F458060

General Info

Members Datasets Scaffolds Average Seq Length
516 252 1032 197

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_1047325|Ga0501036_1047325_17_610
Length 189
Sequence MRFLRRGDSASTLDLLVAGLGNPGSEHAHDRHNAGWMVADELVRRHEGSYRSKFGGRIADLVLKPEAYMNESGASIRAAARFYKLDPGLVLVVHDDVDLPTARLQARLGGGLAGHNGLRSIVRELGTQEFLRLRVGVGRPERGDPRPVADYVLSPFTPEDDAEAIVGHAADAVESLVSDGLEATQRRFN

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 12.02
Rhizosphere 87.4
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_1047325 3300049572 Bacteria 667
2 Ga0070658_10046459 3300005327 Bacteria 3513
3 Ga0070658_10053095 3300005327 Bacteria 3289
4 Ga0070683_100108265 3300005329 Unclassified 2621
5 Ga0070683_100405810 3300005329 Bacteria 1300
6 Ga0070680_100314736 3300005336 Bacteria 1328
7 Ga0070682_100104369 3300005337 Bacteria 1877
8 Ga0070682_100174607 3300005337 Bacteria 1496
9 Ga0070682_100184508 3300005337 Bacteria 1460
10 Ga0070660_100006196 3300005339 Bacteria 8276
11 Ga0070660_100086865 3300005339 Bacteria 2461
12 Ga0070675_100926083 3300005354 Bacteria 799
13 Ga0070671_100046429 3300005355 Bacteria 3612
14 Ga0070659_100145072 3300005366 Bacteria 1934
15 Ga0070709_10069822 3300005434 Bacteria 2263
16 Ga0070714_100339905 3300005435 Bacteria 1408
17 Ga0070714_100472324 3300005435 Bacteria 1193
18 Ga0070713_100117613 3300005436 Bacteria 2326
19 Ga0070710_10016474 3300005437 Bacteria 3762
20 Ga0070705_101010171 3300005440 Bacteria 676
21 Ga0070694_100241786 3300005444 Bacteria 1362
22 Ga0070708_100472802 3300005445 Bacteria 1182
23 Ga0070678_100270747 3300005456 Unclassified 1432
24 Ga0070681_10159049 3300005458 Unclassified 2183
25 Ga0070706_100376312 3300005467 Bacteria 1323
26 Ga0070707_100206290 3300005468 Bacteria 1916
27 Ga0070707_100300525 3300005468 Bacteria 1560
28 Ga0070698_100944171 3300005471 Bacteria 809
29 Ga0070679_100312866 3300005530 Bacteria 1520
30 Ga0070679_100331116 3300005530 Bacteria 1471
31 Ga0070679_100351168 3300005530 Bacteria 1422
32 Ga0070704_100054281 3300005549 Bacteria 2835
33 Ga0068855_100028541 3300005563 Bacteria 6675
34 Ga0068855_100198617 3300005563 Bacteria 2259
35 Ga0068855_100432788 3300005563 Bacteria 1438
36 Ga0070664_100721274 3300005564 Bacteria 930
37 Ga0068856_100081297 3300005614 Bacteria 3214
38 Ga0068856_100087201 3300005614 Bacteria 3102
39 Ga0068852_100207471 3300005616 Bacteria 1857
40 Ga0068864_100193535 3300005618 Bacteria 1865
41 Ga0068863_100307184 3300005841 Unclassified 1539
42 Ga0070717_10001105 3300006028 Bacteria 18179
43 Ga0070717_10017184 3300006028 Bacteria 5623
44 Ga0070717_10266972 3300006028 Bacteria 1515
45 Ga0070717_10980370 3300006028 Bacteria 770
46 Ga0075365_10079033 3300006038 Bacteria 2225
47 Ga0070715_10000878 3300006163 Bacteria 8326
48 Ga0070716_100005870 3300006173 Bacteria 5968
49 Ga0070712_100166358 3300006175 Bacteria 1707
50 Ga0068871_100398724 3300006358 Bacteria 1225
51 Ga0075428_100722145 3300006844 Bacteria 1061
52 Ga0075434_100005305 3300006871 Bacteria 11723
53 Ga0075434_100262991 3300006871 Bacteria 1744
54 Ga0068865_100896379 3300006881 Bacteria 771
55 Ga0075435_100008806 3300007076 Bacteria 7269
56 Ga0105240_10351531 3300009093 Bacteria 1672
57 Ga0111539_10047952 3300009094 Bacteria 5102
58 Ga0105245_10306700 3300009098 Bacteria 1559
59 Ga0105245_10608028 3300009098 Unclassified 1120
60 Ga0105247_10049407 3300009101 Bacteria 2586
61 Ga0114129_10237328 3300009147 Bacteria 2452
62 Ga0114129_10964580 3300009147 Bacteria 1076
63 Ga0114129_11914124 3300009147 Unclassified 719
64 Ga0105242_10104232 3300009176 Bacteria 2407
65 Ga0105242_11774919 3300009176 Bacteria 655
66 Ga0105237_10253696 3300009545 Unclassified 1761
67 Ga0105238_10521496 3300009551 Bacteria 1191
68 Ga0157373_10115004 3300013100 Bacteria 1892
69 Ga0157370_10096209 3300013104 Bacteria 2778
70 Ga0157369_10156737 3300013105 Unclassified 2405
71 Ga0157369_10736517 3300013105 Unclassified 1014
72 Ga0157374_10142715 3300013296 Bacteria 2325
73 Ga0157378_10306249 3300013297 Bacteria 1539
74 Ga0163162_10389392 3300013306 Bacteria 1527
75 Ga0157375_10652404 3300013308 Bacteria 1209
76 Ga0157379_10233394 3300014968 Bacteria 1668
77 Ga0157376_10026968 3300014969 Bacteria 4548
78 Ga0206356_10454879 3300020070 Bacteria 925
79 Ga0206353_10601416 3300020082 Bacteria 1389
80 Ga0206353_11268266 3300020082 Bacteria 1324
81 Ga0206353_11975521 3300020082 Bacteria 1465
82 Ga0213875_10074318 3300021388 Unclassified 1586
83 Ga0213871_10004038 3300021441 Bacteria 2895
84 Ga0207692_10016562 3300025898 Bacteria 3268
85 Ga0207710_10084172 3300025900 Bacteria 1480
86 Ga0207685_10030864 3300025905 Bacteria 1913
87 Ga0207699_10072929 3300025906 Bacteria 2104
88 Ga0207643_10269268 3300025908 Unclassified 1054
89 Ga0207705_10039420 3300025909 Bacteria 3386
90 Ga0207705_10111743 3300025909 Bacteria 2019
91 Ga0207705_10123399 3300025909 Bacteria 1924
92 Ga0207684_10136564 3300025910 Bacteria 2106
93 Ga0207684_10284001 3300025910 Bacteria 1427
94 Ga0207654_10318180 3300025911 Bacteria 1063
95 Ga0207707_10154780 3300025912 Unclassified 2005
96 Ga0207695_10229842 3300025913 Bacteria 1760
97 Ga0207671_10079901 3300025914 Bacteria 2451
98 Ga0207693_10019525 3300025915 Bacteria 5390
99 Ga0207663_10074701 3300025916 Bacteria 2197
100 Ga0207657_10002960 3300025919 Bacteria 18211
101 Ga0207657_10010261 3300025919 Bacteria 9349
102 Ga0207657_10709943 3300025919 Bacteria 781
103 Ga0207652_10253484 3300025921 Bacteria 1587
104 Ga0207646_10081349 3300025922 Bacteria 2896
105 Ga0207646_10230255 3300025922 Bacteria 1674
106 Ga0207700_10249333 3300025928 Bacteria 1516
107 Ga0207700_10463000 3300025928 Bacteria 1119
108 Ga0207664_10033158 3300025929 Bacteria 3965
109 Ga0207664_10080305 3300025929 Bacteria 2650
110 Ga0207664_10351385 3300025929 Bacteria 1305
111 Ga0207664_10911408 3300025929 Bacteria 789
112 Ga0207686_10045955 3300025934 Bacteria 2690
113 Ga0207665_10000298 3300025939 Bacteria 34286
114 Ga0207661_10065112 3300025944 Bacteria 2958
115 Ga0207661_10103761 3300025944 Bacteria 2393
116 Ga0207679_10746615 3300025945 Bacteria 890
117 Ga0207667_10077526 3300025949 Bacteria 3446
118 Ga0207667_10129385 3300025949 Bacteria 2600
119 Ga0207667_10499775 3300025949 Bacteria 1234
120 Ga0207658_10011754 3300025986 Bacteria 5962
121 Ga0207708_10792147 3300026075 Bacteria 815
122 Ga0207702_10118474 3300026078 Bacteria 2366
123 Ga0207641_10162471 3300026088 Bacteria 2032
124 Ga0207683_10387556 3300026121 Unclassified 1285
125 Ga0207428_10087258 3300027907 Bacteria 2428
126 Ga0265337_1047603 3300028556 Bacteria 1215
127 Ga0265319_1002774 3300028563 Bacteria 9394
128 Ga0265334_10014298 3300028573 Bacteria 3309
129 Ga0265318_10003944 3300028577 Bacteria 7310
130 Ga0265323_10034559 3300028653 Bacteria 1867
131 Ga0265338_10010718 3300028800 Bacteria 10701
132 Ga0265338_10021554 3300028800 Bacteria 6713
133 Ga0265338_10029936 3300028800 Bacteria 5382
134 Ga0265338_10117772 3300028800 Bacteria 2124
135 Ga0265338_10144298 3300028800 Bacteria 1859
136 Ga0265338_10377477 3300028800 Bacteria 1014
137 Ga0265324_10028398 3300029957 Bacteria 1973
138 Ga0265330_10002948 3300031235 Bacteria 9061
139 Ga0265332_10007165 3300031238 Bacteria 5050
140 Ga0265328_10003265 3300031239 Bacteria 7183
141 Ga0265320_10019699 3300031240 Bacteria 3680
142 Ga0265320_10212624 3300031240 Bacteria 862
143 Ga0265325_10007753 3300031241 Bacteria 6396
144 Ga0265329_10007171 3300031242 Bacteria 4337
145 Ga0265340_10013668 3300031247 Bacteria 4258
146 Ga0265339_10022866 3300031249 Bacteria 3616
147 Ga0265339_10206849 3300031249 Bacteria 965
148 Ga0265331_10002190 3300031250 Bacteria 13410
149 Ga0265327_10020276 3300031251 Bacteria 4056
150 Ga0265313_10016140 3300031595 Bacteria 4308
151 Ga0265314_10019871 3300031711 Bacteria 5194
152 Ga0265314_10274064 3300031711 Bacteria 957
153 Ga0265342_10013765 3300031712 Bacteria 5403
154 Ga0265342_10178024 3300031712 Bacteria 1166
155 Ga0307405_10468797 3300031731 Bacteria 1003
156 Ga0307416_100103605 3300032002 Bacteria 2485
157 Ga0307416_100187038 3300032002 Bacteria 1948
158 Ga0307416_100519864 3300032002 Bacteria 1258
159 Ga0307415_100267408 3300032126 Bacteria 1399
160 Ga0307415_100389388 3300032126 Bacteria 1186
161 Ga0373926_0166125 3300035083 Bacteria 844
162 Ga0373944_0037670 3300035089 Unclassified 1482
163 Ga0373932_0087745 3300035112 Bacteria 993
164 Ga0373943_0138511 3300035170 Bacteria 1309
165 Ga0373946_0069098 3300035171 Unclassified 1521
166 Ga0373927_0016990 3300035695 Bacteria 4795
167 Ga0373927_0031917 3300035695 Bacteria 3431
168 Ga0373947_0002822 3300035725 Bacteria 10377
169 Ga0373947_0045073 3300035725 Bacteria 2638
170 Ga0373937_0068263 3300036401 Bacteria 3277
171 Ga0373925_0074268 3300037068 Bacteria 2575
172 Ga0395899_0067372 3300037312 Bacteria 2627
173 Ga0395899_0196794 3300037312 Bacteria 1408
174 Ga0395899_0345324 3300037312 Bacteria 997
175 Ga0395900_0021816 3300037418 Bacteria 6547
176 Ga0395900_0031347 3300037418 Bacteria 5461
177 Ga0395900_0059572 3300037418 Bacteria 3931
178 Ga0395900_0196499 3300037418 Bacteria 2043
179 Ga0395898_0050442 3300037466 Bacteria 4072
180 Ga0395898_0108372 3300037466 Bacteria 2663
181 Ga0395898_0115210 3300037466 Bacteria 2575
182 Ga0395898_0380398 3300037466 Bacteria 1346
183 Ga0395898_0381939 3300037466 Bacteria 1343
184 Ga0395898_1087288 3300037466 Bacteria 733
185 Ga0395905_0306045 3300037471 Bacteria 1477
186 Ga0395905_1099067 3300037471 Bacteria 698
187 Ga0436364_0692116 3300037853 Unclassified 1549
188 Ga0395901_0078796 3300038443 Bacteria 3440
189 Ga0395901_0098977 3300038443 Bacteria 3057
190 Ga0395901_0189928 3300038443 Bacteria 2154
191 Ga0395901_0197302 3300038443 Bacteria 2110
192 Ga0395901_0289742 3300038443 Bacteria 1699
193 Ga0395901_0461090 3300038443 Bacteria 1298
194 Ga0395901_0531438 3300038443 Bacteria 1194
195 Ga0395901_1054508 3300038443 Bacteria 786
196 Ga0395901_1101936 3300038443 Bacteria 764
197 Ga0436360_0957884 3300039438 Bacteria 3610
198 Ga0466966_0136242 3300044684 Bacteria 1501
199 Ga0466961_0004090 3300044693 Bacteria 9112
200 Ga0466961_0068441 3300044693 Bacteria 2254
201 Ga0466963_0003018 3300044694 Bacteria 9523
202 Ga0466963_0008526 3300044694 Bacteria 6150
203 Ga0466963_0014393 3300044694 Bacteria 4876
204 Ga0466963_0027766 3300044694 Bacteria 3627
205 Ga0466963_0395495 3300044694 Bacteria 974
206 Ga0466963_0399927 3300044694 Unclassified 968
207 Ga0466964_0004247 3300044706 Bacteria 5275
208 Ga0466964_0012423 3300044706 Bacteria 3221
209 Ga0466964_0077048 3300044706 Bacteria 1423
210 Ga0466964_0303518 3300044706 Bacteria 805
211 Ga0466964_0332524 3300044706 Bacteria 775
212 Ga0466971_0000555 3300044719 Bacteria 14768
213 Ga0466971_0153739 3300044719 Bacteria 1075
214 Ga0466968_0006705 3300044735 Bacteria 4350
215 Ga0466968_0012996 3300044735 Bacteria 3267
216 Ga0466968_0348074 3300044735 Bacteria 719
217 Ga0466970_0004569 3300044765 Bacteria 6831
218 Ga0466957_0004128 3300044842 Bacteria 8047
219 Ga0466957_0020851 3300044842 Bacteria 3856
220 Ga0466960_0015301 3300044901 Bacteria 3304
221 Ga0466960_0181849 3300044901 Bacteria 1140
222 Ga0466959_0002041 3300045049 Bacteria 12763
223 Ga0466959_0053033 3300045049 Bacteria 2966
224 Ga0466959_0073509 3300045049 Bacteria 2473
225 Ga0466958_0005246 3300045836 Bacteria 6945
226 Ga0466958_0007604 3300045836 Bacteria 5968
227 Ga0466967_0000047 3300045976 Bacteria 43648
228 Ga0466967_0007140 3300045976 Bacteria 8017
229 Ga0466967_0017679 3300045976 Bacteria 5671
230 Ga0466967_0025194 3300045976 Bacteria 4902
231 Ga0466967_0042625 3300045976 Bacteria 3923
232 Ga0466967_0087556 3300045976 Bacteria 2824
233 Ga0466967_0136095 3300045976 Bacteria 2284
234 Ga0466967_0147669 3300045976 Bacteria 2194
235 Ga0466967_0147870 3300045976 Bacteria 2193
236 Ga0466967_0166144 3300045976 Bacteria 2074
237 Ga0466967_0191586 3300045976 Bacteria 1932
238 Ga0466967_0227790 3300045976 Bacteria 1773
239 Ga0466967_0501146 3300045976 Bacteria 1192
240 Ga0466967_0548799 3300045976 Bacteria 1137
241 Ga0466967_0672055 3300045976 Bacteria 1025
242 Ga0466967_0713381 3300045976 Bacteria 994
243 Ga0466967_1343438 3300045976 Bacteria 712
244 Ga0495592_0130130 3300046454 Bacteria 1761
245 Ga0495603_0208070 3300046455 Bacteria 1130
246 Ga0495629_0010744 3300046459 Bacteria 6660
247 Ga0495629_0382784 3300046459 Bacteria 957
248 Ga0495629_0416098 3300046459 Bacteria 912
249 Ga0495629_0677592 3300046459 Bacteria 686
250 Ga0495641_0023330 3300046461 Bacteria 3076
251 Ga0495641_0062243 3300046461 Bacteria 1684
252 Ga0495641_0344922 3300046461 Bacteria 673
253 Ga0495651_0047713 3300046462 Bacteria 3309
254 Ga0495653_0063162 3300046463 Bacteria 2796
255 Ga0495580_0035207 3300046472 Bacteria 3601
256 Ga0495582_0005430 3300046473 Bacteria 7114
257 Ga0495582_0008439 3300046473 Bacteria 5683
258 Ga0495582_0022656 3300046473 Bacteria 3437
259 Ga0495582_0068034 3300046473 Bacteria 1969
260 Ga0495605_0180368 3300046474 Bacteria 929
261 Ga0495639_0112392 3300046475 Unclassified 1294
262 Ga0495662_0186150 3300046476 Bacteria 1023
263 Ga0495664_0047185 3300046477 Bacteria 2555
264 Ga0495664_0131833 3300046477 Bacteria 1513
265 Ga0495584_0230830 3300046491 Unclassified 941
266 Ga0495585_0108239 3300046492 Unclassified 1481
267 Ga0495608_0024496 3300046511 Bacteria 4125
268 Ga0495608_0052240 3300046511 Bacteria 2706
269 Ga0495618_0035128 3300046514 Bacteria 3146
270 Ga0495618_0497707 3300046514 Bacteria 735
271 Ga0495628_0146970 3300046516 Bacteria 1797
272 Ga0495628_0455478 3300046516 Bacteria 929
273 Ga0495630_0002254 3300046517 Bacteria 13428
274 Ga0495630_0183637 3300046517 Bacteria 1595
275 Ga0495631_0058235 3300046518 Unclassified 1681
276 Ga0495666_0006203 3300046526 Bacteria 6017
277 Ga0495652_0107839 3300046529 Bacteria 2246
278 Ga0495652_0123303 3300046529 Bacteria 2063
279 Ga0495665_0009759 3300046531 Bacteria 5197
280 Ga0495640_0209303 3300046533 Bacteria 1233
281 Ga0495645_0140380 3300046543 Bacteria 1686
282 Ga0495633_0144417 3300046558 Bacteria 1100
283 Ga0495667_0037758 3300046559 Bacteria 3218
284 Ga0495667_0051186 3300046559 Bacteria 2725
285 Ga0495634_0042741 3300046642 Bacteria 3073
286 Ga0495634_0227560 3300046642 Bacteria 1149
287 Ga0495634_0331382 3300046642 Bacteria 915
288 Ga0495635_0025127 3300046663 Bacteria 4149
289 Ga0495635_0117322 3300046663 Bacteria 1816
290 Ga0495659_0032445 3300046664 Bacteria 1828
291 Ga0495661_0060780 3300046665 Bacteria 2244
292 Ga0495657_0073772 3300046675 Bacteria 2221
293 Ga0495657_0224976 3300046675 Bacteria 1136
294 Ga0495599_0178617 3300046678 Bacteria 1309
295 Ga0495646_0050903 3300046680 Bacteria 2508
296 Ga0495647_0006574 3300046681 Bacteria 3856
297 Ga0495658_0012940 3300046683 Bacteria 4238
298 Ga0495613_0015459 3300046689 Bacteria 5674
299 Ga0495613_0055803 3300046689 Bacteria 2901
300 Ga0495613_0126224 3300046689 Bacteria 1835
301 Ga0495613_0168716 3300046689 Bacteria 1554
302 Ga0495624_0074775 3300046690 Bacteria 2104
303 Ga0495624_0135962 3300046690 Bacteria 1507
304 Ga0495670_0043563 3300046691 Bacteria 2240
305 Ga0495589_0092292 3300046794 Bacteria 1470
306 Ga0495600_0069314 3300046809 Bacteria 2305
307 Ga0495581_0069459 3300047315 Bacteria 2037
308 Ga0495581_0103588 3300047315 Bacteria 1653
309 Ga0495581_0382544 3300047315 Bacteria 821
310 Ga0495674_0003643 3300047319 Bacteria 14996
311 Ga0495674_0136632 3300047319 Bacteria 2062
312 Ga0495674_0144136 3300047319 Bacteria 2000
313 Ga0495674_0408812 3300047319 Bacteria 1095
314 Ga0495676_0150974 3300047321 Bacteria 1653
315 Ga0495680_0012253 3300047322 Bacteria 7557
316 Ga0495680_0022783 3300047322 Bacteria 5215
317 Ga0495680_0033474 3300047322 Bacteria 4160
318 Ga0495680_0248548 3300047322 Bacteria 1261
319 Ga0495675_0182005 3300047444 Bacteria 1286
320 Ga0495675_0201360 3300047444 Bacteria 1212
321 Ga0495677_0030009 3300047445 Bacteria 1978
322 Ga0495684_0018115 3300047471 Bacteria 5428
323 Ga0495684_0043477 3300047471 Bacteria 3439
324 Ga0495684_0066736 3300047471 Bacteria 2736
325 Ga0495684_0112493 3300047471 Bacteria 2053
326 Ga0495684_0156752 3300047471 Bacteria 1700
327 Ga0495593_0280650 3300047673 Bacteria 833
328 Ga0495602_0256222 3300048088 Bacteria 1301
329 Ga0495614_0046310 3300048089 Bacteria 1864
330 Ga0496100_0005094 3300048903 Bacteria 7036
331 Ga0496100_0031052 3300048903 Bacteria 3317
332 Ga0496100_0039845 3300048903 Bacteria 2985
333 Ga0496100_0077046 3300048903 Bacteria 2241
334 Ga0496100_0186804 3300048903 Bacteria 1502
335 Ga0496101_0001776 3300048904 Bacteria 12957
336 Ga0496101_0022797 3300048904 Bacteria 4315
337 Ga0496101_0311762 3300048904 Bacteria 1233
338 Ga0496101_0387182 3300048904 Bacteria 1100
339 Ga0496102_0025543 3300048905 Bacteria 5259
340 Ga0496102_0045612 3300048905 Bacteria 3980
341 Ga0496102_0063387 3300048905 Bacteria 3384
342 Ga0496102_0204303 3300048905 Bacteria 1862
343 Ga0496103_0034836 3300048906 Bacteria 3080
344 Ga0496103_0162447 3300048906 Bacteria 1433
345 Ga0496104_0001249 3300048907 Bacteria 21900
346 Ga0496104_0033457 3300048907 Bacteria 4788
347 Ga0496104_0459984 3300048907 Unclassified 1184
348 Ga0496104_0518882 3300048907 Bacteria 1103
349 Ga0496105_0010671 3300048908 Bacteria 7226
350 Ga0496105_0044877 3300048908 Bacteria 3646
351 Ga0496105_0223285 3300048908 Bacteria 1533
352 Ga0496106_0002971 3300048909 Bacteria 12620
353 Ga0496106_0003251 3300048909 Bacteria 12153
354 Ga0496106_0008521 3300048909 Bacteria 7582
355 Ga0496106_0097451 3300048909 Bacteria 2277
356 Ga0496107_0020331 3300048910 Bacteria 4688
357 Ga0496107_0027018 3300048910 Bacteria 4074
358 Ga0496107_0035335 3300048910 Bacteria 3583
359 Ga0496107_0060133 3300048910 Bacteria 2750
360 Ga0496107_0062008 3300048910 Bacteria 2708
361 Ga0496107_0263055 3300048910 Bacteria 1284
362 Ga0496108_0029953 3300048911 Bacteria 4511
363 Ga0496108_0102147 3300048911 Bacteria 2446
364 Ga0496109_0001252 3300048912 Bacteria 21083
365 Ga0496109_0009108 3300048912 Bacteria 8453
366 Ga0496109_0131188 3300048912 Bacteria 2339
367 Ga0496109_0202061 3300048912 Bacteria 1868
368 Ga0496109_0204237 3300048912 Bacteria 1858
369 Ga0496110_0321938 3300048913 Bacteria 1408
370 Ga0496111_0005331 3300048914 Bacteria 8219
371 Ga0496111_0161822 3300048914 Bacteria 1662
372 Ga0496111_0175878 3300048914 Bacteria 1591
373 Ga0496112_0000390 3300048915 Bacteria 28702
374 Ga0496112_0069780 3300048915 Bacteria 3471
375 Ga0496112_0215805 3300048915 Bacteria 1875
376 Ga0496112_0284659 3300048915 Bacteria 1599
377 Ga0496112_0432826 3300048915 Bacteria 1254
378 Ga0496113_0168193 3300048916 Bacteria 1735
379 Ga0496113_0434724 3300048916 Bacteria 1054
380 Ga0496113_0516289 3300048916 Bacteria 959
381 Ga0496113_0550584 3300048916 Bacteria 925
382 Ga0496114_0028786 3300048917 Bacteria 4562
383 Ga0496114_0094700 3300048917 Bacteria 2540
384 Ga0496114_0660126 3300048917 Unclassified 919
385 Ga0496114_1139296 3300048917 Bacteria 665
386 Ga0496115_0017076 3300048918 Bacteria 5536
387 Ga0496115_0045607 3300048918 Bacteria 3500
388 Ga0496115_0114379 3300048918 Bacteria 2218
389 Ga0496115_0151852 3300048918 Unclassified 1913
390 Ga0496115_0253116 3300048918 Bacteria 1449
391 Ga0496115_0666388 3300048918 Bacteria 821
392 Ga0501031_0027246 3300049568 Bacteria 3726
393 Ga0501032_0222729 3300049569 Bacteria 1227
394 Ga0501033_0063776 3300049570 Bacteria 2711
395 Ga0501034_0079251 3300049571 Bacteria 3288
396 Ga0501034_0175979 3300049571 Bacteria 2106
397 Ga0501034_0186183 3300049571 Bacteria 2040
398 Ga0501036_0013136 3300049572 Bacteria 6878
399 Ga0501036_0039209 3300049572 Bacteria 4010
400 Ga0501037_0000205 3300049573 Bacteria 53176
401 Ga0501037_0058528 3300049573 Bacteria 2811
402 Ga0501037_0059980 3300049573 Bacteria 2775
403 Ga0501038_0000956 3300049574 Bacteria 25825
404 Ga0501038_0095557 3300049574 Bacteria 2482
405 Ga0501039_0000149 3300049575 Bacteria 47666
406 Ga0501039_0017593 3300049575 Bacteria 5483
407 Ga0501039_0041478 3300049575 Bacteria 3555
408 Ga0501040_0000582 3300049576 Bacteria 22247
409 Ga0501040_0003965 3300049576 Bacteria 9616
410 Ga0501040_0036096 3300049576 Bacteria 3353
411 Ga0501040_0843343 3300049576 Bacteria 663
412 Ga0501041_0000273 3300049577 Bacteria 24565
413 Ga0501041_0018630 3300049577 Bacteria 4134
414 Ga0501042_0000079 3300049578 Bacteria 36581
415 Ga0501042_0007505 3300049578 Bacteria 7148
416 Ga0501042_0023771 3300049578 Bacteria 4292
417 Ga0501043_0000217 3300049579 Bacteria 52111
418 Ga0501043_0248506 3300049579 Unclassified 1370
419 Ga0501046_0006443 3300049580 Bacteria 10393
420 Ga0501046_0016443 3300049580 Bacteria 6196
421 Ga0501046_0067721 3300049580 Bacteria 2780
422 Ga0501046_0112693 3300049580 Bacteria 2076
423 Ga0501047_0010164 3300049581 Bacteria 8898
424 Ga0501047_0075237 3300049581 Bacteria 3249
425 Ga0501047_0201988 3300049581 Bacteria 1849
426 Ga0501048_0000664 3300049582 Bacteria 24852
427 Ga0501048_0059994 3300049582 Bacteria 2695
428 Ga0501067_0006911 3300049583 Bacteria 6297
429 Ga0501067_0007827 3300049583 Bacteria 5942
430 Ga0501067_0009461 3300049583 Bacteria 5400
431 Ga0501067_0200628 3300049583 Bacteria 1111
432 Ga0501068_0007394 3300049584 Bacteria 6081
433 Ga0501068_0043726 3300049584 Bacteria 2695
434 Ga0501068_0129238 3300049584 Bacteria 1579
435 Ga0501069_0004707 3300049585 Bacteria 7051
436 Ga0501069_0013546 3300049585 Bacteria 4348
437 Ga0501069_0066601 3300049585 Bacteria 2014
438 Ga0501070_0007902 3300049586 Bacteria 9011
439 Ga0501070_0189102 3300049586 Bacteria 1693
440 Ga0501070_0213300 3300049586 Bacteria 1584
441 Ga0501071_0010977 3300049587 Bacteria 6081
442 Ga0501071_0026574 3300049587 Bacteria 4064
443 Ga0501072_0000248 3300049588 Bacteria 39794
444 Ga0501072_0030495 3300049588 Bacteria 4218
445 Ga0501072_0263929 3300049588 Unclassified 1370
446 Ga0501072_0977467 3300049588 Bacteria 660
447 Ga0501073_0001108 3300049589 Bacteria 19540
448 Ga0501073_0081783 3300049589 Bacteria 2246
449 Ga0501074_0001857 3300049590 Bacteria 14490
450 Ga0501074_0012614 3300049590 Bacteria 6145
451 Ga0501074_0065621 3300049590 Bacteria 2612
452 Ga0501074_0985558 3300049590 Bacteria 593
453 Ga0501075_0000070 3300049591 Bacteria 45029
454 Ga0501075_0004181 3300049591 Bacteria 9744
455 Ga0501075_0069892 3300049591 Bacteria 2653
456 Ga0501075_0348299 3300049591 Bacteria 1129
457 Ga0501076_0000331 3300049592 Bacteria 29298
458 Ga0501076_0001780 3300049592 Bacteria 14601
459 Ga0501076_0064760 3300049592 Bacteria 2913
460 Ga0501076_0575129 3300049592 Unclassified 929
461 Ga0501077_0011702 3300049593 Bacteria 5483
462 Ga0501077_0036978 3300049593 Bacteria 3110
463 Ga0501079_0000491 3300049741 Bacteria 25889
464 Ga0501079_0027577 3300049741 Bacteria 4356
465 Ga0501079_0255238 3300049741 Unclassified 1370
466 Ga0501079_0619158 3300049741 Bacteria 852
467 Ga0501080_0052528 3300049742 Bacteria 3793
468 Ga0501080_0184214 3300049742 Bacteria 1920
469 Ga0501080_0333861 3300049742 Unclassified 1370
470 Ga0501080_1666274 3300049742 Bacteria 539
471 Ga0501081_0000415 3300049743 Bacteria 23526
472 Ga0501081_0002056 3300049743 Bacteria 12553
473 Ga0501081_0026422 3300049743 Bacteria 3914
474 Ga0501081_0073703 3300049743 Bacteria 2381
475 Ga0501083_0000086 3300049744 Bacteria 63536
476 Ga0501083_0002795 3300049744 Bacteria 12067
477 Ga0501083_0480721 3300049744 Bacteria 808
478 Ga0501035_0000437 3300049822 Bacteria 46759
479 Ga0501035_0293914 3300049822 Unclassified 1370
480 Ga0501044_0013262 3300049823 Bacteria 8922
481 Ga0501044_0084651 3300049823 Bacteria 3204
482 Ga0501045_0020953 3300049824 Bacteria 4673
483 Ga0501045_0048273 3300049824 Bacteria 3103
484 Ga0501045_0339770 3300049824 Unclassified 1117
485 nmdc:mga05p37_45049_c1 3300050507 Bacteria 5426
486 nmdc:mga09592_318930_c1 3300050508 Bacteria 1346
487 nmdc:mga06r32_914134_c1 3300050510 Bacteria 833
488 nmdc:mga08y16_275040_c1 3300050511 Bacteria 1738
489 nmdc:mga0n895_243305_c1 3300050512 Bacteria 1826
490 nmdc:mga0n895_35535_c1 3300050512 Bacteria 4805
491 nmdc:mga0n895_995228_c1 3300050512 Bacteria 820
492 nmdc:mga0rr50_301926_c1 3300050513 Bacteria 1339
493 nmdc:mga0rr50_40691_c1 3300050513 Bacteria 3381
494 nmdc:mga0a205_882377_c1 3300050515 Bacteria 741
495 Ga0495601_0008711 3300053077 Bacteria 5987
496 Ga0495601_0193717 3300053077 Bacteria 1328
497 Ga0495601_0225728 3300053077 Bacteria 1223
498 Ga0495601_0303991 3300053077 Bacteria 1039
499 Ga0495595_0146274 3300053084 Bacteria 1161
500 Ga0495595_0337937 3300053084 Bacteria 759
501 Ga0495619_0029133 3300053085 Bacteria 3565
502 Ga0495619_0048672 3300053085 Bacteria 2794
503 Ga0501084_0004694 3300054114 Bacteria 11160
504 Ga0501084_0006490 3300054114 Bacteria 9616
505 Ga0501084_0169757 3300054114 Bacteria 1841
506 Ga0501084_0560693 3300054114 Unclassified 965
507 Ga0501082_0003562 3300060353 Bacteria 13594
508 Ga0501082_0007158 3300060353 Bacteria 9616
509 Ga0501082_0035624 3300060353 Bacteria 4289
510 Ga0501082_0333581 3300060353 Bacteria 1321
511 Ga0466962_0002542 3300061719 Bacteria 8655
512 Ga0530510_0056307 3300061734 Bacteria 2840
513 Ga0530510_0117735 3300061734 Bacteria 1949
514 Ga0530510_0232798 3300061734 Unclassified 1370
515 Ga0530510_0256390 3300061734 Bacteria 1304
516 Ga0530510_0802343 3300061734 Bacteria 718
517 Ga0501036_1047325
518 Ga0070658_10046459
519 Ga0070658_10053095
520 Ga0070683_100108265
521 Ga0070683_100405810
522 Ga0070680_100314736
523 Ga0070682_100104369
524 Ga0070682_100174607
525 Ga0070682_100184508
526 Ga0070660_100006196
527 Ga0070660_100086865
528 Ga0070675_100926083
529 Ga0070671_100046429
530 Ga0070659_100145072
531 Ga0070709_10069822
532 Ga0070714_100339905
533 Ga0070714_100472324
534 Ga0070713_100117613
535 Ga0070710_10016474
536 Ga0070705_101010171
537 Ga0070694_100241786
538 Ga0070708_100472802
539 Ga0070678_100270747
540 Ga0070681_10159049
541 Ga0070706_100376312
542 Ga0070707_100206290
543 Ga0070707_100300525
544 Ga0070698_100944171
545 Ga0070679_100312866
546 Ga0070679_100331116
547 Ga0070679_100351168
548 Ga0070704_100054281
549 Ga0068855_100028541
550 Ga0068855_100198617
551 Ga0068855_100432788
552 Ga0070664_100721274
553 Ga0068856_100081297
554 Ga0068856_100087201
555 Ga0068852_100207471
556 Ga0068864_100193535
557 Ga0068863_100307184
558 Ga0070717_10001105
559 Ga0070717_10017184
560 Ga0070717_10266972
561 Ga0070717_10980370
562 Ga0075365_10079033
563 Ga0070715_10000878
564 Ga0070716_100005870
565 Ga0070712_100166358
566 Ga0068871_100398724
567 Ga0075428_100722145
568 Ga0075434_100005305
569 Ga0075434_100262991
570 Ga0068865_100896379
571 Ga0075435_100008806
572 Ga0105240_10351531
573 Ga0111539_10047952
574 Ga0105245_10306700
575 Ga0105245_10608028
576 Ga0105247_10049407
577 Ga0114129_10237328
578 Ga0114129_10964580
579 Ga0114129_11914124
580 Ga0105242_10104232
581 Ga0105242_11774919
582 Ga0105237_10253696
583 Ga0105238_10521496
584 Ga0157373_10115004
585 Ga0157370_10096209
586 Ga0157369_10156737
587 Ga0157369_10736517
588 Ga0157374_10142715
589 Ga0157378_10306249
590 Ga0163162_10389392
591 Ga0157375_10652404
592 Ga0157379_10233394
593 Ga0157376_10026968
594 Ga0206356_10454879
595 Ga0206353_10601416
596 Ga0206353_11268266
597 Ga0206353_11975521
598 Ga0213875_10074318
599 Ga0213871_10004038
600 Ga0207692_10016562
601 Ga0207710_10084172
602 Ga0207685_10030864
603 Ga0207699_10072929
604 Ga0207643_10269268
605 Ga0207705_10039420
606 Ga0207705_10111743
607 Ga0207705_10123399
608 Ga0207684_10136564
609 Ga0207684_10284001
610 Ga0207654_10318180
611 Ga0207707_10154780
612 Ga0207695_10229842
613 Ga0207671_10079901
614 Ga0207693_10019525
615 Ga0207663_10074701
616 Ga0207657_10002960
617 Ga0207657_10010261
618 Ga0207657_10709943
619 Ga0207652_10253484
620 Ga0207646_10081349
621 Ga0207646_10230255
622 Ga0207700_10249333
623 Ga0207700_10463000
624 Ga0207664_10033158
625 Ga0207664_10080305
626 Ga0207664_10351385
627 Ga0207664_10911408
628 Ga0207686_10045955
629 Ga0207665_10000298
630 Ga0207661_10065112
631 Ga0207661_10103761
632 Ga0207679_10746615
633 Ga0207667_10077526
634 Ga0207667_10129385
635 Ga0207667_10499775
636 Ga0207658_10011754
637 Ga0207708_10792147
638 Ga0207702_10118474
639 Ga0207641_10162471
640 Ga0207683_10387556
641 Ga0207428_10087258
642 Ga0265337_1047603
643 Ga0265319_1002774
644 Ga0265334_10014298
645 Ga0265318_10003944
646 Ga0265323_10034559
647 Ga0265338_10010718
648 Ga0265338_10021554
649 Ga0265338_10029936
650 Ga0265338_10117772
651 Ga0265338_10144298
652 Ga0265338_10377477
653 Ga0265324_10028398
654 Ga0265330_10002948
655 Ga0265332_10007165
656 Ga0265328_10003265
657 Ga0265320_10019699
658 Ga0265320_10212624
659 Ga0265325_10007753
660 Ga0265329_10007171
661 Ga0265340_10013668
662 Ga0265339_10022866
663 Ga0265339_10206849
664 Ga0265331_10002190
665 Ga0265327_10020276
666 Ga0265313_10016140
667 Ga0265314_10019871
668 Ga0265314_10274064
669 Ga0265342_10013765
670 Ga0265342_10178024
671 Ga0307405_10468797
672 Ga0307416_100103605
673 Ga0307416_100187038
674 Ga0307416_100519864
675 Ga0307415_100267408
676 Ga0307415_100389388
677 Ga0373926_0166125
678 Ga0373944_0037670
679 Ga0373932_0087745
680 Ga0373943_0138511
681 Ga0373946_0069098
682 Ga0373927_0016990
683 Ga0373927_0031917
684 Ga0373947_0002822
685 Ga0373947_0045073
686 Ga0373937_0068263
687 Ga0373925_0074268
688 Ga0395899_0067372
689 Ga0395899_0196794
690 Ga0395899_0345324
691 Ga0395900_0021816
692 Ga0395900_0031347
693 Ga0395900_0059572
694 Ga0395900_0196499
695 Ga0395898_0050442
696 Ga0395898_0108372
697 Ga0395898_0115210
698 Ga0395898_0380398
699 Ga0395898_0381939
700 Ga0395898_1087288
701 Ga0395905_0306045
702 Ga0395905_1099067
703 Ga0436364_0692116
704 Ga0395901_0078796
705 Ga0395901_0098977
706 Ga0395901_0189928
707 Ga0395901_0197302
708 Ga0395901_0289742
709 Ga0395901_0461090
710 Ga0395901_0531438
711 Ga0395901_1054508
712 Ga0395901_1101936
713 Ga0436360_0957884
714 Ga0466966_0136242
715 Ga0466961_0004090
716 Ga0466961_0068441
717 Ga0466963_0003018
718 Ga0466963_0008526
719 Ga0466963_0014393
720 Ga0466963_0027766
721 Ga0466963_0395495
722 Ga0466963_0399927
723 Ga0466964_0004247
724 Ga0466964_0012423
725 Ga0466964_0077048
726 Ga0466964_0303518
727 Ga0466964_0332524
728 Ga0466971_0000555
729 Ga0466971_0153739
730 Ga0466968_0006705
731 Ga0466968_0012996
732 Ga0466968_0348074
733 Ga0466970_0004569
734 Ga0466957_0004128
735 Ga0466957_0020851
736 Ga0466960_0015301
737 Ga0466960_0181849
738 Ga0466959_0002041
739 Ga0466959_0053033
740 Ga0466959_0073509
741 Ga0466958_0005246
742 Ga0466958_0007604
743 Ga0466967_0000047
744 Ga0466967_0007140
745 Ga0466967_0017679
746 Ga0466967_0025194
747 Ga0466967_0042625
748 Ga0466967_0087556
749 Ga0466967_0136095
750 Ga0466967_0147669
751 Ga0466967_0147870
752 Ga0466967_0166144
753 Ga0466967_0191586
754 Ga0466967_0227790
755 Ga0466967_0501146
756 Ga0466967_0548799
757 Ga0466967_0672055
758 Ga0466967_0713381
759 Ga0466967_1343438
760 Ga0495592_0130130
761 Ga0495603_0208070
762 Ga0495629_0010744
763 Ga0495629_0382784
764 Ga0495629_0416098
765 Ga0495629_0677592
766 Ga0495641_0023330
767 Ga0495641_0062243
768 Ga0495641_0344922
769 Ga0495651_0047713
770 Ga0495653_0063162
771 Ga0495580_0035207
772 Ga0495582_0005430
773 Ga0495582_0008439
774 Ga0495582_0022656
775 Ga0495582_0068034
776 Ga0495605_0180368
777 Ga0495639_0112392
778 Ga0495662_0186150
779 Ga0495664_0047185
780 Ga0495664_0131833
781 Ga0495584_0230830
782 Ga0495585_0108239
783 Ga0495608_0024496
784 Ga0495608_0052240
785 Ga0495618_0035128
786 Ga0495618_0497707
787 Ga0495628_0146970
788 Ga0495628_0455478
789 Ga0495630_0002254
790 Ga0495630_0183637
791 Ga0495631_0058235
792 Ga0495666_0006203
793 Ga0495652_0107839
794 Ga0495652_0123303
795 Ga0495665_0009759
796 Ga0495640_0209303
797 Ga0495645_0140380
798 Ga0495633_0144417
799 Ga0495667_0037758
800 Ga0495667_0051186
801 Ga0495634_0042741
802 Ga0495634_0227560
803 Ga0495634_0331382
804 Ga0495635_0025127
805 Ga0495635_0117322
806 Ga0495659_0032445
807 Ga0495661_0060780
808 Ga0495657_0073772
809 Ga0495657_0224976
810 Ga0495599_0178617
811 Ga0495646_0050903
812 Ga0495647_0006574
813 Ga0495658_0012940
814 Ga0495613_0015459
815 Ga0495613_0055803
816 Ga0495613_0126224
817 Ga0495613_0168716
818 Ga0495624_0074775
819 Ga0495624_0135962
820 Ga0495670_0043563
821 Ga0495589_0092292
822 Ga0495600_0069314
823 Ga0495581_0069459
824 Ga0495581_0103588
825 Ga0495581_0382544
826 Ga0495674_0003643
827 Ga0495674_0136632
828 Ga0495674_0144136
829 Ga0495674_0408812
830 Ga0495676_0150974
831 Ga0495680_0012253
832 Ga0495680_0022783
833 Ga0495680_0033474
834 Ga0495680_0248548
835 Ga0495675_0182005
836 Ga0495675_0201360
837 Ga0495677_0030009
838 Ga0495684_0018115
839 Ga0495684_0043477
840 Ga0495684_0066736
841 Ga0495684_0112493
842 Ga0495684_0156752
843 Ga0495593_0280650
844 Ga0495602_0256222
845 Ga0495614_0046310
846 Ga0496100_0005094
847 Ga0496100_0031052
848 Ga0496100_0039845
849 Ga0496100_0077046
850 Ga0496100_0186804
851 Ga0496101_0001776
852 Ga0496101_0022797
853 Ga0496101_0311762
854 Ga0496101_0387182
855 Ga0496102_0025543
856 Ga0496102_0045612
857 Ga0496102_0063387
858 Ga0496102_0204303
859 Ga0496103_0034836
860 Ga0496103_0162447
861 Ga0496104_0001249
862 Ga0496104_0033457
863 Ga0496104_0459984
864 Ga0496104_0518882
865 Ga0496105_0010671
866 Ga0496105_0044877
867 Ga0496105_0223285
868 Ga0496106_0002971
869 Ga0496106_0003251
870 Ga0496106_0008521
871 Ga0496106_0097451
872 Ga0496107_0020331
873 Ga0496107_0027018
874 Ga0496107_0035335
875 Ga0496107_0060133
876 Ga0496107_0062008
877 Ga0496107_0263055
878 Ga0496108_0029953
879 Ga0496108_0102147
880 Ga0496109_0001252
881 Ga0496109_0009108
882 Ga0496109_0131188
883 Ga0496109_0202061
884 Ga0496109_0204237
885 Ga0496110_0321938
886 Ga0496111_0005331
887 Ga0496111_0161822
888 Ga0496111_0175878
889 Ga0496112_0000390
890 Ga0496112_0069780
891 Ga0496112_0215805
892 Ga0496112_0284659
893 Ga0496112_0432826
894 Ga0496113_0168193
895 Ga0496113_0434724
896 Ga0496113_0516289
897 Ga0496113_0550584
898 Ga0496114_0028786
899 Ga0496114_0094700
900 Ga0496114_0660126
901 Ga0496114_1139296
902 Ga0496115_0017076
903 Ga0496115_0045607
904 Ga0496115_0114379
905 Ga0496115_0151852
906 Ga0496115_0253116
907 Ga0496115_0666388
908 Ga0501031_0027246
909 Ga0501032_0222729
910 Ga0501033_0063776
911 Ga0501034_0079251
912 Ga0501034_0175979
913 Ga0501034_0186183
914 Ga0501036_0013136
915 Ga0501036_0039209
916 Ga0501037_0000205
917 Ga0501037_0058528
918 Ga0501037_0059980
919 Ga0501038_0000956
920 Ga0501038_0095557
921 Ga0501039_0000149
922 Ga0501039_0017593
923 Ga0501039_0041478
924 Ga0501040_0000582
925 Ga0501040_0003965
926 Ga0501040_0036096
927 Ga0501040_0843343
928 Ga0501041_0000273
929 Ga0501041_0018630
930 Ga0501042_0000079
931 Ga0501042_0007505
932 Ga0501042_0023771
933 Ga0501043_0000217
934 Ga0501043_0248506
935 Ga0501046_0006443
936 Ga0501046_0016443
937 Ga0501046_0067721
938 Ga0501046_0112693
939 Ga0501047_0010164
940 Ga0501047_0075237
941 Ga0501047_0201988
942 Ga0501048_0000664
943 Ga0501048_0059994
944 Ga0501067_0006911
945 Ga0501067_0007827
946 Ga0501067_0009461
947 Ga0501067_0200628
948 Ga0501068_0007394
949 Ga0501068_0043726
950 Ga0501068_0129238
951 Ga0501069_0004707
952 Ga0501069_0013546
953 Ga0501069_0066601
954 Ga0501070_0007902
955 Ga0501070_0189102
956 Ga0501070_0213300
957 Ga0501071_0010977
958 Ga0501071_0026574
959 Ga0501072_0000248
960 Ga0501072_0030495
961 Ga0501072_0263929
962 Ga0501072_0977467
963 Ga0501073_0001108
964 Ga0501073_0081783
965 Ga0501074_0001857
966 Ga0501074_0012614
967 Ga0501074_0065621
968 Ga0501074_0985558
969 Ga0501075_0000070
970 Ga0501075_0004181
971 Ga0501075_0069892
972 Ga0501075_0348299
973 Ga0501076_0000331
974 Ga0501076_0001780
975 Ga0501076_0064760
976 Ga0501076_0575129
977 Ga0501077_0011702
978 Ga0501077_0036978
979 Ga0501079_0000491
980 Ga0501079_0027577
981 Ga0501079_0255238
982 Ga0501079_0619158
983 Ga0501080_0052528
984 Ga0501080_0184214
985 Ga0501080_0333861
986 Ga0501080_1666274
987 Ga0501081_0000415
988 Ga0501081_0002056
989 Ga0501081_0026422
990 Ga0501081_0073703
991 Ga0501083_0000086
992 Ga0501083_0002795
993 Ga0501083_0480721
994 Ga0501035_0000437
995 Ga0501035_0293914
996 Ga0501044_0013262
997 Ga0501044_0084651
998 Ga0501045_0020953
999 Ga0501045_0048273
1000 Ga0501045_0339770
1001 nmdc:mga05p37_45049_c1
1002 nmdc:mga09592_318930_c1
1003 nmdc:mga06r32_914134_c1
1004 nmdc:mga08y16_275040_c1
1005 nmdc:mga0n895_243305_c1
1006 nmdc:mga0n895_35535_c1
1007 nmdc:mga0n895_995228_c1
1008 nmdc:mga0rr50_301926_c1
1009 nmdc:mga0rr50_40691_c1
1010 nmdc:mga0a205_882377_c1
1011 Ga0495601_0008711
1012 Ga0495601_0193717
1013 Ga0495601_0225728
1014 Ga0495601_0303991
1015 Ga0495595_0146274
1016 Ga0495595_0337937
1017 Ga0495619_0029133
1018 Ga0495619_0048672
1019 Ga0501084_0004694
1020 Ga0501084_0006490
1021 Ga0501084_0169757
1022 Ga0501084_0560693
1023 Ga0501082_0003562
1024 Ga0501082_0007158
1025 Ga0501082_0035624
1026 Ga0501082_0333581
1027 Ga0466962_0002542
1028 Ga0530510_0056307
1029 Ga0530510_0117735
1030 Ga0530510_0232798
1031 Ga0530510_0256390
1032 Ga0530510_0802343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

16

189

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9459 14 187
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9438 12 187
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9428 14 196
4yly-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9407 14 196
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9392 12 195
ID Description Score Start End Superfamily
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9428 14 196 3.40.50.1470
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9239 69 196 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9151 10 197 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.914 14 196 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9079 14 190 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A538GP38-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9974 14 147 GO:0004045
AF-A0A538GP38-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9828 14 147 GO:0004045
AF-A0A4Q3RK09-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9782 14 141 GO:0004045
AF-A0A0G1UTJ1-F1-model_v4 Peptidyl-tRNA hydrolase 0.9763 39 137 GO:0004045
AF-A0A519GXZ6-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9754 12 139 GO:0004045

Map