F458101

General Info

Members Datasets Scaffolds Average Seq Length
517 270 1034 157

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100119806|Ga0070705_1001198063
Length 172
Sequence MLQAPRRTHLKGDADGVTAVAWQINAVSSPDQIADVLLIEEASFTNPWSREMYLAELENSGISFCYVAKGADGAVVGFCSFWRVLDELHINNLAVLPAFRRQGVASALLAHVLKEGSALGARRATLEVRRSNDAARLLYERFGFSVAAVRRGYYTKPVEDALVLWREHLDET

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.9
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 23.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100119806 3300005440 Bacteria 1697
2 rootL2_10290995 3300003322 Bacteria 1707
3 Ga0065704_10386294 3300005289 Unclassified 767
4 Ga0065712_10000800 3300005290 Bacteria 9630
5 Ga0065712_10106877 3300005290 Bacteria 1908
6 Ga0065715_10281047 3300005293 Bacteria 1086
7 Ga0065707_10006309 3300005295 Bacteria 4862
8 Ga0065707_10290630 3300005295 Unclassified 1021
9 Ga0070676_10153333 3300005328 Bacteria 1477
10 Ga0070683_100222209 3300005329 Unclassified 1795
11 Ga0070690_100018592 3300005330 Bacteria 4201
12 Ga0070690_100100205 3300005330 Unclassified 1920
13 Ga0070690_100120662 3300005330 Bacteria 1759
14 Ga0070670_100530909 3300005331 Bacteria 1048
15 Ga0070677_10255539 3300005333 Bacteria 872
16 Ga0070677_10531444 3300005333 Bacteria 642
17 Ga0070666_10064425 3300005335 Bacteria 2486
18 Ga0070666_10759620 3300005335 Unclassified 713
19 Ga0070682_100224201 3300005337 Bacteria 1340
20 Ga0068868_100196367 3300005338 Unclassified 1680
21 Ga0070660_100005272 3300005339 Bacteria 8938
22 Ga0070660_100247144 3300005339 Bacteria 1454
23 Ga0070660_100268043 3300005339 Unclassified 1395
24 Ga0070691_10135731 3300005341 Unclassified 1250
25 Ga0070669_100086310 3300005353 Unclassified 2345
26 Ga0070675_100005517 3300005354 Bacteria 9679
27 Ga0070675_100010814 3300005354 Bacteria 7136
28 Ga0070675_100037908 3300005354 Bacteria 3928
29 Ga0070675_100168809 3300005354 Unclassified 1886
30 Ga0070675_100328875 3300005354 Unclassified 1351
31 Ga0070674_100035642 3300005356 Bacteria 3334
32 Ga0070674_100053478 3300005356 Bacteria 2788
33 Ga0070674_100118472 3300005356 Bacteria 1957
34 Ga0070674_101594893 3300005356 Unclassified 588
35 Ga0070673_100032863 3300005364 Bacteria 3911
36 Ga0070673_100182661 3300005364 Bacteria 1796
37 Ga0070688_100354048 3300005365 Bacteria 1076
38 Ga0070659_100192251 3300005366 Bacteria 1678
39 Ga0070667_100152474 3300005367 Unclassified 2031
40 Ga0070667_100663902 3300005367 Unclassified 963
41 Ga0070709_10080058 3300005434 Bacteria 2129
42 Ga0070714_100014694 3300005435 Bacteria 6291
43 Ga0070713_100066495 3300005436 Bacteria 3032
44 Ga0070705_100977490 3300005440 Bacteria 686
45 Ga0070700_100129115 3300005441 Bacteria 1703
46 Ga0070694_100097533 3300005444 Bacteria 2074
47 Ga0070678_100058653 3300005456 Bacteria 2826
48 Ga0070678_100177807 3300005456 Unclassified 1739
49 Ga0070662_100207111 3300005457 Unclassified 1559
50 Ga0070681_10050784 3300005458 Bacteria 4137
51 Ga0070681_11361824 3300005458 Bacteria 633
52 Ga0068867_100141721 3300005459 Bacteria 1880
53 Ga0070706_100168828 3300005467 Bacteria 2043
54 Ga0070706_100283829 3300005467 Bacteria 1545
55 Ga0070706_100320355 3300005467 Bacteria 1446
56 Ga0070706_100350547 3300005467 Bacteria 1376
57 Ga0070707_100066012 3300005468 Bacteria 3477
58 Ga0070698_100081168 3300005471 Bacteria 3238
59 Ga0070698_100214583 3300005471 Bacteria 1859
60 Ga0070698_100818198 3300005471 Unclassified 876
61 Ga0070699_100088968 3300005518 Bacteria 2698
62 Ga0070699_100830087 3300005518 Unclassified 846
63 Ga0070679_100049155 3300005530 Bacteria 4201
64 Ga0070679_100252182 3300005530 Unclassified 1721
65 Ga0070697_100030773 3300005536 Bacteria 4313
66 Ga0070697_100079071 3300005536 Bacteria 2707
67 Ga0070697_100463451 3300005536 Bacteria 1105
68 Ga0070672_100029428 3300005543 Bacteria 4119
69 Ga0070672_100699075 3300005543 Bacteria 888
70 Ga0070686_100080477 3300005544 Bacteria 2155
71 Ga0070686_100625106 3300005544 Bacteria 851
72 Ga0070695_100220600 3300005545 Unclassified 1366
73 Ga0070696_100219588 3300005546 Unclassified 1426
74 Ga0070696_100229463 3300005546 Unclassified 1396
75 Ga0070665_100145877 3300005548 Bacteria 2370
76 Ga0070665_101816216 3300005548 Bacteria 616
77 Ga0070704_100033210 3300005549 Bacteria 3487
78 Ga0070704_100157588 3300005549 Bacteria 1792
79 Ga0070704_100521629 3300005549 Bacteria 1034
80 Ga0070704_100690687 3300005549 Bacteria 904
81 Ga0068855_100079054 3300005563 Bacteria 3815
82 Ga0068855_100371390 3300005563 Bacteria 1572
83 Ga0068855_100564230 3300005563 Unclassified 1231
84 Ga0068855_101950221 3300005563 Unclassified 594
85 Ga0070664_100047891 3300005564 Bacteria 3613
86 Ga0070664_100179553 3300005564 Unclassified 1881
87 Ga0070664_100331057 3300005564 Bacteria 1382
88 Ga0070664_100352390 3300005564 Bacteria 1339
89 Ga0068854_100103901 3300005578 Bacteria 2133
90 Ga0068854_100769953 3300005578 Unclassified 836
91 Ga0068854_101037823 3300005578 Unclassified 728
92 Ga0068856_100069326 3300005614 Bacteria 3487
93 Ga0068856_100538437 3300005614 Unclassified 1189
94 Ga0070702_100715618 3300005615 Bacteria 765
95 Ga0068852_100281341 3300005616 Bacteria 1604
96 Ga0068859_100110287 3300005617 Bacteria 2813
97 Ga0068859_100553644 3300005617 Bacteria 1244
98 Ga0068859_101451753 3300005617 Bacteria 757
99 Ga0068864_100072431 3300005618 Bacteria 3003
100 Ga0068861_100082407 3300005719 Bacteria 2521
101 Ga0068861_100263682 3300005719 Unclassified 1476
102 Ga0068861_100308571 3300005719 Bacteria 1373
103 Ga0068861_101024666 3300005719 Bacteria 789
104 Ga0068870_10148808 3300005840 Bacteria 1377
105 Ga0068870_10845512 3300005840 Unclassified 643
106 Ga0068863_100006039 3300005841 Bacteria 11882
107 Ga0068863_100329970 3300005841 Bacteria 1483
108 Ga0068858_100006490 3300005842 Bacteria 11386
109 Ga0068858_101316418 3300005842 Bacteria 711
110 Ga0068860_100083951 3300005843 Bacteria 3030
111 Ga0068860_100386144 3300005843 Bacteria 1383
112 Ga0068860_100865962 3300005843 Bacteria 919
113 Ga0068860_101141128 3300005843 Unclassified 799
114 Ga0068862_100010418 3300005844 Bacteria 7676
115 Ga0068862_100316545 3300005844 Unclassified 1439
116 Ga0068862_100801060 3300005844 Bacteria 920
117 Ga0068862_100822966 3300005844 Unclassified 908
118 Ga0081455_10087723 3300005937 Bacteria 2531
119 Ga0081539_10005654 3300005985 Bacteria 12559
120 Ga0075432_10084003 3300006058 Bacteria 1158
121 Ga0070715_10013288 3300006163 Bacteria 3020
122 Ga0097621_100004606 3300006237 Bacteria 9626
123 Ga0068871_100014248 3300006358 Bacteria 5922
124 Ga0068871_100527037 3300006358 Bacteria 1067
125 Ga0075428_100053664 3300006844 Bacteria 4416
126 Ga0075428_100981591 3300006844 Bacteria 894
127 Ga0075430_100048673 3300006846 Bacteria 3579
128 Ga0075430_100066564 3300006846 Unclassified 3025
129 Ga0075430_100340891 3300006846 Bacteria 1238
130 Ga0075430_100504498 3300006846 Unclassified 998
131 Ga0075431_100059686 3300006847 Bacteria 3936
132 Ga0075431_100102536 3300006847 Bacteria 2953
133 Ga0075433_10007559 3300006852 Bacteria 8619
134 Ga0075433_10085921 3300006852 Bacteria 2778
135 Ga0075433_10304286 3300006852 Unclassified 1412
136 Ga0075433_10309416 3300006852 Unclassified 1398
137 Ga0075433_10384894 3300006852 Unclassified 1238
138 Ga0075433_10777684 3300006852 Bacteria 837
139 Ga0075434_100004203 3300006871 Bacteria 12904
140 Ga0075434_100073661 3300006871 Bacteria 3408
141 Ga0075434_100091953 3300006871 Bacteria 3035
142 Ga0075434_100112665 3300006871 Bacteria 2732
143 Ga0075434_100115679 3300006871 Bacteria 2695
144 Ga0075434_100238183 3300006871 Bacteria 1840
145 Ga0075434_100254593 3300006871 Bacteria 1775
146 Ga0075434_100381464 3300006871 Unclassified 1430
147 Ga0075434_100506857 3300006871 Unclassified 1227
148 Ga0075434_101255474 3300006871 Unclassified 752
149 Ga0075434_101514687 3300006871 Bacteria 680
150 Ga0075434_101813661 3300006871 Bacteria 617
151 Ga0075429_100071594 3300006880 Bacteria 3019
152 Ga0075436_100003683 3300006914 Bacteria 10504
153 Ga0075436_100318297 3300006914 Bacteria 1117
154 Ga0075436_100332230 3300006914 Bacteria 1093
155 Ga0075436_101028453 3300006914 Unclassified 619
156 Ga0097620_100110288 3300006931 Bacteria 2813
157 Ga0097620_100553642 3300006931 Bacteria 1244
158 Ga0097620_101451190 3300006931 Bacteria 757
159 Ga0075435_100000882 3300007076 Bacteria 18834
160 Ga0075435_100000891 3300007076 Bacteria 18771
161 Ga0075435_100004221 3300007076 Bacteria 9866
162 Ga0075435_100009857 3300007076 Bacteria 6951
163 Ga0075435_100030938 3300007076 Bacteria 4213
164 Ga0075435_100091869 3300007076 Bacteria 2506
165 Ga0075435_100163979 3300007076 Bacteria 1873
166 Ga0075435_100383197 3300007076 Bacteria 1208
167 Ga0105240_10397481 3300009093 Bacteria 1553
168 Ga0111539_10000056 3300009094 Bacteria 114878
169 Ga0111539_10174790 3300009094 Bacteria 2509
170 Ga0111539_10540739 3300009094 Bacteria 1357
171 Ga0105245_10169085 3300009098 Bacteria 2080
172 Ga0105247_10006881 3300009101 Bacteria 7008
173 Ga0114129_10001088 3300009147 Bacteria 35659
174 Ga0114129_10003691 3300009147 Bacteria 21558
175 Ga0114129_10020735 3300009147 Bacteria 9340
176 Ga0114129_10024941 3300009147 Bacteria 8478
177 Ga0114129_10039491 3300009147 Bacteria 6654
178 Ga0114129_10054008 3300009147 Bacteria 5634
179 Ga0114129_10097023 3300009147 Bacteria 4080
180 Ga0114129_10107306 3300009147 Bacteria 3857
181 Ga0114129_10144788 3300009147 Bacteria 3255
182 Ga0114129_10145899 3300009147 Bacteria 3242
183 Ga0114129_10226286 3300009147 Bacteria 2521
184 Ga0114129_10429332 3300009147 Bacteria 1736
185 Ga0114129_11195418 3300009147 Unclassified 947
186 Ga0114129_11983214 3300009147 Bacteria 704
187 Ga0105243_10813993 3300009148 Bacteria 922
188 Ga0105241_10512086 3300009174 Unclassified 1072
189 Ga0105242_10610981 3300009176 Unclassified 1054
190 Ga0105242_10791380 3300009176 Bacteria 938
191 Ga0105242_11656665 3300009176 Bacteria 675
192 Ga0105248_10134060 3300009177 Bacteria 2794
193 Ga0105248_10229759 3300009177 Unclassified 2088
194 Ga0105248_10344440 3300009177 Unclassified 1678
195 Ga0105248_10398950 3300009177 Bacteria 1549
196 Ga0105248_10503968 3300009177 Unclassified 1365
197 Ga0105248_10661126 3300009177 Bacteria 1179
198 Ga0105248_11239369 3300009177 Unclassified 843
199 Ga0105248_12584725 3300009177 Bacteria 579
200 Ga0105237_11302930 3300009545 Unclassified 733
201 Ga0105238_11091815 3300009551 Unclassified 820
202 Ga0105249_10275990 3300009553 Bacteria 1676
203 Ga0105249_10462555 3300009553 Unclassified 1309
204 Ga0105249_10890923 3300009553 Bacteria 956
205 Ga0105239_10270673 3300010375 Bacteria 1910
206 Ga0157371_10863476 3300013102 Bacteria 685
207 Ga0157370_10507457 3300013104 Bacteria 1107
208 Ga0157369_10310564 3300013105 Bacteria 1640
209 Ga0157374_10432834 3300013296 Bacteria 1315
210 Ga0157378_10487693 3300013297 Bacteria 1229
211 Ga0157378_11396084 3300013297 Bacteria 743
212 Ga0163162_10666316 3300013306 Bacteria 1164
213 Ga0157372_10307129 3300013307 Unclassified 1846
214 Ga0157375_10649988 3300013308 Bacteria 1211
215 Ga0157375_11716165 3300013308 Unclassified 744
216 Ga0157380_10037822 3300014326 Bacteria 3743
217 Ga0157380_10544169 3300014326 Bacteria 1137
218 Ga0157377_10026356 3300014745 Unclassified 3110
219 Ga0157377_10161283 3300014745 Bacteria 1395
220 Ga0157379_10010887 3300014968 Bacteria 7928
221 Ga0157376_10281569 3300014969 Bacteria 1566
222 Ga0157376_10393629 3300014969 Bacteria 1338
223 Ga0157376_10473062 3300014969 Bacteria 1226
224 Ga0157376_10503003 3300014969 Bacteria 1191
225 Ga0163161_11137245 3300017792 Bacteria 673
226 Ga0207653_10070786 3300025885 Bacteria 1192
227 Ga0207710_10036406 3300025900 Bacteria 2170
228 Ga0207688_10123008 3300025901 Bacteria 1515
229 Ga0207680_10063177 3300025903 Bacteria 2265
230 Ga0207680_10149984 3300025903 Bacteria 1553
231 Ga0207680_10237713 3300025903 Unclassified 1254
232 Ga0207680_10325913 3300025903 Bacteria 1075
233 Ga0207699_10338377 3300025906 Bacteria 1060
234 Ga0207645_10222481 3300025907 Unclassified 1245
235 Ga0207643_10379189 3300025908 Bacteria 891
236 Ga0207684_10331708 3300025910 Bacteria 1311
237 Ga0207684_10344445 3300025910 Unclassified 1283
238 Ga0207654_10312344 3300025911 Unclassified 1072
239 Ga0207707_10048219 3300025912 Bacteria 3710
240 Ga0207695_10157394 3300025913 Bacteria 2206
241 Ga0207695_10305779 3300025913 Bacteria 1481
242 Ga0207695_11525778 3300025913 Unclassified 549
243 Ga0207660_10746690 3300025917 Bacteria 798
244 Ga0207657_10007049 3300025919 Bacteria 11550
245 Ga0207657_10444546 3300025919 Bacteria 1017
246 Ga0207652_10182999 3300025921 Bacteria 1884
247 Ga0207681_10829966 3300025923 Unclassified 773
248 Ga0207694_10327623 3300025924 Bacteria 1265
249 Ga0207650_10126375 3300025925 Bacteria 1996
250 Ga0207659_10020160 3300025926 Bacteria 4402
251 Ga0207659_10335372 3300025926 Bacteria 1251
252 Ga0207687_10123870 3300025927 Bacteria 1937
253 Ga0207664_10137634 3300025929 Bacteria 2062
254 Ga0207644_11320941 3300025931 Unclassified 606
255 Ga0207706_10080183 3300025933 Bacteria 2870
256 Ga0207706_10194233 3300025933 Bacteria 1781
257 Ga0207686_11257858 3300025934 Unclassified 607
258 Ga0207670_10316209 3300025936 Bacteria 1227
259 Ga0207669_10006658 3300025937 Bacteria 5296
260 Ga0207669_10083216 3300025937 Bacteria 2057
261 Ga0207669_11069670 3300025937 Unclassified 680
262 Ga0207704_10300680 3300025938 Unclassified 1229
263 Ga0207691_10082632 3300025940 Bacteria 2885
264 Ga0207711_10047540 3300025941 Bacteria 3669
265 Ga0207711_10089185 3300025941 Bacteria 2709
266 Ga0207711_10366571 3300025941 Unclassified 1335
267 Ga0207661_10181029 3300025944 Unclassified 1841
268 Ga0207679_10051510 3300025945 Bacteria 3014
269 Ga0207667_10127104 3300025949 Bacteria 2626
270 Ga0207667_10583916 3300025949 Bacteria 1128
271 Ga0207667_10809678 3300025949 Unclassified 933
272 Ga0207667_10943509 3300025949 Unclassified 853
273 Ga0207651_10044202 3300025960 Bacteria 2979
274 Ga0207651_10090291 3300025960 Bacteria 2239
275 Ga0207651_10178798 3300025960 Bacteria 1681
276 Ga0207651_10938864 3300025960 Unclassified 771
277 Ga0207712_10255768 3300025961 Bacteria 1418
278 Ga0207640_10180916 3300025981 Unclassified 1581
279 Ga0207640_11022087 3300025981 Unclassified 728
280 Ga0207658_10568362 3300025986 Unclassified 1016
281 Ga0207658_11009538 3300025986 Unclassified 759
282 Ga0207658_11268009 3300025986 Unclassified 674
283 Ga0207703_10058734 3300026035 Bacteria 3140
284 Ga0207708_10172118 3300026075 Bacteria 1715
285 Ga0207702_10042141 3300026078 Bacteria 3829
286 Ga0207641_10000874 3300026088 Bacteria 31545
287 Ga0207641_10321677 3300026088 Bacteria 1467
288 Ga0207648_10086287 3300026089 Bacteria 2738
289 Ga0207648_10260183 3300026089 Bacteria 1548
290 Ga0207676_10046275 3300026095 Bacteria 3366
291 Ga0207675_100033336 3300026118 Bacteria 4799
292 Ga0207675_100090777 3300026118 Bacteria 2872
293 Ga0207675_100144822 3300026118 Bacteria 2259
294 Ga0207675_100192274 3300026118 Bacteria 1958
295 Ga0207675_100356930 3300026118 Bacteria 1433
296 Ga0207683_10097834 3300026121 Unclassified 2618
297 Ga0207683_10277951 3300026121 Bacteria 1530
298 Ga0207698_10567096 3300026142 Bacteria 1115
299 Ga0209966_1053760 3300027695 Unclassified 860
300 Ga0209974_10022985 3300027876 Bacteria 2064
301 Ga0207428_10002778 3300027907 Bacteria 17388
302 Ga0207428_10083393 3300027907 Bacteria 2493
303 Ga0207428_10273140 3300027907 Bacteria 1256
304 Ga0207428_10515469 3300027907 Unclassified 867
305 Ga0268266_11572309 3300028379 Bacteria 633
306 Ga0268265_10002942 3300028380 Bacteria 12477
307 Ga0268265_10047964 3300028380 Bacteria 3204
308 Ga0268265_10056489 3300028380 Unclassified 2987
309 Ga0268265_10230746 3300028380 Bacteria 1627
310 Ga0268265_10486512 3300028380 Bacteria 1160
311 Ga0268264_10643930 3300028381 Unclassified 1048
312 Ga0268264_11019673 3300028381 Bacteria 834
313 Ga0268264_11356258 3300028381 Unclassified 721
314 Ga0265336_10068545 3300028666 Bacteria 1061
315 Ga0265332_10024920 3300031238 Bacteria 2630
316 Ga0307408_100281055 3300031548 Bacteria 1386
317 Ga0265314_10078074 3300031711 Bacteria 2194
318 Ga0307405_10095198 3300031731 Bacteria 1982
319 Ga0307413_10011842 3300031824 Bacteria 4310
320 Ga0307410_10043397 3300031852 Bacteria 2980
321 Ga0307407_10021828 3300031903 Bacteria 3310
322 Ga0307409_100421605 3300031995 Unclassified 1280
323 Ga0307416_100046979 3300032002 Bacteria 3413
324 Ga0307416_100348991 3300032002 Bacteria 1496
325 Ga0307411_10251669 3300032005 Bacteria 1389
326 Ga0373950_0001342 3300034818 Bacteria 3191
327 Ga0373959_0000310 3300034820 Bacteria 10147
328 Ga0373938_0003069 3300034957 Bacteria 2711
329 Ga0373928_0009846 3300035084 Bacteria 1871
330 Ga0373929_0000254 3300035085 Bacteria 9893
331 Ga0373940_0008403 3300035088 Bacteria 2366
332 Ga0373940_0185030 3300035088 Unclassified 679
333 Ga0373949_0001093 3300035090 Bacteria 8244
334 Ga0373951_0002187 3300035091 Bacteria 4973
335 Ga0373952_0005283 3300035092 Bacteria 2356
336 Ga0373932_0000628 3300035112 Bacteria 10707
337 Ga0373936_0297958 3300035113 Unclassified 727
338 Ga0373939_0000627 3300035114 Bacteria 8795
339 Ga0373941_0010332 3300035115 Bacteria 2382
340 Ga0373956_0016454 3300035119 Bacteria 3107
341 Ga0373960_0003170 3300035121 Bacteria 3715
342 Ga0373943_0002575 3300035170 Bacteria 8257
343 Ga0373946_0056446 3300035171 Bacteria 1658
344 Ga0373955_0005283 3300035172 Bacteria 5798
345 Ga0373942_0001520 3300035207 Bacteria 5972
346 Ga0373961_0002382 3300035241 Bacteria 4894
347 Ga0373962_0016188 3300035242 Bacteria 1920
348 Ga0373962_0033970 3300035242 Bacteria 1410
349 Ga0373924_0002415 3300035410 Bacteria 6288
350 Ga0373931_0056475 3300035691 Bacteria 2103
351 Ga0373931_0764206 3300035691 Unclassified 642
352 Ga0373935_0013377 3300035692 Bacteria 4950
353 Ga0373933_0208078 3300035724 Bacteria 1253
354 Ga0373947_0001887 3300035725 Bacteria 12806
355 Ga0373937_1761268 3300036401 Bacteria 566
356 Ga0373925_0168973 3300037068 Bacteria 1726
357 Ga0436365_0939940 3300039437 Bacteria 555
358 Ga0436365_1761119 3300039437 Bacteria 3100
359 Ga0439450_077263 3300042008 Bacteria 824
360 Ga0439435_0008791 3300042436 Bacteria 2353
361 Ga0439435_0020803 3300042436 Bacteria 1696
362 Ga0439460_0355889 3300042461 Bacteria 517
363 Ga0439440_0111428 3300042993 Unclassified 753
364 Ga0466963_0747259 3300044694 Bacteria 690
365 Ga0451576_0510504 3300045051 Bacteria 1263
366 Ga0451576_0686854 3300045051 Bacteria 1075
367 Ga0466967_0609690 3300045976 Bacteria 1078
368 Ga0495603_0098071 3300046455 Unclassified 1712
369 Ga0495629_0701172 3300046459 Bacteria 672
370 Ga0495651_0381638 3300046462 Bacteria 924
371 Ga0495608_0389083 3300046511 Bacteria 854
372 Ga0495630_0001930 3300046517 Bacteria 14456
373 Ga0495663_0107391 3300046525 Unclassified 925
374 Ga0495642_0180473 3300046528 Bacteria 919
375 Ga0495652_0072519 3300046529 Bacteria 2870
376 Ga0495640_0147355 3300046533 Bacteria 1514
377 Ga0495587_0038684 3300046536 Bacteria 2859
378 Ga0495645_0244852 3300046543 Bacteria 1194
379 Ga0495667_0060269 3300046559 Bacteria 2489
380 Ga0495656_0015128 3300046615 Bacteria 2907
381 Ga0495656_0518405 3300046615 Unclassified 633
382 Ga0495634_0299729 3300046642 Bacteria 972
383 Ga0495659_0373317 3300046664 Unclassified 612
384 Ga0495599_0033717 3300046678 Bacteria 3218
385 Ga0495623_0213050 3300046679 Bacteria 1105
386 Ga0495647_0050120 3300046681 Bacteria 1619
387 Ga0495647_0162708 3300046681 Bacteria 963
388 Ga0495647_0359542 3300046681 Bacteria 664
389 Ga0495658_0058164 3300046683 Unclassified 2211
390 Ga0495658_0204129 3300046683 Bacteria 1233
391 Ga0495669_0087195 3300046684 Bacteria 1438
392 Ga0495613_0001961 3300046689 Bacteria 15620
393 Ga0495624_0592299 3300046690 Bacteria 661
394 Ga0495670_0235262 3300046691 Bacteria 975
395 Ga0495670_0356387 3300046691 Unclassified 788
396 Ga0495604_0022613 3300047317 Bacteria 5020
397 Ga0495674_0009533 3300047319 Bacteria 9220
398 Ga0495680_0337507 3300047322 Bacteria 1052
399 Ga0495675_0386053 3300047444 Unclassified 818
400 Ga0495684_0000706 3300047471 Bacteria 26822
401 Ga0495602_0661738 3300048088 Bacteria 712
402 Ga0496101_0001669 3300048904 Bacteria 13326
403 Ga0496102_0046866 3300048905 Bacteria 3927
404 Ga0496102_0569256 3300048905 Unclassified 1056
405 Ga0496104_0016089 3300048907 Bacteria 6789
406 Ga0496104_0684069 3300048907 Bacteria 934
407 Ga0496104_0782104 3300048907 Bacteria 861
408 Ga0496106_0076144 3300048909 Bacteria 2571
409 Ga0496109_0044570 3300048912 Bacteria 4024
410 Ga0496109_1258526 3300048912 Unclassified 676
411 Ga0496112_0264001 3300048915 Bacteria 1671
412 Ga0496112_0438787 3300048915 Bacteria 1244
413 Ga0496112_0764947 3300048915 Unclassified 892
414 Ga0496114_0000373 3300048917 Bacteria 33059
415 Ga0496114_0244018 3300048917 Unclassified 1580
416 Ga0496115_0633694 3300048918 Unclassified 847
417 Ga0501037_0352170 3300049573 Bacteria 1016
418 Ga0501039_0076621 3300049575 Bacteria 2600
419 Ga0501040_0285522 3300049576 Unclassified 1179
420 Ga0501042_0006369 3300049578 Bacteria 7652
421 Ga0501042_0180704 3300049578 Bacteria 1522
422 Ga0501043_0219822 3300049579 Bacteria 1470
423 Ga0501047_0199337 3300049581 Bacteria 1863
424 Ga0501048_0268638 3300049582 Archaea 1212
425 Ga0501068_0286351 3300049584 Bacteria 1054
426 Ga0501071_0018867 3300049587 Bacteria 4783
427 Ga0501072_0032334 3300049588 Bacteria 4098
428 Ga0501072_0288298 3300049588 Bacteria 1305
429 Ga0501073_0458950 3300049589 Unclassified 881
430 Ga0501073_0536957 3300049589 Unclassified 808
431 Ga0501073_0661008 3300049589 Archaea 721
432 Ga0501073_0726838 3300049589 Bacteria 685
433 Ga0501073_1034216 3300049589 Unclassified 565
434 Ga0501075_0017362 3300049591 Bacteria 5199
435 Ga0501075_0128953 3300049591 Bacteria 1926
436 Ga0501076_0056387 3300049592 Bacteria 3118
437 Ga0501076_0083923 3300049592 Bacteria 2559
438 Ga0501077_0088976 3300049593 Bacteria 1957
439 Ga0501077_0245207 3300049593 Unclassified 1139
440 Ga0501229_064556 3300049706 Bacteria 564
441 Ga0501079_0003457 3300049741 Bacteria 11606
442 Ga0501081_0009807 3300049743 Bacteria 6239
443 Ga0501081_0014867 3300049743 Bacteria 5135
444 Ga0501081_0652276 3300049743 Unclassified 789
445 Ga0501083_0121772 3300049744 Bacteria 1711
446 Ga0501035_0447330 3300049822 Bacteria 1069
447 Ga0501044_0001331 3300049823 Bacteria 29040
448 Ga0501044_1165611 3300049823 Unclassified 639
449 Ga0501045_0143876 3300049824 Bacteria 1773
450 Ga0501212_123917 3300049851 Unclassified 504
451 nmdc:mga05p37_105985_c1 3300050507 Bacteria 3457
452 nmdc:mga05p37_116526_c1 3300050507 Bacteria 3283
453 nmdc:mga05p37_188105_c1 3300050507 Bacteria 2509
454 nmdc:mga05p37_25178_c1 3300050507 Bacteria 7236
455 nmdc:mga05p37_277913_c1 3300050507 Bacteria 1998
456 nmdc:mga05p37_29369_c1 3300050507 Bacteria 6710
457 nmdc:mga05p37_305972_c2 3300050507 Unclassified 681
458 nmdc:mga05p37_38271_c1 3300050507 Bacteria 5883
459 nmdc:mga05p37_416394_c1 3300050507 Unclassified 1565
460 nmdc:mga05p37_56245_c1 3300050507 Bacteria 4843
461 nmdc:mga05p37_96681_c1 3300050507 Bacteria 3639
462 nmdc:mga09592_216888_c1 3300050508 Bacteria 1658
463 nmdc:mga0qj67_41255_c1 3300050509 Bacteria 3629
464 nmdc:mga0qj67_62513_c1 3300050509 Unclassified 2959
465 nmdc:mga06r32_177130_c1 3300050510 Unclassified 2117
466 nmdc:mga06r32_482375_c1 3300050510 Bacteria 1218
467 nmdc:mga06r32_668779_c1 3300050510 Bacteria 1006
468 nmdc:mga08y16_1311_c1 3300050511 Bacteria 24756
469 nmdc:mga08y16_17989_c1 3300050511 Bacteria 7444
470 nmdc:mga08y16_485322_c1 3300050511 Bacteria 1257
471 nmdc:mga08y16_54506_c1 3300050511 Bacteria 4178
472 nmdc:mga0n895_135881_c1 3300050512 Bacteria 2485
473 nmdc:mga0n895_1386689_c1 3300050512 Bacteria 672
474 nmdc:mga0n895_1546_c1 3300050512 Bacteria 17272
475 nmdc:mga0n895_16945_c1 3300050512 Bacteria 6702
476 nmdc:mga0n895_18893_c1 3300050512 Bacteria 6391
477 nmdc:mga0n895_190983_c1 3300050512 Bacteria 2079
478 nmdc:mga0n895_20068_c1 3300050512 Bacteria 6223
479 nmdc:mga0n895_26490_c1 3300050512 Bacteria 5493
480 nmdc:mga0n895_458364_c1 3300050512 Bacteria 1287
481 nmdc:mga0n895_58135_c1 3300050512 Bacteria 3813
482 nmdc:mga0n895_640674_c1 3300050512 Bacteria 1062
483 nmdc:mga0n895_887219_c1 3300050512 Bacteria 878
484 nmdc:mga0n895_92100_c1 3300050512 Bacteria 3035
485 nmdc:mga0rr50_101338_c1 3300050513 Bacteria 2263
486 nmdc:mga0rr50_177689_c1 3300050513 Unclassified 1739
487 nmdc:mga0rr50_269_c1 3300050513 Bacteria 28252
488 nmdc:mga0rr50_37987_c1 3300050513 Bacteria 3480
489 nmdc:mga0rr50_43319_c1 3300050513 Bacteria 3293
490 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
491 nmdc:mga0rr50_99654_c1 3300050513 Bacteria 2280
492 nmdc:mga08x19_11357_c1 3300050514 Bacteria 5362
493 nmdc:mga08x19_2805_c1 3300050514 Bacteria 10507
494 nmdc:mga08x19_299863_c1 3300050514 Unclassified 1116
495 nmdc:mga08x19_324688_c1 3300050514 Bacteria 1071
496 nmdc:mga08x19_38575_c1 3300050514 Bacteria 3035
497 nmdc:mga0a205_123151_c1 3300050515 Bacteria 2493
498 nmdc:mga0a205_204537_c1 3300050515 Unclassified 1864
499 nmdc:mga0a205_3043_c1 3300050515 Bacteria 11795
500 nmdc:mga0a205_399489_c1 3300050515 Unclassified 1238
501 nmdc:mga0a205_467973_c1 3300050515 Bacteria 1119
502 nmdc:mga0a205_47727_c1 3300050515 Bacteria 4132
503 nmdc:mga0a205_94891_c1 3300050515 Bacteria 2882
504 Ga0495601_0011013 3300053077 Bacteria 5403
505 Ga0495601_0550994 3300053077 Bacteria 742
506 Ga0495595_0067712 3300053084 Bacteria 1683
507 Ga0495595_0248876 3300053084 Unclassified 890
508 Ga0495619_0001998 3300053085 Bacteria 13574
509 Ga0495619_0294867 3300053085 Unclassified 1123
510 Ga0495619_0672497 3300053085 Unclassified 705
511 Ga0501084_0005447 3300054114 Bacteria 10438
512 Ga0501084_0321579 3300054114 Archaea 1307
513 Ga0501084_0562655 3300054114 Bacteria 963
514 Ga0501082_0123806 3300060353 Unclassified 2242
515 Ga0501082_0152966 3300060353 Bacteria 2004
516 Ga0501082_0329530 3300060353 Bacteria 1330
517 Ga0530510_0896326 3300061734 Unclassified 678
518 Ga0070705_100119806
519 rootL2_10290995
520 Ga0065704_10386294
521 Ga0065712_10000800
522 Ga0065712_10106877
523 Ga0065715_10281047
524 Ga0065707_10006309
525 Ga0065707_10290630
526 Ga0070676_10153333
527 Ga0070683_100222209
528 Ga0070690_100018592
529 Ga0070690_100100205
530 Ga0070690_100120662
531 Ga0070670_100530909
532 Ga0070677_10255539
533 Ga0070677_10531444
534 Ga0070666_10064425
535 Ga0070666_10759620
536 Ga0070682_100224201
537 Ga0068868_100196367
538 Ga0070660_100005272
539 Ga0070660_100247144
540 Ga0070660_100268043
541 Ga0070691_10135731
542 Ga0070669_100086310
543 Ga0070675_100005517
544 Ga0070675_100010814
545 Ga0070675_100037908
546 Ga0070675_100168809
547 Ga0070675_100328875
548 Ga0070674_100035642
549 Ga0070674_100053478
550 Ga0070674_100118472
551 Ga0070674_101594893
552 Ga0070673_100032863
553 Ga0070673_100182661
554 Ga0070688_100354048
555 Ga0070659_100192251
556 Ga0070667_100152474
557 Ga0070667_100663902
558 Ga0070709_10080058
559 Ga0070714_100014694
560 Ga0070713_100066495
561 Ga0070705_100977490
562 Ga0070700_100129115
563 Ga0070694_100097533
564 Ga0070678_100058653
565 Ga0070678_100177807
566 Ga0070662_100207111
567 Ga0070681_10050784
568 Ga0070681_11361824
569 Ga0068867_100141721
570 Ga0070706_100168828
571 Ga0070706_100283829
572 Ga0070706_100320355
573 Ga0070706_100350547
574 Ga0070707_100066012
575 Ga0070698_100081168
576 Ga0070698_100214583
577 Ga0070698_100818198
578 Ga0070699_100088968
579 Ga0070699_100830087
580 Ga0070679_100049155
581 Ga0070679_100252182
582 Ga0070697_100030773
583 Ga0070697_100079071
584 Ga0070697_100463451
585 Ga0070672_100029428
586 Ga0070672_100699075
587 Ga0070686_100080477
588 Ga0070686_100625106
589 Ga0070695_100220600
590 Ga0070696_100219588
591 Ga0070696_100229463
592 Ga0070665_100145877
593 Ga0070665_101816216
594 Ga0070704_100033210
595 Ga0070704_100157588
596 Ga0070704_100521629
597 Ga0070704_100690687
598 Ga0068855_100079054
599 Ga0068855_100371390
600 Ga0068855_100564230
601 Ga0068855_101950221
602 Ga0070664_100047891
603 Ga0070664_100179553
604 Ga0070664_100331057
605 Ga0070664_100352390
606 Ga0068854_100103901
607 Ga0068854_100769953
608 Ga0068854_101037823
609 Ga0068856_100069326
610 Ga0068856_100538437
611 Ga0070702_100715618
612 Ga0068852_100281341
613 Ga0068859_100110287
614 Ga0068859_100553644
615 Ga0068859_101451753
616 Ga0068864_100072431
617 Ga0068861_100082407
618 Ga0068861_100263682
619 Ga0068861_100308571
620 Ga0068861_101024666
621 Ga0068870_10148808
622 Ga0068870_10845512
623 Ga0068863_100006039
624 Ga0068863_100329970
625 Ga0068858_100006490
626 Ga0068858_101316418
627 Ga0068860_100083951
628 Ga0068860_100386144
629 Ga0068860_100865962
630 Ga0068860_101141128
631 Ga0068862_100010418
632 Ga0068862_100316545
633 Ga0068862_100801060
634 Ga0068862_100822966
635 Ga0081455_10087723
636 Ga0081539_10005654
637 Ga0075432_10084003
638 Ga0070715_10013288
639 Ga0097621_100004606
640 Ga0068871_100014248
641 Ga0068871_100527037
642 Ga0075428_100053664
643 Ga0075428_100981591
644 Ga0075430_100048673
645 Ga0075430_100066564
646 Ga0075430_100340891
647 Ga0075430_100504498
648 Ga0075431_100059686
649 Ga0075431_100102536
650 Ga0075433_10007559
651 Ga0075433_10085921
652 Ga0075433_10304286
653 Ga0075433_10309416
654 Ga0075433_10384894
655 Ga0075433_10777684
656 Ga0075434_100004203
657 Ga0075434_100073661
658 Ga0075434_100091953
659 Ga0075434_100112665
660 Ga0075434_100115679
661 Ga0075434_100238183
662 Ga0075434_100254593
663 Ga0075434_100381464
664 Ga0075434_100506857
665 Ga0075434_101255474
666 Ga0075434_101514687
667 Ga0075434_101813661
668 Ga0075429_100071594
669 Ga0075436_100003683
670 Ga0075436_100318297
671 Ga0075436_100332230
672 Ga0075436_101028453
673 Ga0097620_100110288
674 Ga0097620_100553642
675 Ga0097620_101451190
676 Ga0075435_100000882
677 Ga0075435_100000891
678 Ga0075435_100004221
679 Ga0075435_100009857
680 Ga0075435_100030938
681 Ga0075435_100091869
682 Ga0075435_100163979
683 Ga0075435_100383197
684 Ga0105240_10397481
685 Ga0111539_10000056
686 Ga0111539_10174790
687 Ga0111539_10540739
688 Ga0105245_10169085
689 Ga0105247_10006881
690 Ga0114129_10001088
691 Ga0114129_10003691
692 Ga0114129_10020735
693 Ga0114129_10024941
694 Ga0114129_10039491
695 Ga0114129_10054008
696 Ga0114129_10097023
697 Ga0114129_10107306
698 Ga0114129_10144788
699 Ga0114129_10145899
700 Ga0114129_10226286
701 Ga0114129_10429332
702 Ga0114129_11195418
703 Ga0114129_11983214
704 Ga0105243_10813993
705 Ga0105241_10512086
706 Ga0105242_10610981
707 Ga0105242_10791380
708 Ga0105242_11656665
709 Ga0105248_10134060
710 Ga0105248_10229759
711 Ga0105248_10344440
712 Ga0105248_10398950
713 Ga0105248_10503968
714 Ga0105248_10661126
715 Ga0105248_11239369
716 Ga0105248_12584725
717 Ga0105237_11302930
718 Ga0105238_11091815
719 Ga0105249_10275990
720 Ga0105249_10462555
721 Ga0105249_10890923
722 Ga0105239_10270673
723 Ga0157371_10863476
724 Ga0157370_10507457
725 Ga0157369_10310564
726 Ga0157374_10432834
727 Ga0157378_10487693
728 Ga0157378_11396084
729 Ga0163162_10666316
730 Ga0157372_10307129
731 Ga0157375_10649988
732 Ga0157375_11716165
733 Ga0157380_10037822
734 Ga0157380_10544169
735 Ga0157377_10026356
736 Ga0157377_10161283
737 Ga0157379_10010887
738 Ga0157376_10281569
739 Ga0157376_10393629
740 Ga0157376_10473062
741 Ga0157376_10503003
742 Ga0163161_11137245
743 Ga0207653_10070786
744 Ga0207710_10036406
745 Ga0207688_10123008
746 Ga0207680_10063177
747 Ga0207680_10149984
748 Ga0207680_10237713
749 Ga0207680_10325913
750 Ga0207699_10338377
751 Ga0207645_10222481
752 Ga0207643_10379189
753 Ga0207684_10331708
754 Ga0207684_10344445
755 Ga0207654_10312344
756 Ga0207707_10048219
757 Ga0207695_10157394
758 Ga0207695_10305779
759 Ga0207695_11525778
760 Ga0207660_10746690
761 Ga0207657_10007049
762 Ga0207657_10444546
763 Ga0207652_10182999
764 Ga0207681_10829966
765 Ga0207694_10327623
766 Ga0207650_10126375
767 Ga0207659_10020160
768 Ga0207659_10335372
769 Ga0207687_10123870
770 Ga0207664_10137634
771 Ga0207644_11320941
772 Ga0207706_10080183
773 Ga0207706_10194233
774 Ga0207686_11257858
775 Ga0207670_10316209
776 Ga0207669_10006658
777 Ga0207669_10083216
778 Ga0207669_11069670
779 Ga0207704_10300680
780 Ga0207691_10082632
781 Ga0207711_10047540
782 Ga0207711_10089185
783 Ga0207711_10366571
784 Ga0207661_10181029
785 Ga0207679_10051510
786 Ga0207667_10127104
787 Ga0207667_10583916
788 Ga0207667_10809678
789 Ga0207667_10943509
790 Ga0207651_10044202
791 Ga0207651_10090291
792 Ga0207651_10178798
793 Ga0207651_10938864
794 Ga0207712_10255768
795 Ga0207640_10180916
796 Ga0207640_11022087
797 Ga0207658_10568362
798 Ga0207658_11009538
799 Ga0207658_11268009
800 Ga0207703_10058734
801 Ga0207708_10172118
802 Ga0207702_10042141
803 Ga0207641_10000874
804 Ga0207641_10321677
805 Ga0207648_10086287
806 Ga0207648_10260183
807 Ga0207676_10046275
808 Ga0207675_100033336
809 Ga0207675_100090777
810 Ga0207675_100144822
811 Ga0207675_100192274
812 Ga0207675_100356930
813 Ga0207683_10097834
814 Ga0207683_10277951
815 Ga0207698_10567096
816 Ga0209966_1053760
817 Ga0209974_10022985
818 Ga0207428_10002778
819 Ga0207428_10083393
820 Ga0207428_10273140
821 Ga0207428_10515469
822 Ga0268266_11572309
823 Ga0268265_10002942
824 Ga0268265_10047964
825 Ga0268265_10056489
826 Ga0268265_10230746
827 Ga0268265_10486512
828 Ga0268264_10643930
829 Ga0268264_11019673
830 Ga0268264_11356258
831 Ga0265336_10068545
832 Ga0265332_10024920
833 Ga0307408_100281055
834 Ga0265314_10078074
835 Ga0307405_10095198
836 Ga0307413_10011842
837 Ga0307410_10043397
838 Ga0307407_10021828
839 Ga0307409_100421605
840 Ga0307416_100046979
841 Ga0307416_100348991
842 Ga0307411_10251669
843 Ga0373950_0001342
844 Ga0373959_0000310
845 Ga0373938_0003069
846 Ga0373928_0009846
847 Ga0373929_0000254
848 Ga0373940_0008403
849 Ga0373940_0185030
850 Ga0373949_0001093
851 Ga0373951_0002187
852 Ga0373952_0005283
853 Ga0373932_0000628
854 Ga0373936_0297958
855 Ga0373939_0000627
856 Ga0373941_0010332
857 Ga0373956_0016454
858 Ga0373960_0003170
859 Ga0373943_0002575
860 Ga0373946_0056446
861 Ga0373955_0005283
862 Ga0373942_0001520
863 Ga0373961_0002382
864 Ga0373962_0016188
865 Ga0373962_0033970
866 Ga0373924_0002415
867 Ga0373931_0056475
868 Ga0373931_0764206
869 Ga0373935_0013377
870 Ga0373933_0208078
871 Ga0373947_0001887
872 Ga0373937_1761268
873 Ga0373925_0168973
874 Ga0436365_0939940
875 Ga0436365_1761119
876 Ga0439450_077263
877 Ga0439435_0008791
878 Ga0439435_0020803
879 Ga0439460_0355889
880 Ga0439440_0111428
881 Ga0466963_0747259
882 Ga0451576_0510504
883 Ga0451576_0686854
884 Ga0466967_0609690
885 Ga0495603_0098071
886 Ga0495629_0701172
887 Ga0495651_0381638
888 Ga0495608_0389083
889 Ga0495630_0001930
890 Ga0495663_0107391
891 Ga0495642_0180473
892 Ga0495652_0072519
893 Ga0495640_0147355
894 Ga0495587_0038684
895 Ga0495645_0244852
896 Ga0495667_0060269
897 Ga0495656_0015128
898 Ga0495656_0518405
899 Ga0495634_0299729
900 Ga0495659_0373317
901 Ga0495599_0033717
902 Ga0495623_0213050
903 Ga0495647_0050120
904 Ga0495647_0162708
905 Ga0495647_0359542
906 Ga0495658_0058164
907 Ga0495658_0204129
908 Ga0495669_0087195
909 Ga0495613_0001961
910 Ga0495624_0592299
911 Ga0495670_0235262
912 Ga0495670_0356387
913 Ga0495604_0022613
914 Ga0495674_0009533
915 Ga0495680_0337507
916 Ga0495675_0386053
917 Ga0495684_0000706
918 Ga0495602_0661738
919 Ga0496101_0001669
920 Ga0496102_0046866
921 Ga0496102_0569256
922 Ga0496104_0016089
923 Ga0496104_0684069
924 Ga0496104_0782104
925 Ga0496106_0076144
926 Ga0496109_0044570
927 Ga0496109_1258526
928 Ga0496112_0264001
929 Ga0496112_0438787
930 Ga0496112_0764947
931 Ga0496114_0000373
932 Ga0496114_0244018
933 Ga0496115_0633694
934 Ga0501037_0352170
935 Ga0501039_0076621
936 Ga0501040_0285522
937 Ga0501042_0006369
938 Ga0501042_0180704
939 Ga0501043_0219822
940 Ga0501047_0199337
941 Ga0501048_0268638
942 Ga0501068_0286351
943 Ga0501071_0018867
944 Ga0501072_0032334
945 Ga0501072_0288298
946 Ga0501073_0458950
947 Ga0501073_0536957
948 Ga0501073_0661008
949 Ga0501073_0726838
950 Ga0501073_1034216
951 Ga0501075_0017362
952 Ga0501075_0128953
953 Ga0501076_0056387
954 Ga0501076_0083923
955 Ga0501077_0088976
956 Ga0501077_0245207
957 Ga0501229_064556
958 Ga0501079_0003457
959 Ga0501081_0009807
960 Ga0501081_0014867
961 Ga0501081_0652276
962 Ga0501083_0121772
963 Ga0501035_0447330
964 Ga0501044_0001331
965 Ga0501044_1165611
966 Ga0501045_0143876
967 Ga0501212_123917
968 nmdc:mga05p37_105985_c1
969 nmdc:mga05p37_116526_c1
970 nmdc:mga05p37_188105_c1
971 nmdc:mga05p37_25178_c1
972 nmdc:mga05p37_277913_c1
973 nmdc:mga05p37_29369_c1
974 nmdc:mga05p37_305972_c2
975 nmdc:mga05p37_38271_c1
976 nmdc:mga05p37_416394_c1
977 nmdc:mga05p37_56245_c1
978 nmdc:mga05p37_96681_c1
979 nmdc:mga09592_216888_c1
980 nmdc:mga0qj67_41255_c1
981 nmdc:mga0qj67_62513_c1
982 nmdc:mga06r32_177130_c1
983 nmdc:mga06r32_482375_c1
984 nmdc:mga06r32_668779_c1
985 nmdc:mga08y16_1311_c1
986 nmdc:mga08y16_17989_c1
987 nmdc:mga08y16_485322_c1
988 nmdc:mga08y16_54506_c1
989 nmdc:mga0n895_135881_c1
990 nmdc:mga0n895_1386689_c1
991 nmdc:mga0n895_1546_c1
992 nmdc:mga0n895_16945_c1
993 nmdc:mga0n895_18893_c1
994 nmdc:mga0n895_190983_c1
995 nmdc:mga0n895_20068_c1
996 nmdc:mga0n895_26490_c1
997 nmdc:mga0n895_458364_c1
998 nmdc:mga0n895_58135_c1
999 nmdc:mga0n895_640674_c1
1000 nmdc:mga0n895_887219_c1
1001 nmdc:mga0n895_92100_c1
1002 nmdc:mga0rr50_101338_c1
1003 nmdc:mga0rr50_177689_c1
1004 nmdc:mga0rr50_269_c1
1005 nmdc:mga0rr50_37987_c1
1006 nmdc:mga0rr50_43319_c1
1007 nmdc:mga0rr50_8_c1
1008 nmdc:mga0rr50_99654_c1
1009 nmdc:mga08x19_11357_c1
1010 nmdc:mga08x19_2805_c1
1011 nmdc:mga08x19_299863_c1
1012 nmdc:mga08x19_324688_c1
1013 nmdc:mga08x19_38575_c1
1014 nmdc:mga0a205_123151_c1
1015 nmdc:mga0a205_204537_c1
1016 nmdc:mga0a205_3043_c1
1017 nmdc:mga0a205_399489_c1
1018 nmdc:mga0a205_467973_c1
1019 nmdc:mga0a205_47727_c1
1020 nmdc:mga0a205_94891_c1
1021 Ga0495601_0011013
1022 Ga0495601_0550994
1023 Ga0495595_0067712
1024 Ga0495595_0248876
1025 Ga0495619_0001998
1026 Ga0495619_0294867
1027 Ga0495619_0672497
1028 Ga0501084_0005447
1029 Ga0501084_0321579
1030 Ga0501084_0562655
1031 Ga0501082_0123806
1032 Ga0501082_0152966
1033 Ga0501082_0329530
1034 Ga0530510_0896326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

33

144

0.9

PF08445

FR47

FR47-like protein

81

155

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

26

152

0.82

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

8

145

0.77

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

61

146

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rb3-assembly1.cif.gz_A cryo-em structure of human binary natc complex with a bisubstrate inhibitor 0.9203 10 156
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9096 112 156
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.907 112 156
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9062 10 159
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.9058 112 156
ID Description Score Start End Superfamily
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9713 95 156 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9707 74 137 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9399 23 159 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9309 12 156 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9267 23 159 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A536SWY7-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9961 9 143 GO:0005737
GO:0008999
AF-A0A7Y4WSK0-F1-model_v4 Ribosomal protein S18-alanine N-acetyltransferase 0.992 9 156 GO:0005840
GO:0008080
AF-A0A2V8GVZ5-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9875 11 159 GO:0008080
AF-A0A2G4JJ83-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9822 12 159 GO:0005737
GO:0008999
AF-A0A3N5PM47-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9814 10 156 GO:0005737
GO:0008999

Map