F458056

General Info

Members Datasets Scaffolds Average Seq Length
516 430 245 277

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0050445|Ga0496121_0050445_307_1203
Length 298
Sequence MSTANQHHRGTLAAAESAARNGTSXXXTAGSARDAGSTRFPLPRIDAAHAATLITILALLAGWWLASHLQWVPAVLLPPPETVIGKLAQLSTEGFDDATLGQHLFASLSRIALAFALALVTAIPAGLLIATNRIARGVLDPVIEFYRPIPPLAYLPLMVIWFGIGELSKVLLIYLTIFAPLTIATAAGASRVAKSRLLAAASLGATRYKLLRYVVLPSALPDILTGLRIALGAGWSTLVAAELIAATRGLGFMVYSASRFLVTDVVIAGILVIGAIALILELGLRWLQRKLTPWHAGH

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2512875024 Mesorhizobium loti R88b Isolate Nodule
12 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
13 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
14 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
15 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
16 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
17 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
20 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
21 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
22 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
23 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
24 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
25 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
26 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
27 2643221557 Ensifer sp. Root558 Isolate Unclassified
28 2643221568 Rhizobium sp. Root564 Isolate Unclassified
29 2643221607 Rhizobium sp. Root73 Isolate Unclassified
30 2643221610 Ensifer sp. Root74 Isolate Unclassified
31 2643221618 Ensifer sp. Root231 Isolate Unclassified
32 2643221626 Ensifer sp. Root31 Isolate Unclassified
33 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
34 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
35 2643221655 Ensifer sp. Root1252 Isolate Unclassified
36 2643221659 Ensifer sp. Root127 Isolate Unclassified
37 2643221668 Ensifer sp. Root423 Isolate Unclassified
38 2643221675 Ensifer sp. Root1298 Isolate Unclassified
39 2643221680 Ensifer sp. Root1312 Isolate Unclassified
40 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
41 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
42 2643221698 Ensifer sp. Root142 Isolate Unclassified
43 2643221712 Ensifer sp. Root258 Isolate Unclassified
44 2643221718 Rhizobium sp. Root268 Isolate Unclassified
45 2643221723 Ensifer sp. Root278 Isolate Unclassified
46 2643221726 Ensifer sp. Root954 Isolate Unclassified
47 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
48 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
49 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
50 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
51 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
52 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
53 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
54 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
55 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
56 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
57 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
58 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
59 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
60 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
61 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
62 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
63 2844163670 Ensifer sp. 1H6 Isolate Unclassified
64 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
65 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
66 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
67 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
68 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
69 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
70 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
71 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
72 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
73 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
74 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
75 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
76 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
77 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
78 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
79 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
80 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
81 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
82 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
83 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
84 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
85 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
86 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
87 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
88 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
89 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
90 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
91 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
92 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
93 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
94 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
95 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
96 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
97 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
98 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
99 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
100 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
101 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
102 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
103 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
104 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
105 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
106 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
107 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
108 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
109 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
110 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
111 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
112 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
113 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
114 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
115 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
116 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
117 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
118 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
119 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
120 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
121 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
122 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
123 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
124 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
125 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
126 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
127 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
128 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
129 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
130 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
131 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
132 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
133 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
134 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
135 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
136 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
137 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
138 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
139 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
140 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
141 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
142 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
143 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
144 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
145 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
146 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
147 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
148 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
149 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
150 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
151 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
152 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
153 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
154 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
155 2932401849 Devosia sp. 2618 Isolate Rhizosphere
156 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
157 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
158 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
159 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
160 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
161 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
162 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
163 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
164 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
165 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
166 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
167 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
168 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
169 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
170 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
171 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
172 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
173 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
174 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
175 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
176 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
177 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
178 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
179 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
180 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
181 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
182 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
183 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
184 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
185 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
186 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
187 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
188 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
189 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
190 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
191 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
192 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
193 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
194 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
195 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
196 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
197 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
198 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
199 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
200 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
201 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
202 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
203 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
204 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
205 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
206 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
207 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
208 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
209 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
210 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
211 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
212 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
213 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
214 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
215 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
216 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
217 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
218 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
219 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
220 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
221 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
222 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
223 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
224 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
225 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
226 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
227 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
228 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
229 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
230 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
231 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
232 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
233 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
234 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
235 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
236 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
237 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
238 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
239 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
240 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
241 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
242 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
243 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
244 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
245 3004167301 Mesorhizobium loti 582 Isolate Unclassified
246 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
247 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
248 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
249 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
250 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
251 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
252 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
253 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
254 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
255 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
256 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
257 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
258 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
259 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
260 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
261 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
262 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
263 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
264 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
265 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
266 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
267 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
268 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
269 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
270 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
271 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
272 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
273 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
274 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
275 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
276 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
277 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
278 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
279 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
280 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
281 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
282 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
283 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
284 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
285 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
286 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
287 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
288 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
289 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
290 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
291 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
292 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
293 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
294 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
295 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
296 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
297 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
298 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
299 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
300 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
301 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
302 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
304 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
305 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
306 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
308 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
310 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
311 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
312 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
314 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
315 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
330 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
331 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
332 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
333 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
334 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
335 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
336 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
337 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
338 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
339 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
340 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
341 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
342 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
343 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
344 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
345 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
346 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
347 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
353 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
354 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
355 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
356 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
357 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
358 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
359 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
360 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
361 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
362 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
363 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
364 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
369 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
370 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
371 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
390 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
391 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
402 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
403 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
406 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
407 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
408 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
409 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
410 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
413 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
414 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
415 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
418 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
419 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
420 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
421 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
422 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
423 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
424 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
425 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
426 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
427 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
428 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
429 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
430 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 47.48
Metatranscriptomes 0
Isolates 52.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 19.19
Nodule 37.21
Rhizoplane 0.58
Rhizosphere 24.81
Stem 0
Stem Tuber 0
Unclassified 18.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10038080 3300002067 Bacteria 1408
2 JGI25156J39149_1018789 3300002705 Bacteria 1267
3 JGI25158J39367_1000270 3300002739 Bacteria 11802
4 JGI25157J39369_1003828 3300002741 Bacteria 2933
5 JGI25152J39213_1003426 3300002773 Bacteria 5422
6 JGI25152J39213_1010771 3300002773 Bacteria 2066
7 JGI25150J39212_1001197 3300002774 Bacteria 7688
8 JGI25159J45721_1000563 3300002987 Bacteria 16655
9 JGI25159J45721_1000661 3300002987 Bacteria 15285
10 JGI25151J46595_10003579 3300003187 Bacteria 8518
11 JGI25151J46595_10067982 3300003187 Bacteria 1095
12 JGI25153J46596_10000066 3300003215 Bacteria 123268
13 JGI25153J46596_10007864 3300003215 Bacteria 5175
14 JGI25160J50197_1000820 3300003354 Bacteria 16655
15 JGI25160J50197_1008401 3300003354 Bacteria 3938
16 JGI25161J50226_1000289 3300003374 Bacteria 28340
17 JGI25161J50226_1002468 3300003374 Bacteria 4719
18 Ga0055526_1001598 3300003771 Bacteria 15895
19 Ga0055526_1006061 3300003771 Bacteria 6690
20 Ga0055524_1002668 3300003775 Bacteria 9035
21 Ga0055524_1012961 3300003775 Bacteria 3171
22 Ga0055524_1019036 3300003775 Bacteria 2361
23 Ga0055536_1001086 3300003781 Bacteria 17117
24 Ga0055528_1004598 3300003790 Bacteria 6610
25 Ga0055540_1013800 3300003792 Bacteria 2445
26 Ga0055540_1017042 3300003792 Bacteria 2041
27 Ga0055531_10016501 3300003794 Bacteria 3181
28 Ga0055543_1000023 3300004625 Bacteria 140513
29 Ga0055543_1000727 3300004625 Bacteria 16693
30 Ga0065165_1002311 3300005262 Bacteria 16693
31 Ga0065165_1014552 3300005262 Bacteria 3048
32 Ga0070711_100285334 3300005439 Bacteria 1308
33 Ga0068853_100011643 3300005539 Bacteria 7149
34 Ga0068853_100310947 3300005539 Bacteria 1459
35 Ga0070665_100150042 3300005548 Bacteria 2334
36 Ga0070665_100357281 3300005548 Bacteria 1467
37 Ga0070664_100111217 3300005564 Bacteria 2391
38 Ga0068856_100261346 3300005614 Bacteria 1746
39 Ga0068870_10206961 3300005840 Bacteria 1193
40 Ga0068862_100313273 3300005844 Bacteria 1447
41 Ga0075365_10067131 3300006038 Bacteria 2407
42 Ga0075365_10067848 3300006038 Bacteria 2395
43 Ga0075365_10337354 3300006038 Bacteria 1062
44 Ga0070715_10092544 3300006163 Bacteria 1394
45 Ga0075362_10026824 3300006177 Bacteria 2463
46 Ga0075367_10067180 3300006178 Bacteria 2149
47 Ga0075367_10124465 3300006178 Bacteria 1590
48 Ga0075367_10256632 3300006178 Bacteria 1097
49 Ga0075370_10031152 3300006353 Bacteria 2977
50 Ga0075428_100295041 3300006844 Bacteria 1743
51 Ga0075428_100605910 3300006844 Bacteria 1170
52 Ga0105240_10065519 3300009093 Bacteria 4509
53 Ga0114129_10882835 3300009147 Bacteria 1134
54 Ga0105237_10257163 3300009545 Bacteria 1748
55 Ga0105238_10048642 3300009551 Bacteria 4272
56 Ga0105249_10110180 3300009553 Bacteria 2601
57 Ga0105239_10187910 3300010375 Bacteria 2312
58 Ga0105239_10330002 3300010375 Bacteria 1721
59 Ga0157369_10037593 3300013105 Bacteria 5300
60 Ga0171463_1016 3300013249 Bacteria 62129
61 Ga0157380_10209917 3300014326 Bacteria 1734
62 Ga0183363_1267 3300015690 Bacteria 8408
63 Ga0209436_100053 3300025208 Bacteria 63474
64 Ga0209436_100712 3300025208 Bacteria 13940
65 Ga0207425_1000968 3300025245 Bacteria 13512
66 Ga0207425_1015882 3300025245 Bacteria 1681
67 Ga0209026_1000141 3300025250 Bacteria 114545
68 Ga0209148_1000111 3300025254 Bacteria 198095
69 Ga0209148_1019152 3300025254 Bacteria 1140
70 Ga0209759_1000354 3300025256 Bacteria 59742
71 Ga0209129_1003607 3300025258 Bacteria 6618
72 Ga0209129_1006383 3300025258 Bacteria 3829
73 Ga0209233_1032775 3300025261 Bacteria 1198
74 Ga0209455_1000206 3300025272 Bacteria 84430
75 Ga0209130_1000031 3300025284 Bacteria 322932
76 Ga0209130_1001334 3300025284 Bacteria 16707
77 Ga0209676_1001434 3300025292 Bacteria 22507
78 Ga0209025_1000121 3300025294 Bacteria 208700
79 Ga0209025_1005690 3300025294 Bacteria 10037
80 Ga0209025_1007351 3300025294 Bacteria 8243
81 Ga0209564_1000081 3300025295 Bacteria 261592
82 Ga0209564_1000826 3300025295 Bacteria 42101
83 Ga0209758_1000028 3300025297 Bacteria 530102
84 Ga0209758_1011158 3300025297 Bacteria 5246
85 Ga0209758_1011779 3300025297 Bacteria 5009
86 Ga0209758_1014158 3300025297 Bacteria 4271
87 Ga0209050_1000852 3300025298 Bacteria 41567
88 Ga0209256_1000639 3300025299 Bacteria 47642
89 Ga0209256_1002527 3300025299 Bacteria 14697
90 Ga0209256_1003364 3300025299 Bacteria 11321
91 Ga0207426_1000042 3300025302 Bacteria 433289
92 Ga0207426_1001728 3300025302 Bacteria 16707
93 Ga0209051_1003025 3300025303 Bacteria 11387
94 Ga0209051_1013148 3300025303 Bacteria 3956
95 Ga0209051_1086325 3300025303 Bacteria 888
96 Ga0209257_1001851 3300025304 Bacteria 23010
97 Ga0209257_1029949 3300025304 Bacteria 1763
98 Ga0207647_10043176 3300025904 Bacteria 2822
99 Ga0207685_10074953 3300025905 Bacteria 1383
100 Ga0207663_10019446 3300025916 Bacteria 3826
101 Ga0207694_10031155 3300025924 Bacteria 4073
102 Ga0207694_10049985 3300025924 Bacteria 3237
103 Ga0207700_10275159 3300025928 Bacteria 1446
104 Ga0207669_10238552 3300025937 Bacteria 1346
105 Ga0207665_10357454 3300025939 Bacteria 1104
106 Ga0207679_10194098 3300025945 Bacteria 1691
107 Ga0207667_10355538 3300025949 Bacteria 1494
108 Ga0207667_10450037 3300025949 Bacteria 1309
109 Ga0207639_10297492 3300026041 Bacteria 1425
110 Ga0207675_100002563 3300026118 Bacteria 18003
111 Ga0268266_10019827 3300028379 Bacteria 5731
112 Ga0265318_10016718 3300028577 Bacteria 3023
113 Ga0307515_10022779 3300028794 Bacteria 11022
114 Ga0307515_10024806 3300028794 Bacteria 10418
115 Ga0265338_10038152 3300028800 Bacteria 4557
116 Ga0265324_10019345 3300029957 Bacteria 2454
117 Ga0265330_10033198 3300031235 Bacteria 2310
118 Ga0265325_10003181 3300031241 Bacteria 10801
119 Ga0265340_10132951 3300031247 Bacteria 1140
120 Ga0265339_10001174 3300031249 Bacteria 19772
121 Ga0265331_10001404 3300031250 Bacteria 17682
122 Ga0265331_10033771 3300031250 Bacteria 2528
123 Ga0265331_10068817 3300031250 Bacteria 1659
124 Ga0265327_10001987 3300031251 Bacteria 23267
125 Ga0265316_10015822 3300031344 Bacteria 6573
126 Ga0307513_10003256 3300031456 Bacteria 22138
127 Ga0307513_10024760 3300031456 Bacteria 6977
128 Ga0307513_10102828 3300031456 Bacteria 2875
129 Ga0265313_10000523 3300031595 Bacteria 40161
130 Ga0265313_10001290 3300031595 Bacteria 23699
131 Ga0265314_10040368 3300031711 Bacteria 3350
132 Ga0265314_10055239 3300031711 Bacteria 2743
133 Ga0265342_10010921 3300031712 Bacteria 6246
134 Ga0265342_10045329 3300031712 Bacteria 2647
135 Ga0307406_10244809 3300031901 Bacteria 1347
136 Ga0373927_0141317 3300035695 Bacteria 1575
137 Ga0373937_0107899 3300036401 Bacteria 2589
138 Ga0395899_0047144 3300037312 Bacteria 3209
139 Ga0395900_0000021 3300037418 Bacteria 351144
140 Ga0395900_0297530 3300037418 Bacteria 1601
141 Ga0395898_0002409 3300037466 Bacteria 22197
142 Ga0395905_0000912 3300037471 Bacteria 38176
143 Ga0395905_0025305 3300037471 Bacteria 5597
144 Ga0395901_0014520 3300038443 Bacteria 8009
145 Ga0436365_1709922 3300039437 Bacteria 2478
146 Ga0436361_0095035 3300039447 Bacteria 4270
147 Ga0439465_0036161 3300041413 Bacteria 1585
148 Ga0466972_0018590 3300044658 Bacteria 3476
149 Ga0466965_0001487 3300044683 Bacteria 9485
150 Ga0466966_0007644 3300044684 Bacteria 7163
151 Ga0466961_0037548 3300044693 Bacteria 3107
152 Ga0466961_0292673 3300044693 Bacteria 995
153 Ga0466964_0056330 3300044706 Bacteria 1625
154 Ga0466970_0008194 3300044765 Bacteria 5248
155 Ga0466957_0087624 3300044842 Bacteria 1947
156 Ga0495638_0014130 3300046460 Bacteria 5406
157 Ga0495610_0041751 3300046512 Bacteria 2300
158 Ga0495610_0091584 3300046512 Bacteria 1377
159 Ga0495643_0052753 3300046522 Bacteria 2182
160 Ga0495648_0186718 3300046524 Bacteria 1049
161 Ga0495597_0104515 3300046542 Bacteria 1192
162 Ga0495625_0054747 3300046660 Bacteria 2848
163 Ga0495625_0196167 3300046660 Bacteria 1335
164 Ga0495588_0208511 3300046674 Bacteria 1032
165 Ga0495681_0063185 3300047470 Bacteria 1700
166 Ga0495686_0104364 3300047472 Bacteria 1707
167 Ga0495686_0175082 3300047472 Bacteria 1246
168 Ga0495626_0081406 3300048091 Bacteria 1438
169 Ga0496106_0000401 3300048909 Bacteria 30792
170 Ga0496112_0065977 3300048915 Bacteria 3572
171 Ga0496116_0000233 3300048919 Bacteria 102081
172 Ga0496117_0001463 3300048920 Bacteria 34016
173 Ga0496117_0255224 3300048920 Bacteria 954
174 Ga0496118_0036064 3300048921 Bacteria 4004
175 Ga0496118_0103818 3300048921 Bacteria 1910
176 Ga0496119_0001035 3300048922 Bacteria 35586
177 Ga0496120_0002869 3300048923 Bacteria 16553
178 Ga0496120_0067307 3300048923 Bacteria 1979
179 Ga0496121_0007775 3300048924 Bacteria 12839
180 Ga0496121_0050445 3300048924 Bacteria 3516
181 Ga0496121_0206842 3300048924 Bacteria 1394
182 Ga0496121_0225315 3300048924 Bacteria 1317
183 Ga0496121_0236407 3300048924 Bacteria 1276
184 Ga0496122_0001329 3300048925 Bacteria 40484
185 Ga0496122_0008279 3300048925 Bacteria 11277
186 Ga0496123_0000018 3300048926 Bacteria 404553
187 Ga0496123_0001422 3300048926 Bacteria 33457
188 Ga0496123_0061037 3300048926 Bacteria 2426
189 Ga0496124_0000940 3300048927 Bacteria 46669
190 Ga0496124_0070672 3300048927 Bacteria 2895
191 Ga0496125_0000161 3300048928 Bacteria 150707
192 Ga0496125_0000221 3300048928 Bacteria 116650
193 Ga0496125_0274251 3300048928 Bacteria 1049
194 Ga0496126_0000212 3300048929 Bacteria 128871
195 Ga0496126_0000421 3300048929 Bacteria 85210
196 Ga0496126_0001037 3300048929 Bacteria 46997
197 Ga0496126_0100786 3300048929 Bacteria 2527
198 Ga0496126_0121662 3300048929 Bacteria 2263
199 Ga0496126_0145305 3300048929 Bacteria 2038
200 Ga0496126_0244142 3300048929 Bacteria 1499
201 Ga0501036_0236381 3300049572 Bacteria 1533
202 Ga0501043_0055857 3300049579 Bacteria 3102
203 Ga0501043_0113091 3300049579 Bacteria 2132
204 Ga0501047_0710094 3300049581 Bacteria 823
205 Ga0501070_0099750 3300049586 Bacteria 2403
206 Ga0501070_0211260 3300049586 Bacteria 1593
207 Ga0501073_0115941 3300049589 Bacteria 1856
208 Ga0501079_0454631 3300049741 Bacteria 1006
209 Ga0501080_0301528 3300049742 Bacteria 1453
210 Ga0501080_0310757 3300049742 Bacteria 1428
211 Ga0501080_0522556 3300049742 Bacteria 1059
212 Ga0501083_0084433 3300049744 Bacteria 2102
213 Ga0501044_0077274 3300049823 Bacteria 3377
214 nmdc:mga00v17_36310_c1 3300050491 Bacteria 2936
215 nmdc:mga0yw44_14370_c1 3300050492 Bacteria 4203
216 nmdc:mga0yw44_146641_c1 3300050492 Bacteria 1537
217 nmdc:mga0yw44_21463_c1 3300050492 Bacteria 3602
218 nmdc:mga06z11_90902_c1 3300050494 Bacteria 1657
219 nmdc:mga08y16_86642_c1 3300050511 Bacteria 3264
220 nmdc:mga0sz30_54198_c1 3300050516 Bacteria 1705
221 Ga0500610_0075848 3300053079 Bacteria 1753
222 Ga0500644_0024731 3300053088 Bacteria 1839
223 Ga0500556_0000199 3300053104 Bacteria 49258
224 Ga0500572_002031 3300053111 Bacteria 5040
225 Ga0500594_0029275 3300053118 Bacteria 1439
226 Ga0500658_0090920 3300053134 Bacteria 1320
227 Ga0500559_0007036 3300053136 Bacteria 5025
228 Ga0500568_0000004 3300053139 Bacteria 621666
229 Ga0500568_0015840 3300053139 Bacteria 3364
230 Ga0500568_0043291 3300053139 Bacteria 1800
231 Ga0500577_0057322 3300053142 Bacteria 1486
232 Ga0500604_0017549 3300053151 Bacteria 1983
233 Ga0500604_0060622 3300053151 Bacteria 1187
234 Ga0500604_0061790 3300053151 Bacteria 1178
235 Ga0500616_0045242 3300053153 Bacteria 2346
236 Ga0500616_0077664 3300053153 Bacteria 1676
237 Ga0500620_007038 3300053155 Bacteria 2748
238 Ga0500620_056394 3300053155 Bacteria 1329
239 Ga0500622_0000343 3300053156 Bacteria 45668
240 Ga0500622_0004607 3300053156 Bacteria 8558
241 Ga0500627_0074170 3300053158 Bacteria 1510
242 Ga0500633_0007428 3300053160 Bacteria 2759
243 Ga0500636_0001782 3300053177 Bacteria 11796
244 Ga0500645_030683 3300053730 Bacteria 1617
245 Ga0501084_0105956 3300054114 Bacteria 2362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2878781027 2878788311 218
2 iso_pu_bacteria 2987652177 2987653926 219
3 3300039437 Ga0436365_1709922 Ga0436365_1709922_209_1078 225
4 3300046674 Ga0495588_0208511 Ga0495588_0208511_14_856 226
5 3300031250 Ga0265331_10033771 Ga0265331_100337713 231
6 3300048929 Ga0496126_0000212 Ga0496126_0000212_84331_85173 231
7 3300006038 Ga0075365_10337354 Ga0075365_103373542 232
8 3300049581 Ga0501047_0710094 Ga0501047_0710094_43_795 232
9 3300050492 nmdc:mga0yw44_14370_c1 nmdc:mga0yw44_14370_c1_3000_3845 232
10 3300031251 Ga0265327_10001987 Ga0265327_1000198719 234
11 3300048928 Ga0496125_0000161 Ga0496125_0000161_90776_91615 236
12 3300003187 JGI25151J46595_10067982 JGI25151J46595_100679821 237
13 3300025294 Ga0209025_1000121 Ga0209025_1000121127 237
14 3300048920 Ga0496117_0255224 Ga0496117_0255224_85_942 239
15 3300048929 Ga0496126_0001037 Ga0496126_0001037_28839_29696 239
16 3300013105 Ga0157369_10037593 Ga0157369_100375935 240
17 3300048929 Ga0496126_0100786 Ga0496126_0100786_814_1659 240
18 3300003790 Ga0055528_1004598 Ga0055528_10045984 241
19 3300028577 Ga0265318_10016718 Ga0265318_100167181 243
20 3300053153 Ga0500616_0045242 Ga0500616_0045242_772_1623 243
21 3300048919 Ga0496116_0000233 Ga0496116_0000233_85161_86018 244
22 iso_pu_bacteria 2885342637 2885348590 244
23 3300048925 Ga0496122_0001329 Ga0496122_0001329_13008_13850 245
24 3300048926 Ga0496123_0000018 Ga0496123_0000018_25796_26638 245
25 3300054114 Ga0501084_0105956 Ga0501084_0105956_996_1850 245
26 3300053118 Ga0500594_0029275 Ga0500594_0029275_570_1415 246
27 3300048925 Ga0496122_0008279 Ga0496122_0008279_6473_7327 248
28 3300048927 Ga0496124_0000940 Ga0496124_0000940_19211_20053 248
29 3300013249 Ga0171463_1016 Ga0171463_101666 249
30 3300015690 Ga0183363_1267 Ga0183363_12676 249
31 3300048920 Ga0496117_0001463 Ga0496117_0001463_31069_31911 249
32 iso_pu_bacteria 2738543031 2739350915 249
33 iso_pu_bacteria 2844533157 2844538837 250
34 3300044842 Ga0466957_0087624 Ga0466957_0087624_967_1854 251
35 iso_pu_bacteria 2919100787 2919102880 252
36 3300025303 Ga0209051_1086325 Ga0209051_10863251 253
37 3300028800 Ga0265338_10038152 Ga0265338_100381523 253
38 3300029957 Ga0265324_10019345 Ga0265324_100193453 253
39 3300031235 Ga0265330_10033198 Ga0265330_100331982 253
40 3300031241 Ga0265325_10003181 Ga0265325_100031819 253
41 3300031249 Ga0265339_10001174 Ga0265339_1000117419 253
42 3300031250 Ga0265331_10068817 Ga0265331_100688172 253
43 3300031344 Ga0265316_10015822 Ga0265316_100158227 253
44 3300031456 Ga0307513_10102828 Ga0307513_101028283 253
45 3300031595 Ga0265313_10000523 Ga0265313_1000052333 253
46 3300031711 Ga0265314_10055239 Ga0265314_100552394 253
47 3300031712 Ga0265342_10045329 Ga0265342_100453292 253
48 3300039447 Ga0436361_0095035 Ga0436361_0095035_125_988 253
49 3300044683 Ga0466965_0001487 Ga0466965_0001487_4534_5394 253
50 3300044693 Ga0466961_0292673 Ga0466961_0292673_53_913 253
51 3300044706 Ga0466964_0056330 Ga0466964_0056330_94_954 253
52 3300047472 Ga0495686_0175082 Ga0495686_0175082_112_1008 253
53 iso_pu_bacteria 2510917030 2511195215 253
54 iso_pu_bacteria 2582581298 2585222314 253
55 iso_pu_bacteria 2585427529 2585544733 253
56 3300048924 Ga0496121_0225315 Ga0496121_0225315_370_1194 254
57 iso_pu_bacteria 2524023207 2524452002 254
58 iso_pu_bacteria 2643221568 2643853944 254
59 iso_pu_bacteria 2751185821 2753459283 254
60 iso_pu_bacteria 2775507049 2776916039 254
61 3300002739 JGI25158J39367_1000270 JGI25158J39367_100027010 255
62 3300002773 JGI25152J39213_1003426 JGI25152J39213_10034262 255
63 3300002773 JGI25152J39213_1010771 JGI25152J39213_10107712 255
64 3300002774 JGI25150J39212_1001197 JGI25150J39212_10011971 255
65 3300002987 JGI25159J45721_1000661 JGI25159J45721_10006611 255
66 3300003187 JGI25151J46595_10003579 JGI25151J46595_100035794 255
67 3300003215 JGI25153J46596_10007864 JGI25153J46596_100078645 255
68 3300003354 JGI25160J50197_1008401 JGI25160J50197_10084014 255
69 3300003374 JGI25161J50226_1000289 JGI25161J50226_100028924 255
70 3300003771 Ga0055526_1006061 Ga0055526_10060615 255
71 3300003775 Ga0055524_1012961 Ga0055524_10129612 255
72 3300003792 Ga0055540_1013800 Ga0055540_10138002 255
73 3300004625 Ga0055543_1000023 Ga0055543_1000023102 255
74 3300005262 Ga0065165_1014552 Ga0065165_10145521 255
75 3300025208 Ga0209436_100053 Ga0209436_1000532 255
76 3300025245 Ga0207425_1000968 Ga0207425_10009685 255
77 3300025258 Ga0209129_1003607 Ga0209129_10036072 255
78 3300025258 Ga0209129_1006383 Ga0209129_10063832 255
79 3300025284 Ga0209130_1000031 Ga0209130_1000031132 255
80 3300025294 Ga0209025_1005690 Ga0209025_10056904 255
81 3300025295 Ga0209564_1000826 Ga0209564_100082628 255
82 3300025297 Ga0209758_1011158 Ga0209758_10111585 255
83 3300025297 Ga0209758_1011779 Ga0209758_10117794 255
84 3300025299 Ga0209256_1002527 Ga0209256_10025272 255
85 3300025302 Ga0207426_1000042 Ga0207426_1000042278 255
86 3300025303 Ga0209051_1013148 Ga0209051_10131482 255
87 3300025304 Ga0209257_1029949 Ga0209257_10299492 255
88 3300028794 Ga0307515_10022779 Ga0307515_100227792 255
89 3300031456 Ga0307513_10024760 Ga0307513_100247606 255
90 3300037312 Ga0395899_0047144 Ga0395899_0047144_126_983 255
91 3300037418 Ga0395900_0000021 Ga0395900_0000021_42964_43821 255
92 3300037466 Ga0395898_0002409 Ga0395898_0002409_16773_17630 255
93 3300037471 Ga0395905_0000912 Ga0395905_0000912_23190_24047 255
94 3300038443 Ga0395901_0014520 Ga0395901_0014520_2423_3280 255
95 3300041413 Ga0439465_0036161 Ga0439465_0036161_557_1387 255
96 3300046512 Ga0495610_0091584 Ga0495610_0091584_190_1020 255
97 3300046522 Ga0495643_0052753 Ga0495643_0052753_913_1743 255
98 3300046524 Ga0495648_0186718 Ga0495648_0186718_126_956 255
99 3300048091 Ga0495626_0081406 Ga0495626_0081406_13_843 255
100 3300048909 Ga0496106_0000401 Ga0496106_0000401_21433_22263 255
101 3300048921 Ga0496118_0103818 Ga0496118_0103818_725_1555 255
102 3300048924 Ga0496121_0007775 Ga0496121_0007775_7371_8201 255
103 3300048924 Ga0496121_0236407 Ga0496121_0236407_182_1012 255
104 3300048926 Ga0496123_0061037 Ga0496123_0061037_885_1715 255
105 3300048927 Ga0496124_0070672 Ga0496124_0070672_744_1574 255
106 3300048928 Ga0496125_0000221 Ga0496125_0000221_106220_107047 255
107 3300048928 Ga0496125_0274251 Ga0496125_0274251_41_871 255
108 3300049572 Ga0501036_0236381 Ga0501036_0236381_20_850 255
109 3300049579 Ga0501043_0113091 Ga0501043_0113091_453_1283 255
110 3300050516 nmdc:mga0sz30_54198_c1 nmdc:mga0sz30_54198_c1_735_1595 255
111 3300053088 Ga0500644_0024731 Ga0500644_0024731_784_1626 255
112 3300053139 Ga0500568_0015840 Ga0500568_0015840_1379_2209 255
113 3300053139 Ga0500568_0043291 Ga0500568_0043291_940_1770 255
114 3300053142 Ga0500577_0057322 Ga0500577_0057322_508_1347 255
115 3300053151 Ga0500604_0017549 Ga0500604_0017549_661_1491 255
116 3300053155 Ga0500620_056394 Ga0500620_056394_237_1067 255
117 3300053156 Ga0500622_0000343 Ga0500622_0000343_44132_44962 255
118 3300053156 Ga0500622_0004607 Ga0500622_0004607_2809_3651 255
119 3300053160 Ga0500633_0007428 Ga0500633_0007428_1262_2092 255
120 iso_pu_bacteria 2510917022 2511137280 255
121 iso_pu_bacteria 2582581306 2585264605 255
122 iso_pu_bacteria 2582581307 2585274107 255
123 iso_pu_bacteria 2582581865 2585389973 255
124 iso_pu_bacteria 2585427531 2585560557 255
125 iso_pu_bacteria 2585427608 2585898769 255
126 iso_pu_bacteria 2585427609 2585903660 255
127 iso_pu_bacteria 2585428125 2587981221 255
128 iso_pu_bacteria 2643221618 2644104275 255
129 iso_pu_bacteria 2643221626 2644148038 255
130 iso_pu_bacteria 2643221637 2644206990 255
131 iso_pu_bacteria 2643221655 2644310233 255
132 iso_pu_bacteria 2643221659 2644333439 255
133 iso_pu_bacteria 2643221698 2644543709 255
134 iso_pu_bacteria 2643221712 2644616778 255
135 iso_pu_bacteria 2643221718 2644650638 255
136 iso_pu_bacteria 2690316117 2692318989 255
137 iso_pu_bacteria 2842509118 2842510548 255
138 iso_pu_bacteria 2844163670 2844165048 255
139 iso_pu_bacteria 2847417321 2847422509 255
140 iso_pu_bacteria 2848992105 2848998082 255
141 iso_pu_bacteria 2852387548 2852390982 255
142 iso_pu_bacteria 2855872281 2855875846 255
143 iso_pu_bacteria 2932401849 2932405046 255
144 iso_pu_bacteria 2941499720 2941503970 255
145 iso_pu_bacteria 2957443900 2957444696 255
146 iso_pu_bacteria 2960617483 2960621129 255
147 iso_pu_bacteria 2960660292 2960661411 255
148 iso_pu_bacteria 2977523885 2977524911 255
149 iso_pu_bacteria 643692032 643823619 255
150 3300003215 JGI25153J46596_10000066 JGI25153J46596_10000066104 256
151 3300005840 Ga0068870_10206961 Ga0068870_102069612 256
152 3300005844 Ga0068862_100313273 Ga0068862_1003132731 256
153 3300006844 Ga0075428_100295041 Ga0075428_1002950412 256
154 3300009147 Ga0114129_10882835 Ga0114129_108828352 256
155 3300009553 Ga0105249_10110180 Ga0105249_101101802 256
156 3300014326 Ga0157380_10209917 Ga0157380_102099172 256
157 3300025297 Ga0209758_1000028 Ga0209758_100002826 256
158 3300025937 Ga0207669_10238552 Ga0207669_102385522 256
159 3300026118 Ga0207675_100002563 Ga0207675_1000025637 256
160 3300046460 Ga0495638_0014130 Ga0495638_0014130_2897_3742 256
161 3300049579 Ga0501043_0055857 Ga0501043_0055857_218_1060 256
162 3300049586 Ga0501070_0099750 Ga0501070_0099750_635_1477 256
163 3300049586 Ga0501070_0211260 Ga0501070_0211260_350_1192 256
164 3300049589 Ga0501073_0115941 Ga0501073_0115941_89_931 256
165 3300049741 Ga0501079_0454631 Ga0501079_0454631_153_995 256
166 3300049742 Ga0501080_0301528 Ga0501080_0301528_390_1232 256
167 3300049742 Ga0501080_0310757 Ga0501080_0310757_161_1003 256
168 3300049744 Ga0501083_0084433 Ga0501083_0084433_533_1375 256
169 3300049823 Ga0501044_0077274 Ga0501044_0077274_1961_2803 256
170 3300050492 nmdc:mga0yw44_21463_c1 nmdc:mga0yw44_21463_c1_741_1601 256
171 3300050511 nmdc:mga08y16_86642_c1 nmdc:mga08y16_86642_c1_2034_2873 256
172 iso_pu_bacteria 2582581283 2585164364 256
173 iso_pu_bacteria 2643221607 2644051701 256
174 iso_pu_bacteria 2643221636 2644200185 256
175 iso_pu_bacteria 2643221686 2644480569 256
176 iso_pu_bacteria 2791355253 2793281448 256
177 iso_pu_bacteria 2891373044 2891376951 256
178 iso_pu_bacteria 2904615490 2904615879 256
179 iso_pu_bacteria 2978969890 2978970100 256
180 iso_pu_bacteria 2984587000 2984587129 256
181 iso_pu_bacteria 8018150411 8018150490 256
182 3300028794 Ga0307515_10024806 Ga0307515_100248064 257
183 3300053139 Ga0500568_0000004 Ga0500568_0000004_139327_140157 257
184 iso_pu_bacteria 2989349275 2989353809 257
185 iso_pu_bacteria 3003930520 3003935663 257
186 3300005548 Ga0070665_100150042 Ga0070665_1001500423 258
187 3300028379 Ga0268266_10019827 Ga0268266_100198272 258
188 3300031247 Ga0265340_10132951 Ga0265340_101329511 258
189 3300031250 Ga0265331_10001404 Ga0265331_100014047 258
190 3300031456 Ga0307513_10003256 Ga0307513_100032564 258
191 3300031595 Ga0265313_10001290 Ga0265313_1000129019 258
192 3300031711 Ga0265314_10040368 Ga0265314_100403683 258
193 3300031712 Ga0265342_10010921 Ga0265342_100109214 258
194 3300053111 Ga0500572_002031 Ga0500572_002031_3022_3864 258
195 3300053177 Ga0500636_0001782 Ga0500636_0001782_3911_4753 258
196 iso_pu_bacteria 2643221689 2644498721 258
197 iso_pu_bacteria 2843690924 2843690988 258
198 iso_pu_bacteria 2965040258 2965046122 258
199 3300006844 Ga0075428_100605910 Ga0075428_1006059101 259
200 iso_pu_bacteria 2511231027 2511389561 259
201 iso_pu_bacteria 2599185352 2600197117 259
202 iso_pu_bacteria 2643221557 2643804840 259
203 iso_pu_bacteria 2643221610 2644067379 259
204 iso_pu_bacteria 2643221668 2644378855 259
205 iso_pu_bacteria 2643221675 2644418467 259
206 iso_pu_bacteria 2643221680 2644451834 259
207 iso_pu_bacteria 2643221723 2644675178 259
208 iso_pu_bacteria 2643221726 2644691007 259
209 iso_pu_bacteria 2775506902 2776269684 259
210 iso_pu_bacteria 2775506904 2776282613 259
211 iso_pu_bacteria 2842871566 2842872622 259
212 iso_pu_bacteria 2939669807 2939671943 259
213 iso_pu_bacteria 8002285264 8002287305 259
214 3300005564 Ga0070664_100111217 Ga0070664_1001112172 260
215 3300006178 Ga0075367_10067180 Ga0075367_100671803 260
216 3300006353 Ga0075370_10031152 Ga0075370_100311522 260
217 3300025924 Ga0207694_10031155 Ga0207694_100311554 260
218 3300025928 Ga0207700_10275159 Ga0207700_102751592 260
219 3300025945 Ga0207679_10194098 Ga0207679_101940982 260
220 3300035695 Ga0373927_0141317 Ga0373927_0141317_401_1255 260
221 3300036401 Ga0373937_0107899 Ga0373937_0107899_612_1466 260
222 3300048929 Ga0496126_0121662 Ga0496126_0121662_364_1218 260
223 3300050494 nmdc:mga06z11_90902_c1 nmdc:mga06z11_90902_c1_694_1554 260
224 iso_pu_bacteria 3002141150 3002141571 260
225 iso_pu_bacteria 3004195979 3004202985 260
226 3300002987 JGI25159J45721_1000563 JGI25159J45721_10005633 261
227 3300003354 JGI25160J50197_1000820 JGI25160J50197_100082015 261
228 3300003374 JGI25161J50226_1002468 JGI25161J50226_10024682 261
229 3300003771 Ga0055526_1001598 Ga0055526_100159815 261
230 3300003775 Ga0055524_1002668 Ga0055524_10026685 261
231 3300003775 Ga0055524_1019036 Ga0055524_10190361 261
232 3300003781 Ga0055536_1001086 Ga0055536_10010863 261
233 3300003792 Ga0055540_1017042 Ga0055540_10170422 261
234 3300003794 Ga0055531_10016501 Ga0055531_100165012 261
235 3300004625 Ga0055543_1000727 Ga0055543_100072715 261
236 3300005262 Ga0065165_1002311 Ga0065165_100231115 261
237 3300005439 Ga0070711_100285334 Ga0070711_1002853342 261
238 3300006163 Ga0070715_10092544 Ga0070715_100925442 261
239 3300025208 Ga0209436_100712 Ga0209436_1007124 261
240 3300025245 Ga0207425_1015882 Ga0207425_10158822 261
241 3300025284 Ga0209130_1001334 Ga0209130_100133415 261
242 3300025292 Ga0209676_1001434 Ga0209676_10014344 261
243 3300025294 Ga0209025_1007351 Ga0209025_10073514 261
244 3300025295 Ga0209564_1000081 Ga0209564_100008123 261
245 3300025298 Ga0209050_1000852 Ga0209050_100085222 261
246 3300025299 Ga0209256_1000639 Ga0209256_100063938 261
247 3300025299 Ga0209256_1003364 Ga0209256_100336410 261
248 3300025302 Ga0207426_1001728 Ga0207426_100172815 261
249 3300025303 Ga0209051_1003025 Ga0209051_100302512 261
250 3300025304 Ga0209257_1001851 Ga0209257_10018514 261
251 3300025905 Ga0207685_10074953 Ga0207685_100749532 261
252 3300025916 Ga0207663_10019446 Ga0207663_100194463 261
253 3300025939 Ga0207665_10357454 Ga0207665_103574542 261
254 3300044684 Ga0466966_0007644 Ga0466966_0007644_5969_6835 261
255 3300044693 Ga0466961_0037548 Ga0466961_0037548_1546_2412 261
256 3300044765 Ga0466970_0008194 Ga0466970_0008194_651_1517 261
257 iso_pu_bacteria 2510461069 2510840237 261
258 iso_pu_bacteria 2960624210 2960630354 261
259 iso_pu_bacteria 2977858184 2977863252 261
260 3300031901 Ga0307406_10244809 Ga0307406_102448092 263
261 3300053136 Ga0500559_0007036 Ga0500559_0007036_975_1823 263
262 iso_pu_bacteria 2977907340 2977913297 263
263 3300048922 Ga0496119_0001035 Ga0496119_0001035_21653_22540 264
264 3300048926 Ga0496123_0001422 Ga0496123_0001422_19177_20064 264
265 3300048929 Ga0496126_0000421 Ga0496126_0000421_52789_53664 264
266 3300053104 Ga0500556_0000199 Ga0500556_0000199_13145_14032 264
267 3300053153 Ga0500616_0077664 Ga0500616_0077664_162_1049 264
268 3300053730 Ga0500645_030683 Ga0500645_030683_494_1366 264
269 iso_pu_bacteria 2503198000 2503198881 264
270 iso_pu_bacteria 2508501123 2509117909 264
271 iso_pu_bacteria 2509276018 2509368891 264
272 iso_pu_bacteria 2509276022 2509393696 264
273 iso_pu_bacteria 2510065059 2510315219 264
274 iso_pu_bacteria 2512875016 2512933724 264
275 iso_pu_bacteria 2512875024 2512961889 264
276 iso_pu_bacteria 2513237164 2514035443 264
277 iso_pu_bacteria 2513237305 2514421955 264
278 iso_pu_bacteria 2588253730 2588519807 264
279 iso_pu_bacteria 2687453392 2688596157 264
280 iso_pu_bacteria 2693429784 2694636824 264
281 iso_pu_bacteria 2721755686 2723573295 264
282 iso_pu_bacteria 2756170246 2756673554 264
283 iso_pu_bacteria 2844002411 2844003278 264
284 iso_pu_bacteria 2844009547 2844010961 264
285 iso_pu_bacteria 2856320880 2856324072 264
286 iso_pu_bacteria 2856328259 2856329439 264
287 iso_pu_bacteria 2856334872 2856335080 264
288 iso_pu_bacteria 2856364286 2856367386 264
289 iso_pu_bacteria 2857349434 2857353097 264
290 iso_pu_bacteria 2857367948 2857370410 264
291 iso_pu_bacteria 2869169390 2869174242 264
292 iso_pu_bacteria 2869234852 2869239196 264
293 iso_pu_bacteria 2869242130 2869246630 264
294 iso_pu_bacteria 2869249662 2869256583 264
295 iso_pu_bacteria 2869256925 2869257582 264
296 iso_pu_bacteria 2869264136 2869270091 264
297 iso_pu_bacteria 2869271264 2869271627 264
298 iso_pu_bacteria 2869278585 2869282403 264
299 iso_pu_bacteria 2869285874 2869288527 264
300 iso_pu_bacteria 2871429161 2871431194 264
301 iso_pu_bacteria 2871435913 2871443380 264
302 iso_pu_bacteria 2871451962 2871452047 264
303 iso_pu_bacteria 2871459585 2871465277 264
304 iso_pu_bacteria 2871466892 2871473469 264
305 iso_pu_bacteria 2871474448 2871478539 264
306 iso_pu_bacteria 2871481445 2871481547 264
307 iso_pu_bacteria 2871495908 2871498818 264
308 iso_pu_bacteria 2874116593 2874123516 264
309 iso_pu_bacteria 2874123672 2874126292 264
310 iso_pu_bacteria 2874131515 2874134451 264
311 iso_pu_bacteria 2874139085 2874142766 264
312 iso_pu_bacteria 2874146452 2874150569 264
313 iso_pu_bacteria 2874155637 2874158309 264
314 iso_pu_bacteria 2874162495 2874163671 264
315 iso_pu_bacteria 2874168670 2874170527 264
316 iso_pu_bacteria 2876363079 2876364021 264
317 iso_pu_bacteria 2876386047 2876392592 264
318 iso_pu_bacteria 2876392853 2876399059 264
319 iso_pu_bacteria 2876399893 2876401116 264
320 iso_pu_bacteria 2876406927 2876407901 264
321 iso_pu_bacteria 2876413966 2876416617 264
322 iso_pu_bacteria 2876420981 2876427225 264
323 iso_pu_bacteria 2878738818 2878739796 264
324 iso_pu_bacteria 2878745973 2878747798 264
325 iso_pu_bacteria 2878760144 2878763036 264
326 iso_pu_bacteria 2878767105 2878770006 264
327 iso_pu_bacteria 2878774303 2878774498 264
328 iso_pu_bacteria 2881147464 2881148372 264
329 iso_pu_bacteria 2881155292 2881158314 264
330 iso_pu_bacteria 2881161766 2881165156 264
331 iso_pu_bacteria 2882632389 2882635234 264
332 iso_pu_bacteria 2885305155 2885307034 264
333 iso_pu_bacteria 2885326080 2885329031 264
334 iso_pu_bacteria 2885350715 2885357491 264
335 iso_pu_bacteria 2888337043 2888343545 264
336 iso_pu_bacteria 2888350351 2888353371 264
337 iso_pu_bacteria 2889010040 2889015087 264
338 iso_pu_bacteria 2889016732 2889019838 264
339 iso_pu_bacteria 2903448605 2903453880 264
340 iso_pu_bacteria 2903492973 2903502279 264
341 iso_pu_bacteria 2903521522 2903525820 264
342 iso_pu_bacteria 2903528002 2903532634 264
343 iso_pu_bacteria 2903540706 2903543620 264
344 iso_pu_bacteria 2904659560 2904665586 264
345 iso_pu_bacteria 2906308376 2906310971 264
346 iso_pu_bacteria 2906321335 2906323082 264
347 iso_pu_bacteria 2906363423 2906366076 264
348 iso_pu_bacteria 2906370794 2906375629 264
349 iso_pu_bacteria 2906378014 2906385751 264
350 iso_pu_bacteria 2906386501 2906391742 264
351 iso_pu_bacteria 2906393657 2906394420 264
352 iso_pu_bacteria 2906401398 2906403154 264
353 iso_pu_bacteria 2906408224 2906408991 264
354 iso_pu_bacteria 2906427513 2906429072 264
355 iso_pu_bacteria 2922130491 2922137751 264
356 iso_pu_bacteria 2922151315 2922153576 264
357 iso_pu_bacteria 2922172374 2922173263 264
358 iso_pu_bacteria 2922185730 2922192793 264
359 iso_pu_bacteria 2924710171 2924717801 264
360 iso_pu_bacteria 2924718760 2924719079 264
361 iso_pu_bacteria 2924733363 2924740595 264
362 iso_pu_bacteria 2924741084 2924741756 264
363 iso_pu_bacteria 2924748358 2924753113 264
364 iso_pu_bacteria 2924762789 2924768710 264
365 iso_pu_bacteria 2924776078 2924777417 264
366 iso_pu_bacteria 2937813078 2937815512 264
367 iso_pu_bacteria 2937822353 2937822828 264
368 iso_pu_bacteria 2937836603 2937838872 264
369 iso_pu_bacteria 2937848649 2937852717 264
370 iso_pu_bacteria 2937861824 2937864389 264
371 iso_pu_bacteria 2937877337 2937880436 264
372 iso_pu_bacteria 2937972304 2937975766 264
373 iso_pu_bacteria 2937980651 2937986473 264
374 iso_pu_bacteria 2937994558 2937997466 264
375 iso_pu_bacteria 2958034702 2958038261 264
376 iso_pu_bacteria 2958041894 2958050987 264
377 iso_pu_bacteria 2958041894 2958057325 264
378 iso_pu_bacteria 2958071322 2958072331 264
379 iso_pu_bacteria 2958084443 2958087571 264
380 iso_pu_bacteria 2958092219 2958100427 264
381 iso_pu_bacteria 2958100919 2958105005 264
382 iso_pu_bacteria 2958115193 2958116253 264
383 iso_pu_bacteria 2958122699 2958129575 264
384 iso_pu_bacteria 2958130278 2958132929 264
385 iso_pu_bacteria 2958137437 2958142292 264
386 iso_pu_bacteria 2958158011 2958161392 264
387 iso_pu_bacteria 2958165035 2958167940 264
388 iso_pu_bacteria 2958179912 2958182631 264
389 iso_pu_bacteria 2961077736 2961080479 264
390 iso_pu_bacteria 2961114664 2961120929 264
391 iso_pu_bacteria 2961127735 2961127930 264
392 iso_pu_bacteria 2961136820 2961141615 264
393 iso_pu_bacteria 2961163497 2961166408 264
394 iso_pu_bacteria 2961183825 2961187708 264
395 iso_pu_bacteria 2963644680 2963645479 264
396 iso_pu_bacteria 2965018300 2965021227 264
397 iso_pu_bacteria 2965025482 2965026807 264
398 iso_pu_bacteria 2965032056 2965033247 264
399 iso_pu_bacteria 2965047637 2965053989 264
400 iso_pu_bacteria 2965089291 2965091075 264
401 iso_pu_bacteria 2965119406 2965125534 264
402 iso_pu_bacteria 2968016561 2968017401 264
403 iso_pu_bacteria 2968083720 2968085190 264
404 iso_pu_bacteria 2968110612 2968117079 264
405 iso_pu_bacteria 2968117919 2968122497 264
406 iso_pu_bacteria 2968171901 2968174809 264
407 iso_pu_bacteria 2970469710 2970472445 264
408 iso_pu_bacteria 2970489779 2970493571 264
409 iso_pu_bacteria 2970510686 2970511145 264
410 iso_pu_bacteria 2970532167 2970536324 264
411 iso_pu_bacteria 2970547951 2970550902 264
412 iso_pu_bacteria 2970554993 2970557891 264
413 iso_pu_bacteria 2970593180 2970597012 264
414 iso_pu_bacteria 2970619444 2970624389 264
415 iso_pu_bacteria 2970627176 2970629598 264
416 iso_pu_bacteria 2977843712 2977846723 264
417 iso_pu_bacteria 2977851361 2977853501 264
418 iso_pu_bacteria 2977864932 2977869313 264
419 iso_pu_bacteria 2977872689 2977876736 264
420 iso_pu_bacteria 2977898635 2977902949 264
421 iso_pu_bacteria 2977915119 2977920409 264
422 iso_pu_bacteria 2977922695 2977924744 264
423 iso_pu_bacteria 2977942078 2977945553 264
424 iso_pu_bacteria 2977950692 2977952143 264
425 iso_pu_bacteria 2977957713 2977958474 264
426 iso_pu_bacteria 2977971508 2977978633 264
427 iso_pu_bacteria 2979710463 2979715331 264
428 iso_pu_bacteria 2979742915 2979751257 264
429 iso_pu_bacteria 2979764755 2979768883 264
430 iso_pu_bacteria 2979772303 2979775667 264
431 iso_pu_bacteria 2979793036 2979797133 264
432 iso_pu_bacteria 2987636660 2987641689 264
433 iso_pu_bacteria 2987645492 2987646914 264
434 iso_pu_bacteria 2987659509 2987662416 264
435 iso_pu_bacteria 2987666974 2987667130 264
436 iso_pu_bacteria 2996310559 2996314974 264
437 iso_pu_bacteria 2996348954 2996349855 264
438 iso_pu_bacteria 2996386984 2996392777 264
439 iso_pu_bacteria 3000135777 3000137548 264
440 iso_pu_bacteria 3004167301 3004173473 264
441 iso_pu_bacteria 3004188549 3004191467 264
442 iso_pu_bacteria 3004203850 3004209499 264
443 iso_pu_bacteria 3004211236 3004218535 264
444 iso_pu_bacteria 3004218560 3004223619 264
445 iso_pu_bacteria 3004239961 3004248071 264
446 iso_pu_bacteria 3004248173 3004249846 264
447 iso_pu_bacteria 3004268573 3004273026 264
448 iso_pu_bacteria 3004275668 3004276557 264
449 iso_pu_bacteria 3004289098 3004293639 264
450 iso_pu_bacteria 3004334049 3004337082 264
451 iso_pu_bacteria 637000159 637076836 264
452 iso_pu_bacteria 649633066 649870717 264
453 iso_pu_bacteria 8004312739 8004314948 264
454 iso_pu_bacteria 8004361976 8004368349 264
455 iso_pu_bacteria 8004387939 8004390496 264
456 iso_pu_bacteria 8004445564 8004448772 264
457 iso_pu_bacteria 8004633249 8004638938 264
458 iso_pu_bacteria 8004640170 8004641864 264
459 iso_pu_bacteria 8004703790 8004704749 264
460 iso_pu_bacteria 8004714634 8004717188 264
461 iso_pu_bacteria 8004727605 8004734608 264
462 3300025949 Ga0207667_10450037 Ga0207667_104500372 266
463 3300048924 Ga0496121_0050445 Ga0496121_0050445_307_1203 266
464 3300006177 Ga0075362_10026824 Ga0075362_100268243 267
465 3300046542 Ga0495597_0104515 Ga0495597_0104515_114_974 267
466 3300053079 Ga0500610_0075848 Ga0500610_0075848_97_957 267
467 3300002067 JGI24735J21928_10038080 JGI24735J21928_100380802 268
468 3300002705 JGI25156J39149_1018789 JGI25156J39149_10187891 268
469 3300002741 JGI25157J39369_1003828 JGI25157J39369_10038283 268
470 3300005539 Ga0068853_100011643 Ga0068853_1000116436 268
471 3300005539 Ga0068853_100310947 Ga0068853_1003109472 268
472 3300005548 Ga0070665_100357281 Ga0070665_1003572813 268
473 3300005614 Ga0068856_100261346 Ga0068856_1002613462 268
474 3300006038 Ga0075365_10067131 Ga0075365_100671312 268
475 3300006038 Ga0075365_10067848 Ga0075365_100678482 268
476 3300006178 Ga0075367_10124465 Ga0075367_101244651 268
477 3300006178 Ga0075367_10256632 Ga0075367_102566321 268
478 3300009093 Ga0105240_10065519 Ga0105240_100655192 268
479 3300009545 Ga0105237_10257163 Ga0105237_102571631 268
480 3300009551 Ga0105238_10048642 Ga0105238_100486423 268
481 3300010375 Ga0105239_10187910 Ga0105239_101879103 268
482 3300010375 Ga0105239_10330002 Ga0105239_103300022 268
483 3300025250 Ga0209026_1000141 Ga0209026_100014192 268
484 3300025254 Ga0209148_1000111 Ga0209148_100011141 268
485 3300025254 Ga0209148_1019152 Ga0209148_10191522 268
486 3300025256 Ga0209759_1000354 Ga0209759_100035431 268
487 3300025261 Ga0209233_1032775 Ga0209233_10327752 268
488 3300025272 Ga0209455_1000206 Ga0209455_100020640 268
489 3300025297 Ga0209758_1014158 Ga0209758_10141583 268
490 3300025904 Ga0207647_10043176 Ga0207647_100431762 268
491 3300025924 Ga0207694_10049985 Ga0207694_100499855 268
492 3300025949 Ga0207667_10355538 Ga0207667_103555383 268
493 3300026041 Ga0207639_10297492 Ga0207639_102974922 268
494 3300037418 Ga0395900_0297530 Ga0395900_0297530_355_1218 268
495 3300037471 Ga0395905_0025305 Ga0395905_0025305_4259_5122 268
496 3300044658 Ga0466972_0018590 Ga0466972_0018590_1338_2198 268
497 3300046512 Ga0495610_0041751 Ga0495610_0041751_1378_2238 268
498 3300046660 Ga0495625_0054747 Ga0495625_0054747_1919_2779 268
499 3300046660 Ga0495625_0196167 Ga0495625_0196167_339_1223 268
500 3300047470 Ga0495681_0063185 Ga0495681_0063185_403_1263 268
501 3300047472 Ga0495686_0104364 Ga0495686_0104364_749_1609 268
502 3300048915 Ga0496112_0065977 Ga0496112_0065977_558_1421 268
503 3300048921 Ga0496118_0036064 Ga0496118_0036064_2257_3117 268
504 3300048923 Ga0496120_0002869 Ga0496120_0002869_14519_15379 268
505 3300048923 Ga0496120_0067307 Ga0496120_0067307_532_1392 268
506 3300048924 Ga0496121_0206842 Ga0496121_0206842_124_984 268
507 3300048929 Ga0496126_0145305 Ga0496126_0145305_682_1542 268
508 3300048929 Ga0496126_0244142 Ga0496126_0244142_626_1486 268
509 3300049742 Ga0501080_0522556 Ga0501080_0522556_115_978 268
510 3300050491 nmdc:mga00v17_36310_c1 nmdc:mga00v17_36310_c1_979_1839 268
511 3300050492 nmdc:mga0yw44_146641_c1 nmdc:mga0yw44_146641_c1_411_1271 268
512 3300053134 Ga0500658_0090920 Ga0500658_0090920_416_1276 268
513 3300053151 Ga0500604_0060622 Ga0500604_0060622_238_1098 268
514 3300053151 Ga0500604_0061790 Ga0500604_0061790_61_921 268
515 3300053155 Ga0500620_007038 Ga0500620_007038_1306_2166 268
516 3300053158 Ga0500627_0074170 Ga0500627_0074170_386_1246 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

122

293

0.98

Feature Viewer

pLDDT pTM Quality
74.29 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map