F458104

General Info

Members Datasets Scaffolds Average Seq Length
517 235 1034 221

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100450693|Ga0070695_1004506932
Length 237
Sequence MRSPLSFAISSMVTVMPLREITGPAGRLEALLDEPADGRNVGADGLLETGHPSGVRAAVVFAHPHTEYGGTMHTKVVYQAAKALSRIGCAVLRFNFRGAGASAGRFENGPGEMQDFRAALDFMRERYPDVKLWAGGMSFGAYVALTVGAEDPRVTTLIGIATPLSHYDFESVARSTKAKFFIHGERDELFPLKPMREFYARCAEPKELIVIDAADHLFDGKVSEVADAVDDLLGDWA

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
173 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
174 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
175 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.68
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 9.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100450693 3300005545 Bacteria 986
2 JGI24751J29686_10002099 3300002459 Bacteria 4043
3 Ga0065712_10002227 3300005290 Bacteria 5904
4 Ga0065712_10098464 3300005290 Bacteria 2106
5 Ga0065707_10030744 3300005295 Bacteria 1296
6 Ga0070690_100193776 3300005330 Bacteria 1410
7 Ga0070690_100336948 3300005330 Bacteria 1091
8 Ga0070670_100039184 3300005331 Bacteria 4075
9 Ga0070670_100077609 3300005331 Bacteria 2853
10 Ga0068869_100161712 3300005334 Bacteria 1743
11 Ga0070666_10036583 3300005335 Bacteria 3260
12 Ga0070666_10081747 3300005335 Bacteria 2209
13 Ga0070666_10118372 3300005335 Bacteria 1835
14 Ga0068868_100016841 3300005338 Bacteria 5437
15 Ga0068868_100312060 3300005338 Bacteria 1338
16 Ga0068868_100322178 3300005338 Bacteria 1317
17 Ga0070689_100032883 3300005340 Bacteria 3949
18 Ga0070689_100123783 3300005340 Bacteria 2068
19 Ga0070691_10019803 3300005341 Bacteria 3106
20 Ga0070661_100102435 3300005344 Bacteria 2131
21 Ga0070692_10022238 3300005345 Bacteria 3096
22 Ga0070668_100094882 3300005347 Bacteria 2356
23 Ga0070668_100217923 3300005347 Bacteria 1573
24 Ga0070668_100722911 3300005347 Unclassified 880
25 Ga0070669_100018183 3300005353 Bacteria 5021
26 Ga0070669_100034609 3300005353 Bacteria 3657
27 Ga0070669_100037580 3300005353 Bacteria 3512
28 Ga0070669_100064138 3300005353 Bacteria 2705
29 Ga0070675_100000202 3300005354 Bacteria 37748
30 Ga0070675_100066739 3300005354 Bacteria 2976
31 Ga0070675_100407997 3300005354 Unclassified 1213
32 Ga0070675_100460157 3300005354 Bacteria 1142
33 Ga0070671_100008756 3300005355 Bacteria 8119
34 Ga0070671_100525894 3300005355 Bacteria 1019
35 Ga0070674_100002496 3300005356 Bacteria 10188
36 Ga0070674_100185122 3300005356 Bacteria 1598
37 Ga0070674_100463140 3300005356 Bacteria 1049
38 Ga0070673_100003244 3300005364 Bacteria 10094
39 Ga0070673_100025833 3300005364 Bacteria 4329
40 Ga0070673_100091546 3300005364 Bacteria 2486
41 Ga0070673_100139082 3300005364 Bacteria 2047
42 Ga0070673_100401442 3300005364 Unclassified 1226
43 Ga0070673_100549582 3300005364 Bacteria 1049
44 Ga0070673_100601935 3300005364 Unclassified 1003
45 Ga0070673_100745079 3300005364 Unclassified 902
46 Ga0070688_100013941 3300005365 Bacteria 4547
47 Ga0070659_100264262 3300005366 Bacteria 1428
48 Ga0070667_100002413 3300005367 Bacteria 16341
49 Ga0070701_10007932 3300005438 Bacteria 4566
50 Ga0070701_10170788 3300005438 Bacteria 1266
51 Ga0070711_100203925 3300005439 Bacteria 1528
52 Ga0070711_100205639 3300005439 Bacteria 1522
53 Ga0070705_100006748 3300005440 Bacteria 5646
54 Ga0070705_100210002 3300005440 Bacteria 1341
55 Ga0070700_100003012 3300005441 Bacteria 8640
56 Ga0070700_100115908 3300005441 Unclassified 1788
57 Ga0070708_100493937 3300005445 Bacteria 1154
58 Ga0070708_100517827 3300005445 Bacteria 1125
59 Ga0070678_100057239 3300005456 Bacteria 2855
60 Ga0070678_100109173 3300005456 Bacteria 2161
61 Ga0070678_100983110 3300005456 Unclassified 775
62 Ga0070662_100595342 3300005457 Bacteria 930
63 Ga0070681_10014708 3300005458 Bacteria 7782
64 Ga0070681_10125884 3300005458 Bacteria 2495
65 Ga0070681_10202665 3300005458 Bacteria 1902
66 Ga0068867_100012021 3300005459 Bacteria 6113
67 Ga0068867_100080541 3300005459 Bacteria 2452
68 Ga0068867_100148617 3300005459 Bacteria 1838
69 Ga0068867_100395708 3300005459 Bacteria 1164
70 Ga0070706_100300050 3300005467 Unclassified 1499
71 Ga0070706_100347468 3300005467 Bacteria 1383
72 Ga0070707_100038446 3300005468 Bacteria 4571
73 Ga0070707_100059528 3300005468 Bacteria 3664
74 Ga0070707_100140520 3300005468 Bacteria 2350
75 Ga0070698_100016037 3300005471 Bacteria 7912
76 Ga0070698_100042249 3300005471 Bacteria 4676
77 Ga0070698_100227909 3300005471 Bacteria 1796
78 Ga0070698_100375696 3300005471 Bacteria 1354
79 Ga0070698_100760058 3300005471 Bacteria 912
80 Ga0070699_100016799 3300005518 Bacteria 6283
81 Ga0070699_100084611 3300005518 Bacteria 2768
82 Ga0070699_100121194 3300005518 Bacteria 2300
83 Ga0070699_100189051 3300005518 Bacteria 1829
84 Ga0070699_100797783 3300005518 Bacteria 864
85 Ga0070679_100008862 3300005530 Bacteria 9496
86 Ga0070684_100049463 3300005535 Bacteria 3649
87 Ga0068853_100150590 3300005539 Bacteria 2094
88 Ga0070672_100260425 3300005543 Bacteria 1463
89 Ga0070672_100427163 3300005543 Bacteria 1139
90 Ga0070686_100006797 3300005544 Bacteria 6368
91 Ga0070686_100094688 3300005544 Bacteria 2005
92 Ga0070686_100138216 3300005544 Bacteria 1693
93 Ga0070695_100004292 3300005545 Bacteria 8344
94 Ga0070695_100007901 3300005545 Bacteria 6297
95 Ga0070695_100262590 3300005545 Bacteria 1262
96 Ga0070696_100087670 3300005546 Bacteria 2211
97 Ga0070696_100199365 3300005546 Bacteria 1493
98 Ga0070696_100458899 3300005546 Bacteria 1007
99 Ga0070693_100192251 3300005547 Bacteria 1321
100 Ga0070693_100215079 3300005547 Bacteria 1256
101 Ga0070665_100001535 3300005548 Bacteria 26671
102 Ga0070665_100075372 3300005548 Bacteria 3380
103 Ga0070704_100005288 3300005549 Bacteria 7522
104 Ga0070704_100191969 3300005549 Bacteria 1642
105 Ga0070704_100227110 3300005549 Unclassified 1521
106 Ga0068855_100240920 3300005563 Bacteria 2021
107 Ga0068857_100216856 3300005577 Unclassified 1747
108 Ga0068854_100011716 3300005578 Bacteria 5720
109 Ga0070702_100008655 3300005615 Bacteria 4941
110 Ga0068859_100069962 3300005617 Bacteria 3545
111 Ga0068859_100078549 3300005617 Bacteria 3341
112 Ga0068859_100257239 3300005617 Bacteria 1837
113 Ga0068859_100415914 3300005617 Bacteria 1441
114 Ga0068859_100529610 3300005617 Unclassified 1273
115 Ga0068864_100004686 3300005618 Bacteria 11220
116 Ga0068864_100073526 3300005618 Bacteria 2981
117 Ga0068864_100159011 3300005618 Bacteria 2053
118 Ga0068864_100618770 3300005618 Bacteria 1052
119 Ga0068866_10034902 3300005718 Bacteria 2453
120 Ga0068861_100230855 3300005719 Bacteria 1569
121 Ga0068861_100322498 3300005719 Bacteria 1346
122 Ga0068861_100715079 3300005719 Bacteria 932
123 Ga0068851_10391694 3300005834 Bacteria 816
124 Ga0068870_10227881 3300005840 Bacteria 1144
125 Ga0068863_100021750 3300005841 Bacteria 6119
126 Ga0068858_100001189 3300005842 Bacteria 26942
127 Ga0068858_100098942 3300005842 Bacteria 2719
128 Ga0068858_100182283 3300005842 Bacteria 1983
129 Ga0068858_100519124 3300005842 Bacteria 1152
130 Ga0068860_100032227 3300005843 Bacteria 5037
131 Ga0068860_100089493 3300005843 Bacteria 2931
132 Ga0068860_100157377 3300005843 Bacteria 2190
133 Ga0068860_100493526 3300005843 Bacteria 1222
134 Ga0068862_100044380 3300005844 Bacteria 3791
135 Ga0068862_100046669 3300005844 Bacteria 3695
136 Ga0068862_100154367 3300005844 Bacteria 2045
137 Ga0068862_100187583 3300005844 Unclassified 1859
138 Ga0068862_100222150 3300005844 Bacteria 1711
139 Ga0081455_10111552 3300005937 Bacteria 2172
140 Ga0081455_10317133 3300005937 Unclassified 1112
141 Ga0070715_10171841 3300006163 Bacteria 1080
142 Ga0097621_100031940 3300006237 Bacteria 4181
143 Ga0068871_100002496 3300006358 Bacteria 12554
144 Ga0068871_100631754 3300006358 Bacteria 976
145 Ga0075428_100298374 3300006844 Bacteria 1732
146 Ga0075428_100463345 3300006844 Bacteria 1357
147 Ga0075428_100941371 3300006844 Unclassified 915
148 Ga0075433_10014399 3300006852 Bacteria 6460
149 Ga0075433_10022099 3300006852 Bacteria 5340
150 Ga0075433_10037951 3300006852 Bacteria 4158
151 Ga0075433_10253405 3300006852 Bacteria 1561
152 Ga0075433_10402403 3300006852 Unclassified 1208
153 Ga0075433_10864710 3300006852 Unclassified 789
154 Ga0075434_100013164 3300006871 Bacteria 7859
155 Ga0075434_100015822 3300006871 Bacteria 7243
156 Ga0075434_100047639 3300006871 Bacteria 4254
157 Ga0075434_100130538 3300006871 Bacteria 2531
158 Ga0075434_100246729 3300006871 Bacteria 1805
159 Ga0075434_100273403 3300006871 Bacteria 1709
160 Ga0075434_100295850 3300006871 Bacteria 1639
161 Ga0075434_100313485 3300006871 Unclassified 1589
162 Ga0075434_100447511 3300006871 Bacteria 1313
163 Ga0075429_100358649 3300006880 Bacteria 1277
164 Ga0068865_100273486 3300006881 Bacteria 1342
165 Ga0068865_100317365 3300006881 Bacteria 1252
166 Ga0068865_100418501 3300006881 Unclassified 1101
167 Ga0075436_100005822 3300006914 Bacteria 8461
168 Ga0075436_100012190 3300006914 Bacteria 5890
169 Ga0075436_100026590 3300006914 Bacteria 3984
170 Ga0075436_100044870 3300006914 Bacteria 3049
171 Ga0075436_100066084 3300006914 Bacteria 2499
172 Ga0075436_100193218 3300006914 Bacteria 1440
173 Ga0075436_100296756 3300006914 Bacteria 1157
174 Ga0097620_100069963 3300006931 Bacteria 3545
175 Ga0097620_100078547 3300006931 Bacteria 3341
176 Ga0097620_100257254 3300006931 Bacteria 1837
177 Ga0097620_100415916 3300006931 Bacteria 1441
178 Ga0097620_100529585 3300006931 Unclassified 1273
179 Ga0075435_100000052 3300007076 Bacteria 58955
180 Ga0075435_100003130 3300007076 Bacteria 11178
181 Ga0075435_100009595 3300007076 Bacteria 7022
182 Ga0075435_100021380 3300007076 Bacteria 4976
183 Ga0075435_100034216 3300007076 Bacteria 4024
184 Ga0075435_100060385 3300007076 Bacteria 3074
185 Ga0075435_100088232 3300007076 Bacteria 2556
186 Ga0075435_100150847 3300007076 Bacteria 1954
187 Ga0075435_100238724 3300007076 Bacteria 1545
188 Ga0105240_10265722 3300009093 Bacteria 1977
189 Ga0105240_10391628 3300009093 Bacteria 1567
190 Ga0111539_10000696 3300009094 Bacteria 43539
191 Ga0111539_10003636 3300009094 Bacteria 20314
192 Ga0111539_10144567 3300009094 Bacteria 2784
193 Ga0111539_10145070 3300009094 Bacteria 2779
194 Ga0105245_10084662 3300009098 Bacteria 2906
195 Ga0105245_10091845 3300009098 Bacteria 2794
196 Ga0105247_10035047 3300009101 Bacteria 3058
197 Ga0114129_10000307 3300009147 Bacteria 57086
198 Ga0114129_10010731 3300009147 Bacteria 13060
199 Ga0114129_10055657 3300009147 Bacteria 5543
200 Ga0114129_10106093 3300009147 Bacteria 3881
201 Ga0114129_10135936 3300009147 Bacteria 3373
202 Ga0114129_10146785 3300009147 Bacteria 3230
203 Ga0114129_10148913 3300009147 Bacteria 3204
204 Ga0114129_10160867 3300009147 Bacteria 3067
205 Ga0114129_10212964 3300009147 Bacteria 2611
206 Ga0114129_11082313 3300009147 Unclassified 1005
207 Ga0105243_10041278 3300009148 Bacteria 3608
208 Ga0105243_10049617 3300009148 Bacteria 3312
209 Ga0105242_10009410 3300009176 Bacteria 7494
210 Ga0105248_10000664 3300009177 Bacteria 39095
211 Ga0105248_10009832 3300009177 Bacteria 10537
212 Ga0105248_10014897 3300009177 Bacteria 8562
213 Ga0105248_10017599 3300009177 Bacteria 7882
214 Ga0105248_10052998 3300009177 Bacteria 4552
215 Ga0105248_10057149 3300009177 Bacteria 4379
216 Ga0105248_10057727 3300009177 Bacteria 4357
217 Ga0105248_10063176 3300009177 Bacteria 4156
218 Ga0105248_10132985 3300009177 Bacteria 2807
219 Ga0105248_10198369 3300009177 Bacteria 2261
220 Ga0105248_10295287 3300009177 Bacteria 1825
221 Ga0105248_10500215 3300009177 Bacteria 1370
222 Ga0105249_10101884 3300009553 Bacteria 2701
223 Ga0105249_10293587 3300009553 Bacteria 1628
224 Ga0105249_10648702 3300009553 Unclassified 1113
225 Ga0105249_11241781 3300009553 Bacteria 816
226 Ga0105239_10425960 3300010375 Bacteria 1504
227 Ga0105246_10493659 3300011119 Unclassified 1038
228 Ga0157374_10012030 3300013296 Bacteria 7514
229 Ga0157374_10153776 3300013296 Bacteria 2238
230 Ga0157378_10482398 3300013297 Unclassified 1235
231 Ga0163162_10110055 3300013306 Bacteria 2852
232 Ga0163162_10851121 3300013306 Unclassified 1027
233 Ga0157375_10095268 3300013308 Bacteria 3047
234 Ga0157375_10292220 3300013308 Bacteria 1793
235 Ga0157375_11343500 3300013308 Bacteria 841
236 Ga0163163_10024898 3300014325 Bacteria 5699
237 Ga0163163_10032267 3300014325 Bacteria 5058
238 Ga0163163_10275512 3300014325 Bacteria 1734
239 Ga0163163_10557377 3300014325 Bacteria 1209
240 Ga0163163_10696692 3300014325 Bacteria 1079
241 Ga0157380_10134199 3300014326 Bacteria 2116
242 Ga0157380_10183645 3300014326 Bacteria 1840
243 Ga0157377_10050628 3300014745 Bacteria 2340
244 Ga0157377_10354471 3300014745 Bacteria 985
245 Ga0157377_10416172 3300014745 Bacteria 919
246 Ga0157379_10011426 3300014968 Bacteria 7750
247 Ga0157379_10016218 3300014968 Bacteria 6555
248 Ga0157379_10038695 3300014968 Bacteria 4255
249 Ga0157379_10039390 3300014968 Bacteria 4216
250 Ga0157376_10018769 3300014969 Bacteria 5313
251 Ga0157376_10027955 3300014969 Bacteria 4477
252 Ga0157376_10041269 3300014969 Bacteria 3777
253 Ga0157376_10138783 3300014969 Bacteria 2178
254 Ga0157376_10440788 3300014969 Bacteria 1268
255 Ga0163161_10762166 3300017792 Bacteria 810
256 Ga0213876_10090210 3300021384 Bacteria 1623
257 Ga0207682_10028497 3300025893 Bacteria 2229
258 Ga0207642_10065378 3300025899 Bacteria 1708
259 Ga0207710_10040504 3300025900 Bacteria 2065
260 Ga0207680_10007138 3300025903 Bacteria 5432
261 Ga0207680_10255745 3300025903 Bacteria 1211
262 Ga0207699_10072534 3300025906 Bacteria 2109
263 Ga0207645_10003038 3300025907 Bacteria 12916
264 Ga0207684_10563769 3300025910 Unclassified 974
265 Ga0207707_10325988 3300025912 Bacteria 1325
266 Ga0207695_10228618 3300025913 Bacteria 1765
267 Ga0207671_10495264 3300025914 Bacteria 974
268 Ga0207660_10552967 3300025917 Bacteria 936
269 Ga0207646_10073219 3300025922 Bacteria 3060
270 Ga0207646_10087173 3300025922 Bacteria 2793
271 Ga0207646_10113015 3300025922 Bacteria 2438
272 Ga0207646_10116073 3300025922 Bacteria 2404
273 Ga0207646_10120008 3300025922 Bacteria 2362
274 Ga0207681_10017031 3300025923 Bacteria 4559
275 Ga0207681_10061138 3300025923 Bacteria 2588
276 Ga0207681_10454361 3300025923 Bacteria 1043
277 Ga0207650_10037948 3300025925 Bacteria 3514
278 Ga0207650_10063095 3300025925 Bacteria 2770
279 Ga0207650_10224611 3300025925 Bacteria 1513
280 Ga0207659_10000076 3300025926 Bacteria 62373
281 Ga0207659_10062162 3300025926 Bacteria 2694
282 Ga0207687_10046812 3300025927 Bacteria 2996
283 Ga0207687_10555001 3300025927 Bacteria 964
284 Ga0207644_10002029 3300025931 Bacteria 13091
285 Ga0207706_10032794 3300025933 Bacteria 4623
286 Ga0207706_10050244 3300025933 Bacteria 3685
287 Ga0207686_10057659 3300025934 Bacteria 2446
288 Ga0207686_10165713 3300025934 Bacteria 1553
289 Ga0207709_10017122 3300025935 Bacteria 4040
290 Ga0207670_10051802 3300025936 Bacteria 2758
291 Ga0207669_10012668 3300025937 Bacteria 4155
292 Ga0207669_10228894 3300025937 Bacteria 1370
293 Ga0207704_10042299 3300025938 Bacteria 2681
294 Ga0207704_10171268 3300025938 Bacteria 1558
295 Ga0207665_10090750 3300025939 Bacteria 2118
296 Ga0207691_10011138 3300025940 Bacteria 8631
297 Ga0207691_10268404 3300025940 Bacteria 1470
298 Ga0207711_10010114 3300025941 Bacteria 7837
299 Ga0207711_10010963 3300025941 Bacteria 7531
300 Ga0207711_10034774 3300025941 Bacteria 4267
301 Ga0207711_10038067 3300025941 Bacteria 4089
302 Ga0207711_10068517 3300025941 Bacteria 3073
303 Ga0207711_10100736 3300025941 Bacteria 2555
304 Ga0207711_10181905 3300025941 Bacteria 1912
305 Ga0207689_10205103 3300025942 Bacteria 1628
306 Ga0207689_10333786 3300025942 Unclassified 1259
307 Ga0207661_10498189 3300025944 Bacteria 1113
308 Ga0207661_10626744 3300025944 Unclassified 988
309 Ga0207679_10170471 3300025945 Bacteria 1791
310 Ga0207651_10007811 3300025960 Bacteria 5724
311 Ga0207651_10011179 3300025960 Bacteria 5011
312 Ga0207651_10075023 3300025960 Bacteria 2411
313 Ga0207651_10147860 3300025960 Bacteria 1825
314 Ga0207651_10160181 3300025960 Bacteria 1763
315 Ga0207651_10599883 3300025960 Unclassified 962
316 Ga0207651_10603401 3300025960 Unclassified 960
317 Ga0207712_10258854 3300025961 Bacteria 1410
318 Ga0207712_10574789 3300025961 Unclassified 972
319 Ga0207640_10009205 3300025981 Bacteria 5521
320 Ga0207640_10016650 3300025981 Bacteria 4282
321 Ga0207658_10033149 3300025986 Bacteria 3682
322 Ga0207658_10190021 3300025986 Bacteria 1706
323 Ga0207677_10215154 3300026023 Bacteria 1537
324 Ga0207677_10283403 3300026023 Bacteria 1361
325 Ga0207703_10028156 3300026035 Bacteria 4426
326 Ga0207703_10148029 3300026035 Unclassified 2044
327 Ga0207639_10503725 3300026041 Bacteria 1107
328 Ga0207708_10003617 3300026075 Bacteria 11396
329 Ga0207708_10072892 3300026075 Bacteria 2631
330 Ga0207708_10132853 3300026075 Bacteria 1947
331 Ga0207708_10228374 3300026075 Bacteria 1494
332 Ga0207641_10001113 3300026088 Bacteria 27018
333 Ga0207648_10001579 3300026089 Bacteria 24975
334 Ga0207648_10103577 3300026089 Bacteria 2495
335 Ga0207648_10255235 3300026089 Bacteria 1564
336 Ga0207676_10012228 3300026095 Bacteria 6144
337 Ga0207676_10018114 3300026095 Bacteria 5114
338 Ga0207676_10079345 3300026095 Bacteria 2662
339 Ga0207676_10095016 3300026095 Bacteria 2457
340 Ga0207676_10696441 3300026095 Bacteria 984
341 Ga0207674_10480944 3300026116 Unclassified 1200
342 Ga0207675_100029674 3300026118 Bacteria 5093
343 Ga0207675_100090035 3300026118 Bacteria 2884
344 Ga0207675_100182567 3300026118 Bacteria 2010
345 Ga0207675_100191068 3300026118 Bacteria 1964
346 Ga0207675_100519175 3300026118 Bacteria 1187
347 Ga0207683_10142845 3300026121 Bacteria 2157
348 Ga0207683_10703546 3300026121 Unclassified 937
349 Ga0207428_10004078 3300027907 Bacteria 13998
350 Ga0207428_10024390 3300027907 Bacteria 5078
351 Ga0207428_10028879 3300027907 Bacteria 4603
352 Ga0207428_10116112 3300027907 Bacteria 2056
353 Ga0268266_10003647 3300028379 Bacteria 15228
354 Ga0268266_10038714 3300028379 Bacteria 4059
355 Ga0268265_10052138 3300028380 Bacteria 3092
356 Ga0268265_10130682 3300028380 Bacteria 2086
357 Ga0268265_10220548 3300028380 Bacteria 1659
358 Ga0268265_10702332 3300028380 Unclassified 977
359 Ga0268264_10005498 3300028381 Bacteria 10742
360 Ga0268264_10085569 3300028381 Bacteria 2706
361 Ga0307408_100088843 3300031548 Bacteria 2328
362 Ga0307409_100058103 3300031995 Bacteria 3002
363 Ga0307411_10788995 3300032005 Unclassified 835
364 Ga0307415_100157362 3300032126 Bacteria 1756
365 Ga0373930_0003801 3300034816 Bacteria 2421
366 Ga0373948_0000361 3300034817 Bacteria 5593
367 Ga0373958_0000207 3300034819 Bacteria 6931
368 Ga0373958_0010495 3300034819 Bacteria 1547
369 Ga0373938_0002098 3300034957 Bacteria 3204
370 Ga0373928_0012097 3300035084 Bacteria 1717
371 Ga0373929_0000192 3300035085 Bacteria 10914
372 Ga0373929_0065393 3300035085 Bacteria 860
373 Ga0373940_0003852 3300035088 Bacteria 3111
374 Ga0373944_0017717 3300035089 Bacteria 2026
375 Ga0373949_0000941 3300035090 Bacteria 9061
376 Ga0373949_0032137 3300035090 Bacteria 1255
377 Ga0373951_0000205 3300035091 Bacteria 21388
378 Ga0373952_0001043 3300035092 Bacteria 5051
379 Ga0373923_0192245 3300035111 Bacteria 941
380 Ga0373932_0005029 3300035112 Bacteria 3113
381 Ga0373936_0031800 3300035113 Unclassified 2085
382 Ga0373939_0001980 3300035114 Bacteria 4888
383 Ga0373939_0027077 3300035114 Unclassified 1621
384 Ga0373939_0099215 3300035114 Bacteria 997
385 Ga0373941_0000409 3300035115 Bacteria 8514
386 Ga0373941_0012698 3300035115 Bacteria 2208
387 Ga0373960_0001406 3300035121 Bacteria 5334
388 Ga0373943_0001725 3300035170 Bacteria 9911
389 Ga0373955_0094155 3300035172 Bacteria 1711
390 Ga0373955_0211671 3300035172 Bacteria 1156
391 Ga0373955_0264350 3300035172 Bacteria 1033
392 Ga0373942_0001707 3300035207 Bacteria 5575
393 Ga0373962_0002332 3300035242 Bacteria 4530
394 Ga0373931_0027967 3300035691 Bacteria 2882
395 Ga0373931_0093634 3300035691 Bacteria 1678
396 Ga0373935_0211334 3300035692 Bacteria 1345
397 Ga0373947_0008942 3300035725 Bacteria 5757
398 Ga0373947_0045065 3300035725 Bacteria 2639
399 Ga0373937_0025464 3300036401 Bacteria 5341
400 Ga0373937_0081721 3300036401 Bacteria 2989
401 Ga0373937_0095070 3300036401 Bacteria 2763
402 Ga0373937_0466890 3300036401 Unclassified 1199
403 Ga0373925_0000666 3300037068 Bacteria 32236
404 Ga0395905_0415281 3300037471 Bacteria 1241
405 Ga0436365_0374667 3300039437 Bacteria 1197
406 Ga0450921_007672 3300042123 Bacteria 862
407 Ga0450923_008697 3300042125 Bacteria 1755
408 Ga0450896_000058 3300042133 Bacteria 7054
409 Ga0450898_004430 3300042134 Bacteria 2077
410 Ga0450908_006245 3300042184 Bacteria 2270
411 Ga0451577_0109754 3300042876 Bacteria 2467
412 Ga0466963_0013994 3300044694 Bacteria 4941
413 Ga0453684_0101809 3300044712 Bacteria 3513
414 Ga0451576_0097469 3300045051 Bacteria 3058
415 Ga0451576_0189302 3300045051 Bacteria 2149
416 Ga0466967_0769383 3300045976 Bacteria 955
417 Ga0495592_0300329 3300046454 Bacteria 1044
418 Ga0495629_0045683 3300046459 Bacteria 3073
419 Ga0495629_0245231 3300046459 Bacteria 1233
420 Ga0495651_0114481 3300046462 Bacteria 1990
421 Ga0495651_0314160 3300046462 Bacteria 1047
422 Ga0495582_0063235 3300046473 Bacteria 2045
423 Ga0495639_0037284 3300046475 Bacteria 2179
424 Ga0495664_0374549 3300046477 Bacteria 856
425 Ga0495628_0235184 3300046516 Bacteria 1372
426 Ga0495630_0647529 3300046517 Unclassified 809
427 Ga0495642_0121529 3300046528 Bacteria 1121
428 Ga0495586_0152695 3300046535 Unclassified 1300
429 Ga0495645_0002684 3300046543 Bacteria 12075
430 Ga0495667_0182088 3300046559 Bacteria 1348
431 Ga0495634_0068729 3300046642 Bacteria 2339
432 Ga0495635_0031708 3300046663 Bacteria 3668
433 Ga0495659_0218687 3300046664 Unclassified 786
434 Ga0495646_0267703 3300046680 Bacteria 911
435 Ga0495647_0060888 3300046681 Bacteria 1489
436 Ga0495658_0016514 3300046683 Bacteria 3800
437 Ga0495658_0016706 3300046683 Bacteria 3779
438 Ga0495658_0272555 3300046683 Unclassified 1067
439 Ga0495669_0254015 3300046684 Bacteria 844
440 Ga0495613_0392688 3300046689 Bacteria 947
441 Ga0495600_0185783 3300046809 Bacteria 1338
442 Ga0495581_0177329 3300047315 Bacteria 1246
443 Ga0495604_0094434 3300047317 Bacteria 2211
444 Ga0495674_0068815 3300047319 Bacteria 3063
445 Ga0495684_0344939 3300047471 Bacteria 1059
446 Ga0496102_0053972 3300048905 Bacteria 3664
447 Ga0496103_0413811 3300048906 Bacteria 866
448 Ga0496105_0135166 3300048908 Bacteria 2032
449 Ga0496105_0243665 3300048908 Unclassified 1458
450 Ga0496106_0076648 3300048909 Bacteria 2563
451 Ga0496106_0114047 3300048909 Bacteria 2107
452 Ga0496106_0601635 3300048909 Bacteria 880
453 Ga0496107_0108261 3300048910 Bacteria 2041
454 Ga0496108_0040415 3300048911 Bacteria 3888
455 Ga0496109_0116217 3300048912 Unclassified 2490
456 Ga0496109_0397862 3300048912 Bacteria 1301
457 Ga0496110_0452573 3300048913 Bacteria 1170
458 Ga0496111_0057135 3300048914 Bacteria 2825
459 Ga0496112_0163908 3300048915 Bacteria 2189
460 Ga0496112_0794673 3300048915 Unclassified 871
461 Ga0496113_0006167 3300048916 Bacteria 7567
462 Ga0496114_0328460 3300048917 Bacteria 1352
463 Ga0496115_0046082 3300048918 Bacteria 3483
464 Ga0496115_0763877 3300048918 Archaea 755
465 Ga0501067_0186242 3300049583 Unclassified 1156
466 nmdc:mga05p37_108069_c1 3300050507 Bacteria 3422
467 nmdc:mga05p37_127660_c1 3300050507 Bacteria 3122
468 nmdc:mga05p37_174316_c1 3300050507 Bacteria 2621
469 nmdc:mga05p37_21578_c1 3300050507 Bacteria 7803
470 nmdc:mga05p37_251652_c1 3300050507 Bacteria 2119
471 nmdc:mga05p37_25311_c1 3300050507 Bacteria 7218
472 nmdc:mga05p37_51401_c1 3300050507 Bacteria 5068
473 nmdc:mga05p37_9401_c1 3300050507 Bacteria 11570
474 nmdc:mga09592_117234_c1 3300050508 Bacteria 2285
475 nmdc:mga06r32_165272_c1 3300050510 Bacteria 2196
476 nmdc:mga08y16_180840_c1 3300050511 Bacteria 2190
477 nmdc:mga08y16_22046_c1 3300050511 Bacteria 6726
478 nmdc:mga08y16_48167_c1 3300050511 Bacteria 4460
479 nmdc:mga08y16_5423_c1 3300050511 Bacteria 13335
480 nmdc:mga0n895_103463_c1 3300050512 Bacteria 2859
481 nmdc:mga0n895_139737_c1 3300050512 Bacteria 2450
482 nmdc:mga0n895_185435_c1 3300050512 Bacteria 2111
483 nmdc:mga0n895_199963_c1 3300050512 Bacteria 2029
484 nmdc:mga0n895_228887_c1 3300050512 Bacteria 1887
485 nmdc:mga0n895_312354_c1 3300050512 Bacteria 1593
486 nmdc:mga0n895_42716_c1 3300050512 Unclassified 4412
487 nmdc:mga0n895_71945_c1 3300050512 Bacteria 3430
488 nmdc:mga0n895_844_c1 3300050512 Bacteria 21996
489 nmdc:mga0n895_942204_c1 3300050512 Bacteria 847
490 nmdc:mga0rr50_139485_c1 3300050513 Bacteria 1949
491 nmdc:mga0rr50_16343_c1 3300050513 Bacteria 4926
492 nmdc:mga0rr50_176475_c1 3300050513 Bacteria 1744
493 nmdc:mga0rr50_2107_c1 3300050513 Bacteria 11118
494 nmdc:mga0rr50_219380_c1 3300050513 Bacteria 1570
495 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
496 nmdc:mga0rr50_534122_c1 3300050513 Bacteria 998
497 nmdc:mga0rr50_709651_c1 3300050513 Unclassified 858
498 nmdc:mga0rr50_925_c1 3300050513 Bacteria 15860
499 nmdc:mga08x19_120450_c1 3300050514 Bacteria 1759
500 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
501 nmdc:mga08x19_42785_c1 3300050514 Bacteria 2889
502 nmdc:mga08x19_4977_c1 3300050514 Bacteria 7856
503 nmdc:mga08x19_5806_c1 3300050514 Bacteria 7298
504 nmdc:mga08x19_646_c1 3300050514 Bacteria 22496
505 nmdc:mga0a205_16866_c1 3300050515 Bacteria 6836
506 nmdc:mga0a205_27501_c1 3300050515 Bacteria 5431
507 nmdc:mga0a205_47648_c1 3300050515 Bacteria 4136
508 nmdc:mga0a205_6436_c1 3300050515 Bacteria 10615
509 Ga0495601_0087567 3300053077 Bacteria 2002
510 Ga0495601_0216890 3300053077 Unclassified 1250
511 Ga0495595_0026163 3300053084 Bacteria 2591
512 Ga0495619_0138750 3300053085 Bacteria 1673
513 Ga0495619_0447357 3300053085 Bacteria 891
514 Ga0590071_000104 3300059421 Bacteria 24141
515 Ga0590074_002050 3300059423 Bacteria 3301
516 Ga0590075_000295 3300059424 Bacteria 14079
517 Ga0590077_000960 3300059426 Bacteria 7354
518 Ga0070695_100450693
519 JGI24751J29686_10002099
520 Ga0065712_10002227
521 Ga0065712_10098464
522 Ga0065707_10030744
523 Ga0070690_100193776
524 Ga0070690_100336948
525 Ga0070670_100039184
526 Ga0070670_100077609
527 Ga0068869_100161712
528 Ga0070666_10036583
529 Ga0070666_10081747
530 Ga0070666_10118372
531 Ga0068868_100016841
532 Ga0068868_100312060
533 Ga0068868_100322178
534 Ga0070689_100032883
535 Ga0070689_100123783
536 Ga0070691_10019803
537 Ga0070661_100102435
538 Ga0070692_10022238
539 Ga0070668_100094882
540 Ga0070668_100217923
541 Ga0070668_100722911
542 Ga0070669_100018183
543 Ga0070669_100034609
544 Ga0070669_100037580
545 Ga0070669_100064138
546 Ga0070675_100000202
547 Ga0070675_100066739
548 Ga0070675_100407997
549 Ga0070675_100460157
550 Ga0070671_100008756
551 Ga0070671_100525894
552 Ga0070674_100002496
553 Ga0070674_100185122
554 Ga0070674_100463140
555 Ga0070673_100003244
556 Ga0070673_100025833
557 Ga0070673_100091546
558 Ga0070673_100139082
559 Ga0070673_100401442
560 Ga0070673_100549582
561 Ga0070673_100601935
562 Ga0070673_100745079
563 Ga0070688_100013941
564 Ga0070659_100264262
565 Ga0070667_100002413
566 Ga0070701_10007932
567 Ga0070701_10170788
568 Ga0070711_100203925
569 Ga0070711_100205639
570 Ga0070705_100006748
571 Ga0070705_100210002
572 Ga0070700_100003012
573 Ga0070700_100115908
574 Ga0070708_100493937
575 Ga0070708_100517827
576 Ga0070678_100057239
577 Ga0070678_100109173
578 Ga0070678_100983110
579 Ga0070662_100595342
580 Ga0070681_10014708
581 Ga0070681_10125884
582 Ga0070681_10202665
583 Ga0068867_100012021
584 Ga0068867_100080541
585 Ga0068867_100148617
586 Ga0068867_100395708
587 Ga0070706_100300050
588 Ga0070706_100347468
589 Ga0070707_100038446
590 Ga0070707_100059528
591 Ga0070707_100140520
592 Ga0070698_100016037
593 Ga0070698_100042249
594 Ga0070698_100227909
595 Ga0070698_100375696
596 Ga0070698_100760058
597 Ga0070699_100016799
598 Ga0070699_100084611
599 Ga0070699_100121194
600 Ga0070699_100189051
601 Ga0070699_100797783
602 Ga0070679_100008862
603 Ga0070684_100049463
604 Ga0068853_100150590
605 Ga0070672_100260425
606 Ga0070672_100427163
607 Ga0070686_100006797
608 Ga0070686_100094688
609 Ga0070686_100138216
610 Ga0070695_100004292
611 Ga0070695_100007901
612 Ga0070695_100262590
613 Ga0070696_100087670
614 Ga0070696_100199365
615 Ga0070696_100458899
616 Ga0070693_100192251
617 Ga0070693_100215079
618 Ga0070665_100001535
619 Ga0070665_100075372
620 Ga0070704_100005288
621 Ga0070704_100191969
622 Ga0070704_100227110
623 Ga0068855_100240920
624 Ga0068857_100216856
625 Ga0068854_100011716
626 Ga0070702_100008655
627 Ga0068859_100069962
628 Ga0068859_100078549
629 Ga0068859_100257239
630 Ga0068859_100415914
631 Ga0068859_100529610
632 Ga0068864_100004686
633 Ga0068864_100073526
634 Ga0068864_100159011
635 Ga0068864_100618770
636 Ga0068866_10034902
637 Ga0068861_100230855
638 Ga0068861_100322498
639 Ga0068861_100715079
640 Ga0068851_10391694
641 Ga0068870_10227881
642 Ga0068863_100021750
643 Ga0068858_100001189
644 Ga0068858_100098942
645 Ga0068858_100182283
646 Ga0068858_100519124
647 Ga0068860_100032227
648 Ga0068860_100089493
649 Ga0068860_100157377
650 Ga0068860_100493526
651 Ga0068862_100044380
652 Ga0068862_100046669
653 Ga0068862_100154367
654 Ga0068862_100187583
655 Ga0068862_100222150
656 Ga0081455_10111552
657 Ga0081455_10317133
658 Ga0070715_10171841
659 Ga0097621_100031940
660 Ga0068871_100002496
661 Ga0068871_100631754
662 Ga0075428_100298374
663 Ga0075428_100463345
664 Ga0075428_100941371
665 Ga0075433_10014399
666 Ga0075433_10022099
667 Ga0075433_10037951
668 Ga0075433_10253405
669 Ga0075433_10402403
670 Ga0075433_10864710
671 Ga0075434_100013164
672 Ga0075434_100015822
673 Ga0075434_100047639
674 Ga0075434_100130538
675 Ga0075434_100246729
676 Ga0075434_100273403
677 Ga0075434_100295850
678 Ga0075434_100313485
679 Ga0075434_100447511
680 Ga0075429_100358649
681 Ga0068865_100273486
682 Ga0068865_100317365
683 Ga0068865_100418501
684 Ga0075436_100005822
685 Ga0075436_100012190
686 Ga0075436_100026590
687 Ga0075436_100044870
688 Ga0075436_100066084
689 Ga0075436_100193218
690 Ga0075436_100296756
691 Ga0097620_100069963
692 Ga0097620_100078547
693 Ga0097620_100257254
694 Ga0097620_100415916
695 Ga0097620_100529585
696 Ga0075435_100000052
697 Ga0075435_100003130
698 Ga0075435_100009595
699 Ga0075435_100021380
700 Ga0075435_100034216
701 Ga0075435_100060385
702 Ga0075435_100088232
703 Ga0075435_100150847
704 Ga0075435_100238724
705 Ga0105240_10265722
706 Ga0105240_10391628
707 Ga0111539_10000696
708 Ga0111539_10003636
709 Ga0111539_10144567
710 Ga0111539_10145070
711 Ga0105245_10084662
712 Ga0105245_10091845
713 Ga0105247_10035047
714 Ga0114129_10000307
715 Ga0114129_10010731
716 Ga0114129_10055657
717 Ga0114129_10106093
718 Ga0114129_10135936
719 Ga0114129_10146785
720 Ga0114129_10148913
721 Ga0114129_10160867
722 Ga0114129_10212964
723 Ga0114129_11082313
724 Ga0105243_10041278
725 Ga0105243_10049617
726 Ga0105242_10009410
727 Ga0105248_10000664
728 Ga0105248_10009832
729 Ga0105248_10014897
730 Ga0105248_10017599
731 Ga0105248_10052998
732 Ga0105248_10057149
733 Ga0105248_10057727
734 Ga0105248_10063176
735 Ga0105248_10132985
736 Ga0105248_10198369
737 Ga0105248_10295287
738 Ga0105248_10500215
739 Ga0105249_10101884
740 Ga0105249_10293587
741 Ga0105249_10648702
742 Ga0105249_11241781
743 Ga0105239_10425960
744 Ga0105246_10493659
745 Ga0157374_10012030
746 Ga0157374_10153776
747 Ga0157378_10482398
748 Ga0163162_10110055
749 Ga0163162_10851121
750 Ga0157375_10095268
751 Ga0157375_10292220
752 Ga0157375_11343500
753 Ga0163163_10024898
754 Ga0163163_10032267
755 Ga0163163_10275512
756 Ga0163163_10557377
757 Ga0163163_10696692
758 Ga0157380_10134199
759 Ga0157380_10183645
760 Ga0157377_10050628
761 Ga0157377_10354471
762 Ga0157377_10416172
763 Ga0157379_10011426
764 Ga0157379_10016218
765 Ga0157379_10038695
766 Ga0157379_10039390
767 Ga0157376_10018769
768 Ga0157376_10027955
769 Ga0157376_10041269
770 Ga0157376_10138783
771 Ga0157376_10440788
772 Ga0163161_10762166
773 Ga0213876_10090210
774 Ga0207682_10028497
775 Ga0207642_10065378
776 Ga0207710_10040504
777 Ga0207680_10007138
778 Ga0207680_10255745
779 Ga0207699_10072534
780 Ga0207645_10003038
781 Ga0207684_10563769
782 Ga0207707_10325988
783 Ga0207695_10228618
784 Ga0207671_10495264
785 Ga0207660_10552967
786 Ga0207646_10073219
787 Ga0207646_10087173
788 Ga0207646_10113015
789 Ga0207646_10116073
790 Ga0207646_10120008
791 Ga0207681_10017031
792 Ga0207681_10061138
793 Ga0207681_10454361
794 Ga0207650_10037948
795 Ga0207650_10063095
796 Ga0207650_10224611
797 Ga0207659_10000076
798 Ga0207659_10062162
799 Ga0207687_10046812
800 Ga0207687_10555001
801 Ga0207644_10002029
802 Ga0207706_10032794
803 Ga0207706_10050244
804 Ga0207686_10057659
805 Ga0207686_10165713
806 Ga0207709_10017122
807 Ga0207670_10051802
808 Ga0207669_10012668
809 Ga0207669_10228894
810 Ga0207704_10042299
811 Ga0207704_10171268
812 Ga0207665_10090750
813 Ga0207691_10011138
814 Ga0207691_10268404
815 Ga0207711_10010114
816 Ga0207711_10010963
817 Ga0207711_10034774
818 Ga0207711_10038067
819 Ga0207711_10068517
820 Ga0207711_10100736
821 Ga0207711_10181905
822 Ga0207689_10205103
823 Ga0207689_10333786
824 Ga0207661_10498189
825 Ga0207661_10626744
826 Ga0207679_10170471
827 Ga0207651_10007811
828 Ga0207651_10011179
829 Ga0207651_10075023
830 Ga0207651_10147860
831 Ga0207651_10160181
832 Ga0207651_10599883
833 Ga0207651_10603401
834 Ga0207712_10258854
835 Ga0207712_10574789
836 Ga0207640_10009205
837 Ga0207640_10016650
838 Ga0207658_10033149
839 Ga0207658_10190021
840 Ga0207677_10215154
841 Ga0207677_10283403
842 Ga0207703_10028156
843 Ga0207703_10148029
844 Ga0207639_10503725
845 Ga0207708_10003617
846 Ga0207708_10072892
847 Ga0207708_10132853
848 Ga0207708_10228374
849 Ga0207641_10001113
850 Ga0207648_10001579
851 Ga0207648_10103577
852 Ga0207648_10255235
853 Ga0207676_10012228
854 Ga0207676_10018114
855 Ga0207676_10079345
856 Ga0207676_10095016
857 Ga0207676_10696441
858 Ga0207674_10480944
859 Ga0207675_100029674
860 Ga0207675_100090035
861 Ga0207675_100182567
862 Ga0207675_100191068
863 Ga0207675_100519175
864 Ga0207683_10142845
865 Ga0207683_10703546
866 Ga0207428_10004078
867 Ga0207428_10024390
868 Ga0207428_10028879
869 Ga0207428_10116112
870 Ga0268266_10003647
871 Ga0268266_10038714
872 Ga0268265_10052138
873 Ga0268265_10130682
874 Ga0268265_10220548
875 Ga0268265_10702332
876 Ga0268264_10005498
877 Ga0268264_10085569
878 Ga0307408_100088843
879 Ga0307409_100058103
880 Ga0307411_10788995
881 Ga0307415_100157362
882 Ga0373930_0003801
883 Ga0373948_0000361
884 Ga0373958_0000207
885 Ga0373958_0010495
886 Ga0373938_0002098
887 Ga0373928_0012097
888 Ga0373929_0000192
889 Ga0373929_0065393
890 Ga0373940_0003852
891 Ga0373944_0017717
892 Ga0373949_0000941
893 Ga0373949_0032137
894 Ga0373951_0000205
895 Ga0373952_0001043
896 Ga0373923_0192245
897 Ga0373932_0005029
898 Ga0373936_0031800
899 Ga0373939_0001980
900 Ga0373939_0027077
901 Ga0373939_0099215
902 Ga0373941_0000409
903 Ga0373941_0012698
904 Ga0373960_0001406
905 Ga0373943_0001725
906 Ga0373955_0094155
907 Ga0373955_0211671
908 Ga0373955_0264350
909 Ga0373942_0001707
910 Ga0373962_0002332
911 Ga0373931_0027967
912 Ga0373931_0093634
913 Ga0373935_0211334
914 Ga0373947_0008942
915 Ga0373947_0045065
916 Ga0373937_0025464
917 Ga0373937_0081721
918 Ga0373937_0095070
919 Ga0373937_0466890
920 Ga0373925_0000666
921 Ga0395905_0415281
922 Ga0436365_0374667
923 Ga0450921_007672
924 Ga0450923_008697
925 Ga0450896_000058
926 Ga0450898_004430
927 Ga0450908_006245
928 Ga0451577_0109754
929 Ga0466963_0013994
930 Ga0453684_0101809
931 Ga0451576_0097469
932 Ga0451576_0189302
933 Ga0466967_0769383
934 Ga0495592_0300329
935 Ga0495629_0045683
936 Ga0495629_0245231
937 Ga0495651_0114481
938 Ga0495651_0314160
939 Ga0495582_0063235
940 Ga0495639_0037284
941 Ga0495664_0374549
942 Ga0495628_0235184
943 Ga0495630_0647529
944 Ga0495642_0121529
945 Ga0495586_0152695
946 Ga0495645_0002684
947 Ga0495667_0182088
948 Ga0495634_0068729
949 Ga0495635_0031708
950 Ga0495659_0218687
951 Ga0495646_0267703
952 Ga0495647_0060888
953 Ga0495658_0016514
954 Ga0495658_0016706
955 Ga0495658_0272555
956 Ga0495669_0254015
957 Ga0495613_0392688
958 Ga0495600_0185783
959 Ga0495581_0177329
960 Ga0495604_0094434
961 Ga0495674_0068815
962 Ga0495684_0344939
963 Ga0496102_0053972
964 Ga0496103_0413811
965 Ga0496105_0135166
966 Ga0496105_0243665
967 Ga0496106_0076648
968 Ga0496106_0114047
969 Ga0496106_0601635
970 Ga0496107_0108261
971 Ga0496108_0040415
972 Ga0496109_0116217
973 Ga0496109_0397862
974 Ga0496110_0452573
975 Ga0496111_0057135
976 Ga0496112_0163908
977 Ga0496112_0794673
978 Ga0496113_0006167
979 Ga0496114_0328460
980 Ga0496115_0046082
981 Ga0496115_0763877
982 Ga0501067_0186242
983 nmdc:mga05p37_108069_c1
984 nmdc:mga05p37_127660_c1
985 nmdc:mga05p37_174316_c1
986 nmdc:mga05p37_21578_c1
987 nmdc:mga05p37_251652_c1
988 nmdc:mga05p37_25311_c1
989 nmdc:mga05p37_51401_c1
990 nmdc:mga05p37_9401_c1
991 nmdc:mga09592_117234_c1
992 nmdc:mga06r32_165272_c1
993 nmdc:mga08y16_180840_c1
994 nmdc:mga08y16_22046_c1
995 nmdc:mga08y16_48167_c1
996 nmdc:mga08y16_5423_c1
997 nmdc:mga0n895_103463_c1
998 nmdc:mga0n895_139737_c1
999 nmdc:mga0n895_185435_c1
1000 nmdc:mga0n895_199963_c1
1001 nmdc:mga0n895_228887_c1
1002 nmdc:mga0n895_312354_c1
1003 nmdc:mga0n895_42716_c1
1004 nmdc:mga0n895_71945_c1
1005 nmdc:mga0n895_844_c1
1006 nmdc:mga0n895_942204_c1
1007 nmdc:mga0rr50_139485_c1
1008 nmdc:mga0rr50_16343_c1
1009 nmdc:mga0rr50_176475_c1
1010 nmdc:mga0rr50_2107_c1
1011 nmdc:mga0rr50_219380_c1
1012 nmdc:mga0rr50_23_c1
1013 nmdc:mga0rr50_534122_c1
1014 nmdc:mga0rr50_709651_c1
1015 nmdc:mga0rr50_925_c1
1016 nmdc:mga08x19_120450_c1
1017 nmdc:mga08x19_165_c1
1018 nmdc:mga08x19_42785_c1
1019 nmdc:mga08x19_4977_c1
1020 nmdc:mga08x19_5806_c1
1021 nmdc:mga08x19_646_c1
1022 nmdc:mga0a205_16866_c1
1023 nmdc:mga0a205_27501_c1
1024 nmdc:mga0a205_47648_c1
1025 nmdc:mga0a205_6436_c1
1026 Ga0495601_0087567
1027 Ga0495601_0216890
1028 Ga0495595_0026163
1029 Ga0495619_0138750
1030 Ga0495619_0447357
1031 Ga0590071_000104
1032 Ga0590074_002050
1033 Ga0590075_000295
1034 Ga0590077_000960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

67

181

0.89

PF12146

Hydrolase_4

Serine aminopeptidase, S33

53

177

0.88

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

55

233

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.935 1 215
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.9318 1 217
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.8996 1 217
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8974 1 217
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.8569 1 215
ID Description Score Start End Superfamily
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.935 1 215 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9318 1 217 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8974 1 217 3.40.50.1820
2i3dA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8887 1 216 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8568 1 215 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2D6R1L1-F1-model_v4 Alpha/beta hydrolase 0.9911 47 222 GO:0016787
AF-A0A2V8GI51-F1-model_v4 Alpha/beta hydrolase 0.9898 121 220
AF-A0A3D1IJW1-F1-model_v4 Alpha/beta hydrolase 0.989 4 169 GO:0016787
AF-A0A2V8GXT7-F1-model_v4 Alpha/beta hydrolase 0.9889 4 154 GO:0016787
AF-A0A2D8R3M7-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9867 2 222

Map