F458040

General Info

Members Datasets Scaffolds Average Seq Length
516 296 1032 174

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0006713|Ga0495580_0006713_3199_3726
Length 169
Sequence MKVANIVLASALFFAVEVVVAQEAAPNDAQIASIVVTANQVDINAGKLATSKASDKDVKAFARQMVTDHTGVNKSASALVTKLKVKPEDNPTSESLKAGGEQNVQGAAFDSAYIDNEVTYHQTVIDAMDKTLIPSAKNEELKDLLVKVRPAFVAHLEHAKQIQASLGKK

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
294 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
295 2818991450 Burkholderia sp. 604 Isolate Unclassified
296 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 2.71
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 0
Rhizoplane 2.91
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 16.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0006713 3300046472 Bacteria 9341
2 JGI24743J22301_10063963 3300001991 Unclassified 761
3 JGI25165J46597_1000544 3300003214 Bacteria 34636
4 Ga0058863_11958704 3300004799 Bacteria 1257
5 Ga0058861_11851302 3300004800 Bacteria 745
6 Ga0058861_12040947 3300004800 Bacteria 604
7 Ga0058862_12294519 3300004803 Bacteria 768
8 Ga0058862_12543922 3300004803 Bacteria 975
9 Ga0065712_10095526 3300005290 Bacteria 2216
10 Ga0065712_10115049 3300005290 Unclassified 1757
11 Ga0065715_10125731 3300005293 Unclassified 2124
12 Ga0070658_10033457 3300005327 Bacteria 4136
13 Ga0070658_10035801 3300005327 Bacteria 3999
14 Ga0070658_10059969 3300005327 Unclassified 3098
15 Ga0070658_10199247 3300005327 Bacteria 1689
16 Ga0070676_10051069 3300005328 Unclassified 2427
17 Ga0070676_10222154 3300005328 Bacteria 1248
18 Ga0070683_100010426 3300005329 Bacteria 7992
19 Ga0070683_100015459 3300005329 Bacteria 6705
20 Ga0070683_100060743 3300005329 Unclassified 3513
21 Ga0070670_100007454 3300005331 Bacteria 9292
22 Ga0070670_100138282 3300005331 Bacteria 2106
23 Ga0070670_100521405 3300005331 Bacteria 1058
24 Ga0070677_10013399 3300005333 Unclassified 2866
25 Ga0070677_10202415 3300005333 Bacteria 959
26 Ga0068869_100527777 3300005334 Bacteria 989
27 Ga0070666_10340176 3300005335 Unclassified 1072
28 Ga0070666_10452432 3300005335 Bacteria 927
29 Ga0070680_100207854 3300005336 Unclassified 1651
30 Ga0070680_100237253 3300005336 Bacteria 1541
31 Ga0070680_100389620 3300005336 Unclassified 1187
32 Ga0068868_100003384 3300005338 Bacteria 11099
33 Ga0070660_100030440 3300005339 Unclassified 4050
34 Ga0070660_100127058 3300005339 Bacteria 2038
35 Ga0070660_100236299 3300005339 Bacteria 1488
36 Ga0070660_100343441 3300005339 Unclassified 1228
37 Ga0070660_100669888 3300005339 Bacteria 869
38 Ga0070689_100079909 3300005340 Bacteria 2566
39 Ga0070691_10013802 3300005341 Bacteria 3708
40 Ga0070691_10112473 3300005341 Bacteria 1363
41 Ga0070687_100609033 3300005343 Bacteria 751
42 Ga0070661_100009017 3300005344 Bacteria 6900
43 Ga0070661_100010499 3300005344 Bacteria 6442
44 Ga0070661_100121506 3300005344 Bacteria 1957
45 Ga0070661_100397643 3300005344 Bacteria 1089
46 Ga0070661_101013504 3300005344 Bacteria 689
47 Ga0070692_10111863 3300005345 Unclassified 1511
48 Ga0070669_100033796 3300005353 Bacteria 3700
49 Ga0070669_100499016 3300005353 Unclassified 1009
50 Ga0070675_100004443 3300005354 Bacteria 10690
51 Ga0070675_100056012 3300005354 Bacteria 3247
52 Ga0070675_100198606 3300005354 Bacteria 1740
53 Ga0070675_100297730 3300005354 Bacteria 1421
54 Ga0070671_100002489 3300005355 Bacteria 14252
55 Ga0070671_100004313 3300005355 Bacteria 11251
56 Ga0070671_100027823 3300005355 Bacteria 4654
57 Ga0070671_100560008 3300005355 Bacteria 986
58 Ga0070674_100005918 3300005356 Bacteria 7111
59 Ga0070674_100301555 3300005356 Unclassified 1277
60 Ga0070673_100001254 3300005364 Bacteria 14739
61 Ga0070673_100042182 3300005364 Bacteria 3516
62 Ga0070673_100094791 3300005364 Bacteria 2447
63 Ga0070659_100011094 3300005366 Bacteria 6657
64 Ga0070659_100125032 3300005366 Unclassified 2086
65 Ga0070659_100195137 3300005366 Bacteria 1665
66 Ga0070659_100604672 3300005366 Bacteria 942
67 Ga0070659_100908826 3300005366 Bacteria 770
68 Ga0070667_100057369 3300005367 Bacteria 3291
69 Ga0070667_100217404 3300005367 Bacteria 1700
70 Ga0070667_100564269 3300005367 Bacteria 1047
71 Ga0070709_10331062 3300005434 Bacteria 1120
72 Ga0070714_100003202 3300005435 Bacteria 12179
73 Ga0070714_100013727 3300005435 Bacteria 6496
74 Ga0070714_100647182 3300005435 Bacteria 1017
75 Ga0070713_100006630 3300005436 Bacteria 8050
76 Ga0070710_10029833 3300005437 Bacteria 2929
77 Ga0070705_100378923 3300005440 Bacteria 1041
78 Ga0070700_100647088 3300005441 Unclassified 834
79 Ga0070663_100052764 3300005455 Bacteria 2901
80 Ga0070678_100001420 3300005456 Bacteria 12746
81 Ga0070678_100564043 3300005456 Unclassified 1012
82 Ga0070662_100160288 3300005457 Unclassified 1759
83 Ga0070662_100196054 3300005457 Bacteria 1600
84 Ga0070662_100777579 3300005457 Bacteria 813
85 Ga0070681_10001728 3300005458 Bacteria 19562
86 Ga0070681_10003080 3300005458 Bacteria 15474
87 Ga0070681_10044779 3300005458 Unclassified 4430
88 Ga0068867_100009799 3300005459 Bacteria 6752
89 Ga0070685_11070481 3300005466 Bacteria 608
90 Ga0070706_100107419 3300005467 Bacteria 2596
91 Ga0070707_100105507 3300005468 Bacteria 2732
92 Ga0070698_100227722 3300005471 Bacteria 1797
93 Ga0070699_100773232 3300005518 Bacteria 878
94 Ga0070679_100050478 3300005530 Bacteria 4144
95 Ga0070679_100071084 3300005530 Unclassified 3471
96 Ga0070679_100225157 3300005530 Bacteria 1836
97 Ga0070679_100992402 3300005530 Bacteria 784
98 Ga0070684_100006015 3300005535 Bacteria 9347
99 Ga0070684_100447191 3300005535 Bacteria 1194
100 Ga0070697_100368511 3300005536 Bacteria 1242
101 Ga0068853_100015978 3300005539 Bacteria 6172
102 Ga0070672_100031328 3300005543 Bacteria 4002
103 Ga0070672_100038378 3300005543 Bacteria 3660
104 Ga0070672_100392806 3300005543 Bacteria 1188
105 Ga0070696_100639077 3300005546 Bacteria 862
106 Ga0070693_100001317 3300005547 Bacteria 11188
107 Ga0070693_100067382 3300005547 Unclassified 2098
108 Ga0070693_100274587 3300005547 Bacteria 1126
109 Ga0070704_100864150 3300005549 Bacteria 811
110 Ga0068855_100007905 3300005563 Bacteria 12849
111 Ga0068855_100039692 3300005563 Bacteria 5588
112 Ga0068855_100434818 3300005563 Bacteria 1434
113 Ga0070664_100004856 3300005564 Bacteria 10767
114 Ga0070664_100010215 3300005564 Bacteria 7613
115 Ga0070664_100043399 3300005564 Bacteria 3794
116 Ga0070664_100188796 3300005564 Bacteria 1835
117 Ga0070664_100402635 3300005564 Bacteria 1251
118 Ga0070664_100406682 3300005564 Bacteria 1245
119 Ga0070664_100966643 3300005564 Bacteria 800
120 Ga0068857_100008433 3300005577 Bacteria 8906
121 Ga0068857_100290095 3300005577 Bacteria 1506
122 Ga0068854_100002135 3300005578 Bacteria 12141
123 Ga0068854_100008413 3300005578 Bacteria 6632
124 Ga0068854_100010458 3300005578 Bacteria 6018
125 Ga0068856_100011798 3300005614 Bacteria 8469
126 Ga0068856_100119617 3300005614 Bacteria 2635
127 Ga0068856_100697834 3300005614 Bacteria 1035
128 Ga0070702_100045690 3300005615 Unclassified 2479
129 Ga0070702_100344445 3300005615 Bacteria 1047
130 Ga0068852_100001496 3300005616 Bacteria 15807
131 Ga0068852_100004957 3300005616 Bacteria 9459
132 Ga0068852_100561069 3300005616 Bacteria 1143
133 Ga0068852_100624039 3300005616 Bacteria 1084
134 Ga0068859_100075590 3300005617 Bacteria 3409
135 Ga0068859_100213849 3300005617 Bacteria 2015
136 Ga0068859_100941767 3300005617 Bacteria 947
137 Ga0068864_100024027 3300005618 Bacteria 5124
138 Ga0068864_100174634 3300005618 Bacteria 1961
139 Ga0068861_100243164 3300005719 Bacteria 1532
140 Ga0068851_10000947 3300005834 Bacteria 12546
141 Ga0068851_10052442 3300005834 Unclassified 2074
142 Ga0068863_100084610 3300005841 Unclassified 3006
143 Ga0068863_100210636 3300005841 Bacteria 1872
144 Ga0068860_100543539 3300005843 Unclassified 1163
145 Ga0068862_101005734 3300005844 Bacteria 825
146 Ga0075368_10013656 3300006042 Bacteria 2985
147 Ga0075363_100160214 3300006048 Bacteria 1274
148 Ga0075364_10090364 3300006051 Bacteria 2031
149 Ga0075364_10122738 3300006051 Bacteria 1740
150 Ga0070715_10359070 3300006163 Bacteria 798
151 Ga0075362_10382944 3300006177 Bacteria 708
152 Ga0075367_10030186 3300006178 Bacteria 3106
153 Ga0075367_10053607 3300006178 Bacteria 2390
154 Ga0075367_10249626 3300006178 Bacteria 1113
155 Ga0075369_10208903 3300006186 Bacteria 902
156 Ga0075366_10024002 3300006195 Bacteria 3555
157 Ga0075366_10092681 3300006195 Bacteria 1810
158 Ga0075366_10264031 3300006195 Bacteria 1051
159 Ga0097621_100003236 3300006237 Bacteria 11194
160 Ga0097621_100314004 3300006237 Bacteria 1387
161 Ga0075370_10061661 3300006353 Bacteria 2136
162 Ga0068871_100005716 3300006358 Bacteria 8733
163 Ga0068871_101891806 3300006358 Bacteria 567
164 Ga0075431_100009727 3300006847 Bacteria 9656
165 Ga0075431_100029252 3300006847 Bacteria 5669
166 Ga0075433_10053247 3300006852 Bacteria 3527
167 Ga0075433_10375515 3300006852 Bacteria 1255
168 Ga0075434_100004364 3300006871 Bacteria 12738
169 Ga0075434_100052885 3300006871 Bacteria 4036
170 Ga0075434_100460991 3300006871 Bacteria 1292
171 Ga0075434_100941588 3300006871 Bacteria 878
172 Ga0075429_100147228 3300006880 Bacteria 2061
173 Ga0075429_100415220 3300006880 Bacteria 1178
174 Ga0068865_100086406 3300006881 Unclassified 2264
175 Ga0075436_100872095 3300006914 Bacteria 672
176 Ga0097620_100075592 3300006931 Bacteria 3409
177 Ga0097620_100213867 3300006931 Bacteria 2015
178 Ga0097620_100941981 3300006931 Bacteria 947
179 Ga0075435_100295788 3300007076 Unclassified 1384
180 Ga0105240_10004747 3300009093 Bacteria 20520
181 Ga0105240_10012847 3300009093 Bacteria 11537
182 Ga0105240_10024216 3300009093 Bacteria 8010
183 Ga0111539_10232166 3300009094 Bacteria 2148
184 Ga0105245_10078554 3300009098 Unclassified 3011
185 Ga0105247_10153746 3300009101 Bacteria 1518
186 Ga0114129_10012314 3300009147 Bacteria 12170
187 Ga0114129_10106940 3300009147 Bacteria 3864
188 Ga0114129_10111149 3300009147 Bacteria 3782
189 Ga0114129_10487178 3300009147 Bacteria 1612
190 Ga0105241_10004341 3300009174 Bacteria 10482
191 Ga0105241_10011622 3300009174 Bacteria 6456
192 Ga0105241_11346866 3300009174 Bacteria 681
193 Ga0105242_10792713 3300009176 Unclassified 937
194 Ga0105248_10188353 3300009177 Unclassified 2325
195 Ga0105248_10322367 3300009177 Bacteria 1740
196 Ga0105237_10056643 3300009545 Bacteria 3923
197 Ga0105237_10251585 3300009545 Unclassified 1769
198 Ga0105238_10010502 3300009551 Bacteria 9294
199 Ga0105238_10014343 3300009551 Bacteria 8010
200 Ga0105238_10268040 3300009551 Bacteria 1688
201 Ga0105238_10388643 3300009551 Bacteria 1387
202 Ga0105239_10074907 3300010375 Unclassified 3721
203 Ga0157373_10024652 3300013100 Unclassified 4357
204 Ga0157371_10316358 3300013102 Bacteria 1132
205 Ga0157370_10062058 3300013104 Unclassified 3545
206 Ga0157370_10078547 3300013104 Bacteria 3108
207 Ga0157370_10305269 3300013104 Bacteria 1469
208 Ga0157369_10053814 3300013105 Unclassified 4348
209 Ga0157374_10012362 3300013296 Bacteria 7427
210 Ga0157374_10080285 3300013296 Unclassified 3093
211 Ga0157378_10002306 3300013297 Bacteria 16968
212 Ga0157372_10011050 3300013307 Bacteria 9606
213 Ga0157372_10067345 3300013307 Bacteria 4023
214 Ga0157372_10130878 3300013307 Bacteria 2887
215 Ga0157372_10352608 3300013307 Bacteria 1714
216 Ga0157375_10030256 3300013308 Bacteria 5103
217 Ga0157375_10224105 3300013308 Bacteria 2039
218 Ga0157380_10637900 3300014326 Bacteria 1060
219 Ga0157376_10003036 3300014969 Bacteria 11496
220 Ga0163161_10061600 3300017792 Bacteria 2732
221 Ga0163161_10100464 3300017792 Unclassified 2153
222 Ga0163161_10409410 3300017792 Bacteria 1089
223 Ga0206356_10180786 3300020070 Bacteria 690
224 Ga0206356_11092758 3300020070 Bacteria 890
225 Ga0224712_10125796 3300022467 Bacteria 1114
226 Ga0207427_101873 3300025231 Bacteria 6639
227 Ga0209233_1000018 3300025261 Bacteria 886857
228 Ga0209051_1034684 3300025303 Bacteria 1888
229 Ga0207697_10147384 3300025315 Bacteria 1023
230 Ga0207697_10293717 3300025315 Unclassified 721
231 Ga0207656_10000881 3300025321 Bacteria 9790
232 Ga0207656_10098282 3300025321 Unclassified 1339
233 Ga0207682_10016830 3300025893 Unclassified 2853
234 Ga0207682_10262550 3300025893 Bacteria 805
235 Ga0207692_10021679 3300025898 Bacteria 2942
236 Ga0207710_10145106 3300025900 Bacteria 1148
237 Ga0207688_10033481 3300025901 Bacteria 2843
238 Ga0207688_10227708 3300025901 Bacteria 1125
239 Ga0207680_10018301 3300025903 Unclassified 3721
240 Ga0207645_10187911 3300025907 Unclassified 1357
241 Ga0207645_10398360 3300025907 Bacteria 925
242 Ga0207705_10025709 3300025909 Bacteria 4201
243 Ga0207705_10036105 3300025909 Bacteria 3537
244 Ga0207705_10681451 3300025909 Bacteria 799
245 Ga0207654_10238415 3300025911 Bacteria 1214
246 Ga0207707_10107564 3300025912 Bacteria 2438
247 Ga0207707_10180732 3300025912 Unclassified 1842
248 Ga0207707_10201663 3300025912 Unclassified 1734
249 Ga0207707_10292088 3300025912 Bacteria 1410
250 Ga0207695_10031880 3300025913 Bacteria 5773
251 Ga0207695_10086935 3300025913 Bacteria 3151
252 Ga0207695_10115140 3300025913 Bacteria 2663
253 Ga0207671_10275558 3300025914 Unclassified 1326
254 Ga0207660_10279734 3300025917 Bacteria 1324
255 Ga0207660_10345738 3300025917 Unclassified 1191
256 Ga0207660_10770887 3300025917 Unclassified 785
257 Ga0207662_10778420 3300025918 Bacteria 674
258 Ga0207657_10056848 3300025919 Unclassified 3374
259 Ga0207657_10180222 3300025919 Bacteria 1708
260 Ga0207657_10301892 3300025919 Bacteria 1268
261 Ga0207657_10578992 3300025919 Bacteria 877
262 Ga0207657_10637985 3300025919 Bacteria 830
263 Ga0207649_10018892 3300025920 Unclassified 3931
264 Ga0207649_10037437 3300025920 Plasmid 2931
265 Ga0207649_10611267 3300025920 Bacteria 839
266 Ga0207652_10106496 3300025921 Unclassified 2482
267 Ga0207652_10151626 3300025921 Unclassified 2076
268 Ga0207652_10234615 3300025921 Bacteria 1653
269 Ga0207646_10010475 3300025922 Bacteria 9055
270 Ga0207681_10149879 3300025923 Bacteria 1747
271 Ga0207694_10004542 3300025924 Bacteria 10825
272 Ga0207694_10053907 3300025924 Bacteria 3119
273 Ga0207694_10785759 3300025924 Bacteria 804
274 Ga0207650_10000992 3300025925 Bacteria 21360
275 Ga0207650_10136363 3300025925 Bacteria 1925
276 Ga0207650_10293177 3300025925 Bacteria 1327
277 Ga0207650_10491298 3300025925 Bacteria 1025
278 Ga0207659_10002555 3300025926 Bacteria 10827
279 Ga0207659_10035446 3300025926 Bacteria 3448
280 Ga0207659_10640558 3300025926 Bacteria 908
281 Ga0207687_10148470 3300025927 Unclassified 1786
282 Ga0207700_10024493 3300025928 Bacteria 4178
283 Ga0207664_10010376 3300025929 Bacteria 6578
284 Ga0207644_10004917 3300025931 Bacteria 8711
285 Ga0207644_10081599 3300025931 Bacteria 2390
286 Ga0207644_10126826 3300025931 Bacteria 1949
287 Ga0207644_10300766 3300025931 Bacteria 1293
288 Ga0207644_11043059 3300025931 Bacteria 687
289 Ga0207690_10007158 3300025932 Bacteria 6627
290 Ga0207690_10138617 3300025932 Bacteria 1790
291 Ga0207690_10241657 3300025932 Bacteria 1391
292 Ga0207690_10288269 3300025932 Bacteria 1281
293 Ga0207690_10319278 3300025932 Unclassified 1220
294 Ga0207706_10001379 3300025933 Bacteria 24277
295 Ga0207706_10178070 3300025933 Bacteria 1868
296 Ga0207706_10212557 3300025933 Unclassified 1695
297 Ga0207706_10992670 3300025933 Bacteria 706
298 Ga0207686_10000512 3300025934 Bacteria 25164
299 Ga0207686_10950342 3300025934 Unclassified 695
300 Ga0207669_10263641 3300025937 Unclassified 1290
301 Ga0207669_10558707 3300025937 Bacteria 925
302 Ga0207691_10008496 3300025940 Bacteria 9862
303 Ga0207691_10029548 3300025940 Bacteria 5127
304 Ga0207691_10148314 3300025940 Bacteria 2063
305 Ga0207711_10253392 3300025941 Unclassified 1617
306 Ga0207711_10373027 3300025941 Bacteria 1323
307 Ga0207689_10581426 3300025942 Bacteria 942
308 Ga0207661_10005530 3300025944 Bacteria 8915
309 Ga0207661_10231767 3300025944 Unclassified 1635
310 Ga0207661_10260621 3300025944 Unclassified 1544
311 Ga0207679_10004399 3300025945 Bacteria 8774
312 Ga0207679_10042640 3300025945 Unclassified 3262
313 Ga0207679_10043914 3300025945 Bacteria 3221
314 Ga0207679_10241078 3300025945 Bacteria 1532
315 Ga0207679_10361044 3300025945 Bacteria 1269
316 Ga0207679_11817699 3300025945 Bacteria 557
317 Ga0207667_10020214 3300025949 Bacteria 7409
318 Ga0207651_10006435 3300025960 Bacteria 6146
319 Ga0207651_10071376 3300025960 Bacteria 2461
320 Ga0207651_10350904 3300025960 Bacteria 1242
321 Ga0207640_10009846 3300025981 Bacteria 5364
322 Ga0207640_10091133 3300025981 Unclassified 2111
323 Ga0207640_10152969 3300025981 Bacteria 1697
324 Ga0207658_10745937 3300025986 Bacteria 886
325 Ga0207703_11477871 3300026035 Bacteria 654
326 Ga0207639_10321834 3300026041 Unclassified 1373
327 Ga0207678_10024607 3300026067 Bacteria 5259
328 Ga0207708_10221667 3300026075 Bacteria 1515
329 Ga0207702_10008792 3300026078 Bacteria 8513
330 Ga0207702_10968504 3300026078 Bacteria 844
331 Ga0207641_10099375 3300026088 Unclassified 2560
332 Ga0207641_10114295 3300026088 Bacteria 2398
333 Ga0207641_10870385 3300026088 Bacteria 894
334 Ga0207648_10021020 3300026089 Bacteria 5875
335 Ga0207676_10204344 3300026095 Bacteria 1748
336 Ga0207676_10223533 3300026095 Unclassified 1678
337 Ga0207676_10388897 3300026095 Bacteria 1300
338 Ga0207674_10001588 3300026116 Bacteria 29245
339 Ga0207675_100024424 3300026118 Bacteria 5620
340 Ga0207683_10000340 3300026121 Bacteria 42502
341 Ga0207683_10001005 3300026121 Bacteria 25752
342 Ga0207683_10060621 3300026121 Bacteria 3326
343 Ga0207683_10232031 3300026121 Bacteria 1683
344 Ga0207698_10003379 3300026142 Bacteria 9614
345 Ga0207698_10019327 3300026142 Plasmid 4662
346 Ga0207698_10583239 3300026142 Bacteria 1100
347 Ga0210002_1011012 3300027617 Bacteria 1394
348 Ga0207428_10027270 3300027907 Bacteria 4757
349 Ga0307408_101430211 3300031548 Bacteria 652
350 Ga0307410_10091332 3300031852 Bacteria 2162
351 Ga0307407_10057747 3300031903 Bacteria 2253
352 Ga0307411_10223929 3300032005 Bacteria 1461
353 Ga0373950_0002186 3300034818 Bacteria 2663
354 Ga0373950_0017737 3300034818 Bacteria 1230
355 Ga0373923_0003440 3300035111 Bacteria 5074
356 Ga0373936_0060918 3300035113 Bacteria 1540
357 Ga0373957_0135351 3300035120 Bacteria 1005
358 Ga0373960_0006883 3300035121 Bacteria 2678
359 Ga0373927_0202199 3300035695 Bacteria 1304
360 Ga0373933_0041344 3300035724 Bacteria 2721
361 Ga0373947_0059537 3300035725 Bacteria 2315
362 Ga0373937_0019017 3300036401 Bacteria 6145
363 Ga0373937_0049593 3300036401 Bacteria 3844
364 Ga0373937_0205271 3300036401 Bacteria 1853
365 Ga0373925_0027236 3300037068 Bacteria 4185
366 Ga0373925_0338547 3300037068 Bacteria 1220
367 Ga0395905_0130297 3300037471 Bacteria 2366
368 Ga0395901_0006634 3300038443 Bacteria 11694
369 Ga0451807_1728393 3300041486 Unclassified 1312
370 Ga0451853_3305521 3300041512 Unclassified 1079
371 Ga0439464_0102658 3300042439 Bacteria 870
372 Ga0439464_0179823 3300042439 Bacteria 670
373 Ga0439460_0139304 3300042461 Unclassified 804
374 Ga0466972_0037206 3300044658 Bacteria 2379
375 Ga0466966_0037455 3300044684 Bacteria 3128
376 Ga0466964_0328533 3300044706 Unclassified 779
377 Ga0466971_0045438 3300044719 Unclassified 1973
378 Ga0451576_0141315 3300045051 Bacteria 2510
379 Ga0451576_0363210 3300045051 Bacteria 1516
380 Ga0495617_009989 3300046452 Bacteria 3254
381 Ga0495603_0199647 3300046455 Bacteria 1156
382 Ga0495629_0000015 3300046459 Bacteria 182026
383 Ga0495629_0097733 3300046459 Bacteria 2048
384 Ga0495651_0095110 3300046462 Bacteria 2229
385 Ga0495653_0000201 3300046463 Bacteria 48489
386 Ga0495580_0028032 3300046472 Bacteria 4095
387 Ga0495582_0027069 3300046473 Bacteria 3142
388 Ga0495639_0002962 3300046475 Bacteria 7387
389 Ga0495584_0004575 3300046491 Bacteria 7416
390 Ga0495585_0000011 3300046492 Bacteria 210440
391 Ga0495585_0002901 3300046492 Bacteria 11882
392 Ga0495585_0010347 3300046492 Bacteria 5559
393 Ga0495585_0071263 3300046492 Bacteria 1894
394 Ga0495594_0019773 3300046499 Bacteria 3582
395 Ga0495607_0027792 3300046501 Bacteria 3494
396 Ga0495583_0041985 3300046506 Bacteria 2139
397 Ga0495606_0062098 3300046507 Bacteria 2386
398 Ga0495606_0457453 3300046507 Bacteria 652
399 Ga0495616_0001527 3300046513 Bacteria 15941
400 Ga0495620_0004272 3300046515 Bacteria 8081
401 Ga0495628_0007697 3300046516 Bacteria 9308
402 Ga0495666_0010493 3300046526 Bacteria 4619
403 Ga0495666_0171447 3300046526 Bacteria 1003
404 Ga0495642_0004974 3300046528 Bacteria 5124
405 Ga0495652_0539973 3300046529 Bacteria 803
406 Ga0495665_0025276 3300046531 Bacteria 3190
407 Ga0495665_0025565 3300046531 Bacteria 3172
408 Ga0495665_0223412 3300046531 Bacteria 973
409 Ga0495640_0549116 3300046533 Bacteria 700
410 Ga0495586_0282467 3300046535 Bacteria 950
411 Ga0495645_0021835 3300046543 Bacteria 4627
412 Ga0495622_0109147 3300046557 Bacteria 1267
413 Ga0495633_0001893 3300046558 Bacteria 15266
414 Ga0495635_0097823 3300046663 Bacteria 2006
415 Ga0495659_0010265 3300046664 Bacteria 3000
416 Ga0495646_0061487 3300046680 Bacteria 2236
417 Ga0495647_0004971 3300046681 Bacteria 4352
418 Ga0495669_0040303 3300046684 Bacteria 2071
419 Ga0495669_0088281 3300046684 Bacteria 1429
420 Ga0495613_0236760 3300046689 Bacteria 1277
421 Ga0495613_0331876 3300046689 Bacteria 1048
422 Ga0495624_0002458 3300046690 Bacteria 14051
423 Ga0495624_0043915 3300046690 Bacteria 2850
424 Ga0495670_0000177 3300046691 Bacteria 28439
425 Ga0495649_0369816 3300046694 Bacteria 722
426 Ga0495600_0049396 3300046809 Bacteria 2745
427 Ga0495581_0048602 3300047315 Bacteria 2449
428 Ga0495604_0012201 3300047317 Bacteria 6830
429 Ga0495674_0218641 3300047319 Bacteria 1575
430 Ga0495674_0346241 3300047319 Bacteria 1207
431 Ga0495672_0002523 3300047320 Bacteria 16718
432 Ga0495672_0004029 3300047320 Bacteria 12288
433 Ga0495683_0371896 3300047323 Bacteria 599
434 Ga0495673_0176498 3300047469 Bacteria 811
435 Ga0495602_0565548 3300048088 Bacteria 786
436 Ga0495615_0076503 3300048090 Bacteria 911
437 Ga0496100_0097811 3300048903 Unclassified 2016
438 Ga0496101_0190752 3300048904 Bacteria 1581
439 Ga0496104_0068780 3300048907 Unclassified 3365
440 Ga0496104_0073154 3300048907 Bacteria 3261
441 Ga0496106_0530215 3300048909 Unclassified 945
442 Ga0496108_0012409 3300048911 Bacteria 6934
443 Ga0496109_0096798 3300048912 Unclassified 2734
444 Ga0496109_1122895 3300048912 Bacteria 723
445 Ga0496110_0013854 3300048913 Bacteria 6681
446 Ga0496110_0091807 3300048913 Bacteria 2717
447 Ga0496111_0317394 3300048914 Unclassified 1154
448 Ga0496114_0065863 3300048917 Unclassified 3036
449 Ga0496114_0273403 3300048917 Bacteria 1489
450 Ga0496115_0776949 3300048918 Unclassified 747
451 Ga0501036_0077871 3300049572 Bacteria 2805
452 Ga0501036_1119700 3300049572 Bacteria 643
453 Ga0501038_0028857 3300049574 Bacteria 4925
454 Ga0501038_0265524 3300049574 Bacteria 1355
455 Ga0501039_0251845 3300049575 Bacteria 1388
456 Ga0501039_0713347 3300049575 Bacteria 784
457 Ga0501040_0004302 3300049576 Bacteria 9250
458 Ga0501041_0000769 3300049577 Bacteria 17164
459 Ga0501042_0019844 3300049578 Bacteria 4673
460 Ga0501043_0469945 3300049579 Bacteria 943
461 Ga0501046_0047844 3300049580 Bacteria 3389
462 Ga0501048_0238292 3300049582 Bacteria 1291
463 Ga0501067_0052433 3300049583 Bacteria 2260
464 Ga0501068_0016625 3300049584 Bacteria 4242
465 Ga0501069_0336059 3300049585 Bacteria 889
466 Ga0501071_0786633 3300049587 Bacteria 733
467 Ga0501072_0006242 3300049588 Bacteria 9082
468 Ga0501072_0294687 3300049588 Bacteria 1289
469 Ga0501072_0811904 3300049588 Bacteria 732
470 Ga0501073_0128163 3300049589 Bacteria 1759
471 Ga0501074_0055188 3300049590 Bacteria 2864
472 Ga0501075_0058943 3300049591 Bacteria 2891
473 Ga0501075_0346295 3300049591 Bacteria 1132
474 Ga0501076_0046920 3300049592 Bacteria 3414
475 Ga0501077_0020875 3300049593 Bacteria 4146
476 Ga0501079_0071702 3300049741 Bacteria 2676
477 Ga0501080_0096568 3300049742 Bacteria 2744
478 Ga0501283_006132 3300049779 Bacteria 1674
479 Ga0501045_0000242 3300049824 Bacteria 31725
480 Ga0501045_0092380 3300049824 Bacteria 2238
481 nmdc:mga00v17_518090_c1 3300050491 Bacteria 772
482 nmdc:mga0k408_273716_c1 3300050493 Bacteria 1008
483 nmdc:mga0k408_57561_c1 3300050493 Bacteria 2257
484 nmdc:mga06z11_158229_c1 3300050494 Bacteria 1293
485 nmdc:mga06z11_73742_c1 3300050494 Bacteria 1813
486 nmdc:mga06z11_75002_c1 3300050494 Bacteria 1800
487 nmdc:mga04h51_275920_c1 3300050495 Bacteria 680
488 nmdc:mga05p37_1272422_c1 3300050507 Bacteria 753
489 nmdc:mga05p37_477458_c1 3300050507 Bacteria 1437
490 nmdc:mga09592_135708_c1 3300050508 Bacteria 2119
491 nmdc:mga06r32_87275_c1 3300050510 Bacteria 3044
492 nmdc:mga08y16_250_c1 3300050511 Bacteria 48435
493 nmdc:mga0n895_1237978_c1 3300050512 Bacteria 719
494 nmdc:mga0n895_226614_c1 3300050512 Unclassified 1897
495 nmdc:mga0n895_517888_c1 3300050512 Bacteria 1200
496 nmdc:mga0n895_856713_c1 3300050512 Bacteria 896
497 nmdc:mga0a205_174209_c2 3300050515 Bacteria 1686
498 Ga0495601_0568546 3300053077 Bacteria 729
499 Ga0495595_0266468 3300053084 Bacteria 859
500 Ga0495619_0459228 3300053085 Bacteria 877
501 Ga0501084_0001014 3300054114 Bacteria 21788
502 Ga0590071_022149 3300059421 Bacteria 1499
503 Ga0587088_006084 3300059508 Unclassified 1613
504 Ga0587089_001984 3300059509 Bacteria 2008
505 Ga0587091_000754 3300059511 Unclassified 3075
506 Ga0587094_020116 3300059513 Unclassified 963
507 Ga0587128_001186 3300059630 Bacteria 2373
508 Ga0587130_009873 3300059631 Unclassified 925
509 Ga0501082_0002223 3300060353 Bacteria 16968
510 Ga0501082_0921465 3300060353 Bacteria 764
511 Ga0466962_0065769 3300061719 Unclassified 1731
512 Ga0530510_0000156 3300061734 Bacteria 40875
513 Ga0530510_1008014 3300061734 Bacteria 637
514 2644027210 2643221603 Bacteria 6147767
515 2819620723 2818991450 Bacteria 6962147
516 2928504334 2928503688 Bacteria 7268108
517 Ga0495580_0006713
518 JGI24743J22301_10063963
519 JGI25165J46597_1000544
520 Ga0058863_11958704
521 Ga0058861_11851302
522 Ga0058861_12040947
523 Ga0058862_12294519
524 Ga0058862_12543922
525 Ga0065712_10095526
526 Ga0065712_10115049
527 Ga0065715_10125731
528 Ga0070658_10033457
529 Ga0070658_10035801
530 Ga0070658_10059969
531 Ga0070658_10199247
532 Ga0070676_10051069
533 Ga0070676_10222154
534 Ga0070683_100010426
535 Ga0070683_100015459
536 Ga0070683_100060743
537 Ga0070670_100007454
538 Ga0070670_100138282
539 Ga0070670_100521405
540 Ga0070677_10013399
541 Ga0070677_10202415
542 Ga0068869_100527777
543 Ga0070666_10340176
544 Ga0070666_10452432
545 Ga0070680_100207854
546 Ga0070680_100237253
547 Ga0070680_100389620
548 Ga0068868_100003384
549 Ga0070660_100030440
550 Ga0070660_100127058
551 Ga0070660_100236299
552 Ga0070660_100343441
553 Ga0070660_100669888
554 Ga0070689_100079909
555 Ga0070691_10013802
556 Ga0070691_10112473
557 Ga0070687_100609033
558 Ga0070661_100009017
559 Ga0070661_100010499
560 Ga0070661_100121506
561 Ga0070661_100397643
562 Ga0070661_101013504
563 Ga0070692_10111863
564 Ga0070669_100033796
565 Ga0070669_100499016
566 Ga0070675_100004443
567 Ga0070675_100056012
568 Ga0070675_100198606
569 Ga0070675_100297730
570 Ga0070671_100002489
571 Ga0070671_100004313
572 Ga0070671_100027823
573 Ga0070671_100560008
574 Ga0070674_100005918
575 Ga0070674_100301555
576 Ga0070673_100001254
577 Ga0070673_100042182
578 Ga0070673_100094791
579 Ga0070659_100011094
580 Ga0070659_100125032
581 Ga0070659_100195137
582 Ga0070659_100604672
583 Ga0070659_100908826
584 Ga0070667_100057369
585 Ga0070667_100217404
586 Ga0070667_100564269
587 Ga0070709_10331062
588 Ga0070714_100003202
589 Ga0070714_100013727
590 Ga0070714_100647182
591 Ga0070713_100006630
592 Ga0070710_10029833
593 Ga0070705_100378923
594 Ga0070700_100647088
595 Ga0070663_100052764
596 Ga0070678_100001420
597 Ga0070678_100564043
598 Ga0070662_100160288
599 Ga0070662_100196054
600 Ga0070662_100777579
601 Ga0070681_10001728
602 Ga0070681_10003080
603 Ga0070681_10044779
604 Ga0068867_100009799
605 Ga0070685_11070481
606 Ga0070706_100107419
607 Ga0070707_100105507
608 Ga0070698_100227722
609 Ga0070699_100773232
610 Ga0070679_100050478
611 Ga0070679_100071084
612 Ga0070679_100225157
613 Ga0070679_100992402
614 Ga0070684_100006015
615 Ga0070684_100447191
616 Ga0070697_100368511
617 Ga0068853_100015978
618 Ga0070672_100031328
619 Ga0070672_100038378
620 Ga0070672_100392806
621 Ga0070696_100639077
622 Ga0070693_100001317
623 Ga0070693_100067382
624 Ga0070693_100274587
625 Ga0070704_100864150
626 Ga0068855_100007905
627 Ga0068855_100039692
628 Ga0068855_100434818
629 Ga0070664_100004856
630 Ga0070664_100010215
631 Ga0070664_100043399
632 Ga0070664_100188796
633 Ga0070664_100402635
634 Ga0070664_100406682
635 Ga0070664_100966643
636 Ga0068857_100008433
637 Ga0068857_100290095
638 Ga0068854_100002135
639 Ga0068854_100008413
640 Ga0068854_100010458
641 Ga0068856_100011798
642 Ga0068856_100119617
643 Ga0068856_100697834
644 Ga0070702_100045690
645 Ga0070702_100344445
646 Ga0068852_100001496
647 Ga0068852_100004957
648 Ga0068852_100561069
649 Ga0068852_100624039
650 Ga0068859_100075590
651 Ga0068859_100213849
652 Ga0068859_100941767
653 Ga0068864_100024027
654 Ga0068864_100174634
655 Ga0068861_100243164
656 Ga0068851_10000947
657 Ga0068851_10052442
658 Ga0068863_100084610
659 Ga0068863_100210636
660 Ga0068860_100543539
661 Ga0068862_101005734
662 Ga0075368_10013656
663 Ga0075363_100160214
664 Ga0075364_10090364
665 Ga0075364_10122738
666 Ga0070715_10359070
667 Ga0075362_10382944
668 Ga0075367_10030186
669 Ga0075367_10053607
670 Ga0075367_10249626
671 Ga0075369_10208903
672 Ga0075366_10024002
673 Ga0075366_10092681
674 Ga0075366_10264031
675 Ga0097621_100003236
676 Ga0097621_100314004
677 Ga0075370_10061661
678 Ga0068871_100005716
679 Ga0068871_101891806
680 Ga0075431_100009727
681 Ga0075431_100029252
682 Ga0075433_10053247
683 Ga0075433_10375515
684 Ga0075434_100004364
685 Ga0075434_100052885
686 Ga0075434_100460991
687 Ga0075434_100941588
688 Ga0075429_100147228
689 Ga0075429_100415220
690 Ga0068865_100086406
691 Ga0075436_100872095
692 Ga0097620_100075592
693 Ga0097620_100213867
694 Ga0097620_100941981
695 Ga0075435_100295788
696 Ga0105240_10004747
697 Ga0105240_10012847
698 Ga0105240_10024216
699 Ga0111539_10232166
700 Ga0105245_10078554
701 Ga0105247_10153746
702 Ga0114129_10012314
703 Ga0114129_10106940
704 Ga0114129_10111149
705 Ga0114129_10487178
706 Ga0105241_10004341
707 Ga0105241_10011622
708 Ga0105241_11346866
709 Ga0105242_10792713
710 Ga0105248_10188353
711 Ga0105248_10322367
712 Ga0105237_10056643
713 Ga0105237_10251585
714 Ga0105238_10010502
715 Ga0105238_10014343
716 Ga0105238_10268040
717 Ga0105238_10388643
718 Ga0105239_10074907
719 Ga0157373_10024652
720 Ga0157371_10316358
721 Ga0157370_10062058
722 Ga0157370_10078547
723 Ga0157370_10305269
724 Ga0157369_10053814
725 Ga0157374_10012362
726 Ga0157374_10080285
727 Ga0157378_10002306
728 Ga0157372_10011050
729 Ga0157372_10067345
730 Ga0157372_10130878
731 Ga0157372_10352608
732 Ga0157375_10030256
733 Ga0157375_10224105
734 Ga0157380_10637900
735 Ga0157376_10003036
736 Ga0163161_10061600
737 Ga0163161_10100464
738 Ga0163161_10409410
739 Ga0206356_10180786
740 Ga0206356_11092758
741 Ga0224712_10125796
742 Ga0207427_101873
743 Ga0209233_1000018
744 Ga0209051_1034684
745 Ga0207697_10147384
746 Ga0207697_10293717
747 Ga0207656_10000881
748 Ga0207656_10098282
749 Ga0207682_10016830
750 Ga0207682_10262550
751 Ga0207692_10021679
752 Ga0207710_10145106
753 Ga0207688_10033481
754 Ga0207688_10227708
755 Ga0207680_10018301
756 Ga0207645_10187911
757 Ga0207645_10398360
758 Ga0207705_10025709
759 Ga0207705_10036105
760 Ga0207705_10681451
761 Ga0207654_10238415
762 Ga0207707_10107564
763 Ga0207707_10180732
764 Ga0207707_10201663
765 Ga0207707_10292088
766 Ga0207695_10031880
767 Ga0207695_10086935
768 Ga0207695_10115140
769 Ga0207671_10275558
770 Ga0207660_10279734
771 Ga0207660_10345738
772 Ga0207660_10770887
773 Ga0207662_10778420
774 Ga0207657_10056848
775 Ga0207657_10180222
776 Ga0207657_10301892
777 Ga0207657_10578992
778 Ga0207657_10637985
779 Ga0207649_10018892
780 Ga0207649_10037437
781 Ga0207649_10611267
782 Ga0207652_10106496
783 Ga0207652_10151626
784 Ga0207652_10234615
785 Ga0207646_10010475
786 Ga0207681_10149879
787 Ga0207694_10004542
788 Ga0207694_10053907
789 Ga0207694_10785759
790 Ga0207650_10000992
791 Ga0207650_10136363
792 Ga0207650_10293177
793 Ga0207650_10491298
794 Ga0207659_10002555
795 Ga0207659_10035446
796 Ga0207659_10640558
797 Ga0207687_10148470
798 Ga0207700_10024493
799 Ga0207664_10010376
800 Ga0207644_10004917
801 Ga0207644_10081599
802 Ga0207644_10126826
803 Ga0207644_10300766
804 Ga0207644_11043059
805 Ga0207690_10007158
806 Ga0207690_10138617
807 Ga0207690_10241657
808 Ga0207690_10288269
809 Ga0207690_10319278
810 Ga0207706_10001379
811 Ga0207706_10178070
812 Ga0207706_10212557
813 Ga0207706_10992670
814 Ga0207686_10000512
815 Ga0207686_10950342
816 Ga0207669_10263641
817 Ga0207669_10558707
818 Ga0207691_10008496
819 Ga0207691_10029548
820 Ga0207691_10148314
821 Ga0207711_10253392
822 Ga0207711_10373027
823 Ga0207689_10581426
824 Ga0207661_10005530
825 Ga0207661_10231767
826 Ga0207661_10260621
827 Ga0207679_10004399
828 Ga0207679_10042640
829 Ga0207679_10043914
830 Ga0207679_10241078
831 Ga0207679_10361044
832 Ga0207679_11817699
833 Ga0207667_10020214
834 Ga0207651_10006435
835 Ga0207651_10071376
836 Ga0207651_10350904
837 Ga0207640_10009846
838 Ga0207640_10091133
839 Ga0207640_10152969
840 Ga0207658_10745937
841 Ga0207703_11477871
842 Ga0207639_10321834
843 Ga0207678_10024607
844 Ga0207708_10221667
845 Ga0207702_10008792
846 Ga0207702_10968504
847 Ga0207641_10099375
848 Ga0207641_10114295
849 Ga0207641_10870385
850 Ga0207648_10021020
851 Ga0207676_10204344
852 Ga0207676_10223533
853 Ga0207676_10388897
854 Ga0207674_10001588
855 Ga0207675_100024424
856 Ga0207683_10000340
857 Ga0207683_10001005
858 Ga0207683_10060621
859 Ga0207683_10232031
860 Ga0207698_10003379
861 Ga0207698_10019327
862 Ga0207698_10583239
863 Ga0210002_1011012
864 Ga0207428_10027270
865 Ga0307408_101430211
866 Ga0307410_10091332
867 Ga0307407_10057747
868 Ga0307411_10223929
869 Ga0373950_0002186
870 Ga0373950_0017737
871 Ga0373923_0003440
872 Ga0373936_0060918
873 Ga0373957_0135351
874 Ga0373960_0006883
875 Ga0373927_0202199
876 Ga0373933_0041344
877 Ga0373947_0059537
878 Ga0373937_0019017
879 Ga0373937_0049593
880 Ga0373937_0205271
881 Ga0373925_0027236
882 Ga0373925_0338547
883 Ga0395905_0130297
884 Ga0395901_0006634
885 Ga0451807_1728393
886 Ga0451853_3305521
887 Ga0439464_0102658
888 Ga0439464_0179823
889 Ga0439460_0139304
890 Ga0466972_0037206
891 Ga0466966_0037455
892 Ga0466964_0328533
893 Ga0466971_0045438
894 Ga0451576_0141315
895 Ga0451576_0363210
896 Ga0495617_009989
897 Ga0495603_0199647
898 Ga0495629_0000015
899 Ga0495629_0097733
900 Ga0495651_0095110
901 Ga0495653_0000201
902 Ga0495580_0028032
903 Ga0495582_0027069
904 Ga0495639_0002962
905 Ga0495584_0004575
906 Ga0495585_0000011
907 Ga0495585_0002901
908 Ga0495585_0010347
909 Ga0495585_0071263
910 Ga0495594_0019773
911 Ga0495607_0027792
912 Ga0495583_0041985
913 Ga0495606_0062098
914 Ga0495606_0457453
915 Ga0495616_0001527
916 Ga0495620_0004272
917 Ga0495628_0007697
918 Ga0495666_0010493
919 Ga0495666_0171447
920 Ga0495642_0004974
921 Ga0495652_0539973
922 Ga0495665_0025276
923 Ga0495665_0025565
924 Ga0495665_0223412
925 Ga0495640_0549116
926 Ga0495586_0282467
927 Ga0495645_0021835
928 Ga0495622_0109147
929 Ga0495633_0001893
930 Ga0495635_0097823
931 Ga0495659_0010265
932 Ga0495646_0061487
933 Ga0495647_0004971
934 Ga0495669_0040303
935 Ga0495669_0088281
936 Ga0495613_0236760
937 Ga0495613_0331876
938 Ga0495624_0002458
939 Ga0495624_0043915
940 Ga0495670_0000177
941 Ga0495649_0369816
942 Ga0495600_0049396
943 Ga0495581_0048602
944 Ga0495604_0012201
945 Ga0495674_0218641
946 Ga0495674_0346241
947 Ga0495672_0002523
948 Ga0495672_0004029
949 Ga0495683_0371896
950 Ga0495673_0176498
951 Ga0495602_0565548
952 Ga0495615_0076503
953 Ga0496100_0097811
954 Ga0496101_0190752
955 Ga0496104_0068780
956 Ga0496104_0073154
957 Ga0496106_0530215
958 Ga0496108_0012409
959 Ga0496109_0096798
960 Ga0496109_1122895
961 Ga0496110_0013854
962 Ga0496110_0091807
963 Ga0496111_0317394
964 Ga0496114_0065863
965 Ga0496114_0273403
966 Ga0496115_0776949
967 Ga0501036_0077871
968 Ga0501036_1119700
969 Ga0501038_0028857
970 Ga0501038_0265524
971 Ga0501039_0251845
972 Ga0501039_0713347
973 Ga0501040_0004302
974 Ga0501041_0000769
975 Ga0501042_0019844
976 Ga0501043_0469945
977 Ga0501046_0047844
978 Ga0501048_0238292
979 Ga0501067_0052433
980 Ga0501068_0016625
981 Ga0501069_0336059
982 Ga0501071_0786633
983 Ga0501072_0006242
984 Ga0501072_0294687
985 Ga0501072_0811904
986 Ga0501073_0128163
987 Ga0501074_0055188
988 Ga0501075_0058943
989 Ga0501075_0346295
990 Ga0501076_0046920
991 Ga0501077_0020875
992 Ga0501079_0071702
993 Ga0501080_0096568
994 Ga0501283_006132
995 Ga0501045_0000242
996 Ga0501045_0092380
997 nmdc:mga00v17_518090_c1
998 nmdc:mga0k408_273716_c1
999 nmdc:mga0k408_57561_c1
1000 nmdc:mga06z11_158229_c1
1001 nmdc:mga06z11_73742_c1
1002 nmdc:mga06z11_75002_c1
1003 nmdc:mga04h51_275920_c1
1004 nmdc:mga05p37_1272422_c1
1005 nmdc:mga05p37_477458_c1
1006 nmdc:mga09592_135708_c1
1007 nmdc:mga06r32_87275_c1
1008 nmdc:mga08y16_250_c1
1009 nmdc:mga0n895_1237978_c1
1010 nmdc:mga0n895_226614_c1
1011 nmdc:mga0n895_517888_c1
1012 nmdc:mga0n895_856713_c1
1013 nmdc:mga0a205_174209_c2
1014 Ga0495601_0568546
1015 Ga0495595_0266468
1016 Ga0495619_0459228
1017 Ga0501084_0001014
1018 Ga0590071_022149
1019 Ga0587088_006084
1020 Ga0587089_001984
1021 Ga0587091_000754
1022 Ga0587094_020116
1023 Ga0587128_001186
1024 Ga0587130_009873
1025 Ga0501082_0002223
1026 Ga0501082_0921465
1027 Ga0466962_0065769
1028 Ga0530510_0000156
1029 Ga0530510_1008014
1030 2644027210
1031 2819620723
1032 2928504334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13628

DUF4142

Domain of unknown function (DUF4142)

26

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5c-assembly1.cif.gz_D m. xanthus ferritin-like protein encb 0.8972 115 171
7s5c-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.8926 116 171
2qf9-assembly1.cif.gz_B crystal structure of putative secreted protein duf305 from streptomyces coelicolor 0.8584 27 172
3bt5-assembly1.cif.gz_A crystal structure of duf305 fragment from deinococcus radiodurans 0.8505 23 170
2qf9-assembly1.cif.gz_A crystal structure of putative secreted protein duf305 from streptomyces coelicolor 0.8464 27 172
ID Description Score Start End Superfamily
af_Q9FIN5_34_181_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9499 112 172 1.20.140.40
af_Q9CA10_47_189_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9319 112 172 1.20.140.40
3fseA02 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8661 28 170 1.20.1260.10
3bt5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8506 23 170 1.20.1260.10
5fejA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8488 27 170 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A0F7KLB8-F1-model_v4 Membrane protein 1 25 171
AF-A0A2C9A4E8-F1-model_v4 deleted 0.9999 31 172
AF-A0A419ZVP3-F1-model_v4 Putative outer membrane protein 0.9986 36 172
AF-A0A6J4KGW1-F1-model_v4 DUF4142 domain-containing protein 0.9933 21 171
AF-A0A7G4RF50-F1-model_v4 DUF4142 domain-containing protein 0.992 27 171

Map