Ga0097621_100052912
683 Ga0097621_100578648
684 Ga0068871_100015323
685 Ga0068871_100049180
686 Ga0068871_100381780
687 Ga0068871_100722935
688 Ga0075431_100108106
689 Ga0075431_100476388
690 Ga0075433_10611485
691 Ga0075434_100310660
692 Ga0075434_100453875
693 Ga0075429_100360459
694 Ga0068865_100016027
695 Ga0068865_100124602
696 Ga0097620_100037578
697 Ga0097620_100089290
698 Ga0097620_100435481
699 Ga0097620_100675264
700 Ga0097620_100826465
701 Ga0097620_101616261
702 Ga0105240_10242970
703 Ga0111539_10096593
704 Ga0111539_10205386
705 Ga0111539_10382767
706 Ga0111539_10445585
707 Ga0111539_10487405
708 Ga0111539_10940967
709 Ga0105245_10019789
710 Ga0105245_10735892
711 Ga0105245_10791392
712 Ga0105247_10028466
713 Ga0114129_11261780
714 Ga0105243_10255097
715 Ga0105243_10313912
716 Ga0105241_10094121
717 Ga0105242_10049526
718 Ga0105242_10056133
719 Ga0105242_10090598
720 Ga0105248_10025984
721 Ga0105248_10681640
722 Ga0105237_10862569
723 Ga0105238_10124277
724 Ga0105249_10271083
725 Ga0105249_10645247
726 Ga0105249_11143418
727 Ga0105239_10003819
728 Ga0105239_10233516
729 Ga0105239_11761225
730 Ga0105246_10017355
731 Ga0157373_10009669
732 Ga0157373_10018710
733 Ga0157373_10032917
734 Ga0157371_11110863
735 Ga0157370_10250424
736 Ga0157370_10259676
737 Ga0157369_10011209
738 Ga0157369_10105381
739 Ga0157369_10818228
740 Ga0157374_10007960
741 Ga0157374_10222015
742 Ga0157374_10685603
743 Ga0157378_10041386
744 Ga0157378_10122729
745 Ga0157378_10473904
746 Ga0163162_10329950
747 Ga0163162_10494435
748 Ga0163162_10671214
749 Ga0157372_10025772
750 Ga0157372_10401970
751 Ga0157372_10507110
752 Ga0157372_10603646
753 Ga0157372_10666362
754 Ga0157375_10207631
755 Ga0157375_10518350
756 Ga0157375_10519532
757 Ga0163163_10005833
758 Ga0163163_10009110
759 Ga0163163_10021621
760 Ga0163163_10243743
761 Ga0163163_11536415
762 Ga0163163_11840322
763 Ga0157380_10030762
764 Ga0157380_10034742
765 Ga0157380_10046147
766 Ga0157380_10343005
767 Ga0157380_10731703
768 Ga0182008_10141312
769 Ga0157377_10049945
770 Ga0157379_10022698
771 Ga0157379_11292251
772 Ga0157376_10023099
773 Ga0157376_10128955
774 Ga0157376_10130736
775 Ga0157376_10697193
776 Ga0157376_11031656
777 Ga0157376_12573044
778 Ga0163161_10000630
779 Ga0163161_10062960
780 Ga0207697_10007048
781 Ga0207653_10198302
782 Ga0207682_10181191
783 Ga0207682_10344865
784 Ga0207642_10050271
785 Ga0207647_10434008
786 Ga0207699_10054620
787 Ga0207699_10202475
788 Ga0207643_10023627
789 Ga0207643_10800130
790 Ga0207705_10022755
791 Ga0207654_10129595
792 Ga0207654_10150296
793 Ga0207707_10044638
794 Ga0207707_10088368
795 Ga0207695_10216114
796 Ga0207693_10165742
797 Ga0207693_10319293
798 Ga0207663_10179857
799 Ga0207660_11018503
800 Ga0207662_10001441
801 Ga0207662_10013360
802 Ga0207657_10223614
803 Ga0207649_10016218
804 Ga0207649_10118415
805 Ga0207649_10255996
806 Ga0207649_10280602
807 Ga0207681_10055109
808 Ga0207650_10092999
809 Ga0207650_10493156
810 Ga0207659_10293126
811 Ga0207659_10538883
812 Ga0207687_10168614
813 Ga0207687_10196970
814 Ga0207700_10000532
815 Ga0207700_10379711
816 Ga0207664_10004681
817 Ga0207644_10612852
818 Ga0207706_10059713
819 Ga0207706_10187993
820 Ga0207686_10013848
821 Ga0207686_10029351
822 Ga0207709_10064913
823 Ga0207670_10048007
824 Ga0207669_10013462
825 Ga0207704_10707633
826 Ga0207691_10017311
827 Ga0207691_10266481
828 Ga0207689_10005192
829 Ga0207689_10742707
830 Ga0207679_10006639
831 Ga0207679_10028359
832 Ga0207679_10218244
833 Ga0207679_10275397
834 Ga0207679_10879440
835 Ga0207667_10067457
836 Ga0207667_10310055
837 Ga0207667_11437037
838 Ga0207651_10072366
839 Ga0207712_10008332
840 Ga0207712_10826486
841 Ga0207712_10884556
842 Ga0207712_10975286
843 Ga0207668_10447934
844 Ga0207668_10824623
845 Ga0207640_10089123
846 Ga0207640_10182560
847 Ga0207640_10500706
848 Ga0207703_10161879
849 Ga0207703_10334324
850 Ga0207639_10001381
851 Ga0207639_10013144
852 Ga0207639_10020532
853 Ga0207639_10535232
854 Ga0207639_10637913
855 Ga0207678_10343174
856 Ga0207708_10396498
857 Ga0207702_10015412
858 Ga0207702_10792644
859 Ga0207641_10001538
860 Ga0207641_10067841
861 Ga0207641_10076435
862 Ga0207641_10405856
863 Ga0207648_10223325
864 Ga0207648_10292169
865 Ga0207648_10292513
866 Ga0207648_10583421
867 Ga0207648_10676867
868 Ga0207676_10056961
869 Ga0207676_10107751
870 Ga0207676_10159125
871 Ga0207676_10383812
872 Ga0207674_10000098
873 Ga0207674_10001791
874 Ga0207674_10008635
875 Ga0207674_10135182
876 Ga0207674_11280743
877 Ga0207675_100028658
878 Ga0207675_100057090
879 Ga0207675_100325608
880 Ga0207675_100539326
881 Ga0207675_100856890
882 Ga0207683_10502562
883 Ga0207698_10392821
884 Ga0207428_10144347
885 Ga0207428_10160667
886 Ga0268266_10002164
887 Ga0268265_10066585
888 Ga0268265_10085716
889 Ga0268264_10001877
890 Ga0268264_10202413
891 Ga0268264_10360501
892 Ga0265325_10051028
893 Ga0307408_100008376
894 Ga0307408_100044811
895 Ga0307408_100125742
896 Ga0307408_100236887
897 Ga0307408_100436161
898 Ga0265342_10123348
899 Ga0307516_10195955
900 Ga0307405_10026794
901 Ga0307405_10071765
902 Ga0307405_10211481
903 Ga0307413_10001509
904 Ga0307413_10183222
905 Ga0307413_10309672
906 Ga0307413_10348396
907 Ga0307410_10002216
908 Ga0307410_10117208
909 Ga0307410_11364704
910 Ga0307406_10004976
911 Ga0307406_10014626
912 Ga0307406_10049434
913 Ga0307406_10166421
914 Ga0307406_10175128
915 Ga0307406_10235019
916 Ga0307407_10001376
917 Ga0307407_10003549
918 Ga0307407_10003868
919 Ga0307407_10017168
920 Ga0307407_10112634
921 Ga0307407_11052845
922 Ga0307412_10022441
923 Ga0307412_10026226
924 Ga0307412_10313274
925 Ga0307412_10380070
926 Ga0307412_10633152
927 Ga0307409_100022778
928 Ga0307409_100056371
929 Ga0307409_100064309
930 Ga0307409_100130003
931 Ga0307409_100164807
932 Ga0307409_100561319
933 Ga0307409_101061107
934 Ga0307409_101470326
935 Ga0307409_101632087
936 Ga0307416_100016106
937 Ga0307416_100041644
938 Ga0307416_100193146
939 Ga0307416_100551842
940 Ga0307416_100628305
941 Ga0307416_100823160
942 Ga0307416_101084504
943 Ga0307416_101231470
944 Ga0307414_10020323
945 Ga0307414_10038640
946 Ga0307414_11292305
947 Ga0307411_10002856
948 Ga0307411_10004336
949 Ga0307411_10019832
950 Ga0307411_10063964
951 Ga0307411_10073501
952 Ga0307411_10156459
953 Ga0307415_100027967
954 Ga0307415_100417459
955 Ga0307415_100595178
956 Ga0373958_0022572
957 Ga0373934_0033086
958 Ga0373949_0122813
959 Ga0373954_0013054
960 Ga0373954_0459623
961 Ga0373955_0132645
962 Ga0373961_0136675
963 Ga0373961_0159781
964 Ga0373935_0028144
965 Ga0373935_0140365
966 Ga0373927_0254329
967 Ga0373927_0276197
968 Ga0373947_0054464
969 Ga0373937_0019809
970 Ga0373937_0029398
971 Ga0373925_0060552
972 Ga0436363_0684184
973 Ga0451791_1692457
974 Ga0451837_0482289
975 Ga0439434_0024453
976 Ga0495580_0002609
977 Ga0495608_0362410
978 Ga0495621_0049028
979 Ga0495667_0108462
980 Ga0495656_0416797
981 Ga0495635_0078517
982 Ga0495659_0124391
983 Ga0495623_0200699
984 Ga0495684_0289249
985 Ga0496115_0031218
986 Ga0501042_0611075
987 Ga0501201_007889
988 Ga0501209_020607
989 Ga0501216_017950
990 Ga0501217_042951
991 Ga0501223_011728
992 Ga0501224_032297
993 Ga0501227_067680
994 Ga0501236_009167
995 Ga0501239_002617
996 Ga0501242_004362
997 Ga0501247_001481
998 Ga0501249_001562
999 Ga0501250_000717
1000 Ga0501252_007654
1001 Ga0501253_009578
1002 Ga0501257_002533
1003 Ga0501257_199761
1004 Ga0501258_002920
1005 Ga0501259_023636
1006 Ga0501261_016260
1007 Ga0501221_036819
1008 Ga0501225_0057039
1009 Ga0501234_012402
1010 Ga0501263_006980
1011 Ga0501266_009565
1012 Ga0501268_000134
1013 Ga0501268_063654
1014 Ga0501270_002071
1015 Ga0501272_002228
1016 Ga0501275_010692
1017 nmdc:mga05p37_1329697_c1
1018 nmdc:mga05p37_31786_c1
1019 nmdc:mga09592_1056888_c1
1020 nmdc:mga06r32_394234_c1
1021 nmdc:mga06r32_962546_c1
1022 nmdc:mga08y16_302353_c1
1023 nmdc:mga08y16_438171_c1
1024 nmdc:mga08y16_58639_c1
1025 nmdc:mga08y16_59599_c1
1026 nmdc:mga0n895_1122542_c1
1027 nmdc:mga0n895_262589_c1
1028 nmdc:mga0n895_915504_c1
1029 nmdc:mga0a205_244028_c1
1030 nmdc:mga0a205_26857_c1
1031 Ga0501084_0176615
1032 Ga0501084_0405779
1033 Ga0587066_134784
1034 Ga0501082_0794137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

26

199

0.84

PF12867

DinB_2

DinB superfamily

44

176

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8168 2 159
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8157 1 159
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8008 1 159
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.7993 4 158
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7969 2 159
ID Description Score Start End Superfamily
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8298 6 151 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8126 6 151 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8009 2 159 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7858 2 159 1.20.120.450
2f22B00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7401 11 157 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A0S7Z742-F1-model_v4 Damage-inducible protein DinB 0.9697 1 167
AF-A0A1M3QUC7-F1-model_v4 Damage-inducible protein DinB 0.9693 1 166
AF-A0A5B8UEX6-F1-model_v4 DUF1572 domain-containing protein 0.9692 4 166
AF-A0A512B773-F1-model_v4 Damage-inducible protein DinB 0.9692 4 166
AF-A0A2V8XV01-F1-model_v4 Damage-inducible protein DinB 0.9642 1 167

Map