F458037

General Info

Members Datasets Scaffolds Average Seq Length
516 222 484 119

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0492442|Ga0495638_0492442_181_576
Length 131
Sequence MFHEYSKQQGALMHLAAQIVTALVAVIHIYIVLLETVLFNSRGRRTFGLSKETAEIVQPAMSNQGCYNGFLVAALVVGLVHPDAAIASAFNVFGLACVAVAGIWGGVTVKRTILLIQTLPAVIGLALHFGA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221645 Massilia sp. Root351 Isolate Unclassified
11 2643221664 Massilia sp. Root418 Isolate Unclassified
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541297 Duganella sp. GV083 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738541357 Duganella sp. GV053 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543018 Massilia sp. GV045 Isolate Unclassified
18 2738543026 Duganella sp. GV089 Isolate Unclassified
19 2738543029 Duganella sp. GV039 Isolate Unclassified
20 2738543030 Massilia sp. GV097 Isolate Unclassified
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2821131069 Duganella sp. 1224 Isolate Unclassified
24 2842711865 Duganella sp. R-73148 Isolate Unclassified
25 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
26 2857553236 Duganella sp. R-74557 Isolate Unclassified
27 2857558681 Duganella sp. R-74565 Isolate Unclassified
28 2857564685 Duganella sp. R-74599 Isolate Unclassified
29 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
30 2919476304 Duganella sp. 3397 Isolate Unclassified
31 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
32 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
42 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
123 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
196 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
197 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
198 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
201 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
202 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
203 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
204 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
205 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
213 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0
Isolates 6.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.71
Nodule 0.78
Rhizoplane 1.94
Rhizosphere 65.12
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000716 3300002738 Bacteria 15035
2 JGI25152J39213_1000005 3300002773 Bacteria 160019
3 JGI25150J39212_1000571 3300002774 Bacteria 14701
4 JGI25150J39212_1011165 3300002774 Unclassified 1639
5 JGI25159J45721_1003493 3300002987 Bacteria 5539
6 JGI25159J45721_1004574 3300002987 Unclassified 4551
7 JGI25159J45721_1023617 3300002987 Unclassified 1110
8 JGI25151J46595_10065835 3300003187 Bacteria 1126
9 JGI25153J46596_10005856 3300003215 Bacteria 6369
10 JGI25153J46596_10079000 3300003215 Bacteria 826
11 JGI25153J46596_10100130 3300003215 Bacteria 683
12 rootL2_10079717 3300003322 Bacteria 4110
13 rootH1_10094760 3300003323 Bacteria 3192
14 rootH1_10246408 3300003323 Bacteria 1156
15 JGI25160J50197_1022198 3300003354 Unclassified 1865
16 JGI25161J50226_1006667 3300003374 Unclassified 2056
17 Ga0055529_1000068 3300003763 Bacteria 163911
18 Ga0055526_1000013 3300003771 Bacteria 233580
19 Ga0055526_1000048 3300003771 Bacteria 120076
20 Ga0055526_1000934 3300003771 Bacteria 21684
21 Ga0055526_1004533 3300003771 Bacteria 8305
22 Ga0055526_1005682 3300003771 Bacteria 7080
23 Ga0055526_1018641 3300003771 Bacteria 2579
24 Ga0055537_1000039 3300003773 Bacteria 92151
25 Ga0055537_1002487 3300003773 Bacteria 6146
26 Ga0055537_1025918 3300003773 Unclassified 804
27 Ga0055524_1000008 3300003775 Bacteria 297761
28 Ga0055524_1003496 3300003775 Bacteria 7605
29 Ga0055524_1003858 3300003775 Bacteria 7112
30 Ga0055524_1004427 3300003775 Bacteria 6483
31 Ga0055524_1007872 3300003775 Unclassified 4480
32 Ga0055534_1000174 3300003784 Bacteria 47983
33 Ga0055534_1001797 3300003784 Bacteria 8068
34 Ga0055528_1000066 3300003790 Bacteria 84724
35 Ga0055528_1009249 3300003790 Unclassified 4134
36 Ga0055528_1054680 3300003790 Bacteria 784
37 Ga0055530_10061291 3300003791 Unclassified 838
38 Ga0055531_10001853 3300003794 Bacteria 14867
39 Ga0055531_10005354 3300003794 Bacteria 7522
40 Ga0055543_1000112 3300004625 Bacteria 69589
41 Ga0055543_1004521 3300004625 Bacteria 3762
42 Ga0065165_1000005 3300005262 Bacteria 370361
43 Ga0065165_1001216 3300005262 Bacteria 29672
44 Ga0065165_1001578 3300005262 Bacteria 23475
45 Ga0065165_1013430 3300005262 Bacteria 3255
46 Ga0065165_1118482 3300005262 Bacteria 644
47 Ga0065714_10335023 3300005288 Unclassified 652
48 Ga0065715_10118162 3300005293 Bacteria 2324
49 Ga0070677_10716420 3300005333 Bacteria 565
50 Ga0070666_11325145 3300005335 Bacteria 537
51 Ga0068868_100138152 3300005338 Bacteria 1999
52 Ga0070671_100457356 3300005355 Bacteria 1095
53 Ga0070686_100165240 3300005544 Bacteria 1561
54 Ga0068861_100613493 3300005719 Bacteria 1000
55 Ga0068858_100264798 3300005842 Bacteria 1635
56 Ga0070717_10025687 3300006028 Bacteria 4689
57 Ga0075362_10126751 3300006177 Bacteria 1212
58 Ga0075366_10080296 3300006195 Bacteria 1948
59 Ga0068865_100313571 3300006881 Bacteria 1259
60 Ga0099826_10000001 3300006948 Bacteria 1155201
61 Ga0105244_10002659 3300009036 Bacteria 13391
62 Ga0105244_10018702 3300009036 Bacteria 3880
63 Ga0105245_10139938 3300009098 Bacteria 2278
64 Ga0105242_10140458 3300009176 Bacteria 2095
65 Ga0105248_10495731 3300009177 Bacteria 1377
66 Ga0105237_10960857 3300009545 Bacteria 861
67 Ga0105238_10298680 3300009551 Bacteria 1594
68 Ga0105239_11221890 3300010375 Bacteria 866
69 Ga0182008_10004711 3300014497 Bacteria 7910
70 Ga0182008_10308150 3300014497 Bacteria 830
71 Ga0182006_1000002 3300015261 Bacteria 887990
72 Ga0182007_10000997 3300015262 Bacteria 15535
73 Ga0182007_10086640 3300015262 Bacteria 1030
74 Ga0182005_1000002 3300015265 Bacteria 908499
75 Ga0182005_1000012 3300015265 Bacteria 396944
76 Ga0163161_11550267 3300017792 Bacteria 583
77 Ga0163161_12097926 3300017792 Bacteria 502
78 Ga0213872_10000032 3300021361 Bacteria 138939
79 Ga0213872_10003798 3300021361 Bacteria 8235
80 Ga0213872_10005831 3300021361 Bacteria 6253
81 Ga0213872_10017689 3300021361 Bacteria 3291
82 Ga0213872_10019146 3300021361 Unclassified 3153
83 Ga0213872_10259215 3300021361 Bacteria 730
84 Ga0209437_105566 3300025233 Bacteria 2139
85 Ga0207425_1000001 3300025245 Bacteria 2525432
86 Ga0207425_1000130 3300025245 Bacteria 70791
87 Ga0207425_1000132 3300025245 Bacteria 68018
88 Ga0209646_1000007 3300025246 Bacteria 670994
89 Ga0209129_1000003 3300025258 Bacteria 903689
90 Ga0209129_1028701 3300025258 Bacteria 943
91 Ga0209565_1000003 3300025263 Bacteria 1099648
92 Ga0209565_1002141 3300025263 Bacteria 7464
93 Ga0209565_1008265 3300025263 Bacteria 2734
94 Ga0209565_1017592 3300025263 Bacteria 1564
95 Ga0209565_1025098 3300025263 Bacteria 1207
96 Ga0209455_1000026 3300025272 Bacteria 653778
97 Ga0209673_1000003 3300025273 Bacteria 980859
98 Ga0209673_1030493 3300025273 Bacteria 1697
99 Ga0209673_1047843 3300025273 Bacteria 1156
100 Ga0209130_1000084 3300025284 Bacteria 160070
101 Ga0209130_1000237 3300025284 Bacteria 70739
102 Ga0209675_1000003 3300025291 Bacteria 1003982
103 Ga0209675_1043659 3300025291 Bacteria 963
104 Ga0209025_1006230 3300025294 Bacteria 9350
105 Ga0209564_1000002 3300025295 Bacteria 1636803
106 Ga0209564_1000007 3300025295 Bacteria 1028582
107 Ga0209564_1000012 3300025295 Bacteria 792078
108 Ga0209564_1000311 3300025295 Bacteria 95587
109 Ga0209564_1005699 3300025295 Bacteria 6983
110 Ga0209564_1007305 3300025295 Bacteria 5732
111 Ga0209564_1009926 3300025295 Bacteria 4455
112 Ga0209564_1010971 3300025295 Bacteria 4112
113 Ga0209758_1000041 3300025297 Bacteria 410328
114 Ga0209758_1000757 3300025297 Bacteria 46825
115 Ga0209758_1000919 3300025297 Bacteria 39837
116 Ga0209050_1000011 3300025298 Bacteria 914037
117 Ga0209050_1000164 3300025298 Bacteria 154628
118 Ga0209050_1000664 3300025298 Bacteria 52795
119 Ga0209256_1000005 3300025299 Bacteria 1315082
120 Ga0209256_1000068 3300025299 Bacteria 246064
121 Ga0209256_1000395 3300025299 Bacteria 69343
122 Ga0209256_1000952 3300025299 Bacteria 35118
123 Ga0209256_1003000 3300025299 Bacteria 12538
124 Ga0209256_1072913 3300025299 Bacteria 768
125 Ga0207426_1011742 3300025302 Bacteria 3318
126 Ga0209051_1104371 3300025303 Bacteria 754
127 Ga0209257_1000003 3300025304 Bacteria 1702593
128 Ga0209257_1000187 3300025304 Bacteria 154077
129 Ga0207655_1004019 3300025728 Bacteria 10620
130 Ga0207655_1020403 3300025728 Bacteria 3407
131 Ga0207694_10558959 3300025924 Bacteria 961
132 Ga0207687_10114815 3300025927 Bacteria 2005
133 Ga0207686_11816504 3300025934 Bacteria 505
134 Ga0207711_11565774 3300025941 Bacteria 602
135 Ga0207658_10214930 3300025986 Bacteria 1614
136 Ga0207703_10782430 3300026035 Bacteria 910
137 Ga0207675_100344375 3300026118 Bacteria 1459
138 Ga0209281_1003014 3300027111 Bacteria 5967
139 Ga0209281_1005961 3300027111 Bacteria 3257
140 Ga0209282_1000001 3300027666 Bacteria 2450367
141 Ga0307515_10049411 3300028794 Bacteria 6329
142 Ga0307515_10132054 3300028794 Bacteria 2742
143 Ga0307515_10142342 3300028794 Bacteria 2564
144 Ga0265320_10385501 3300031240 Bacteria 619
145 Ga0307513_10497343 3300031456 Bacteria 937
146 Ga0307408_100001129 3300031548 Bacteria 20315
147 Ga0307408_100001185 3300031548 Bacteria 19736
148 Ga0307408_100003316 3300031548 Bacteria 11066
149 Ga0307408_100004137 3300031548 Bacteria 9880
150 Ga0307408_101723167 3300031548 Bacteria 597
151 Ga0307416_100618853 3300032002 Bacteria 1164
152 Ga0307414_10003286 3300032004 Bacteria 8617
153 Ga0373939_0041605 3300035114 Bacteria 1386
154 Ga0395899_0004163 3300037312 Bacteria 11362
155 Ga0395899_0016120 3300037312 Bacteria 5697
156 Ga0395899_0264455 3300037312 Bacteria 1175
157 Ga0395900_0208607 3300037418 Bacteria 1973
158 Ga0395898_0008173 3300037466 Bacteria 11075
159 Ga0395905_1189806 3300037471 Bacteria 666
160 Ga0395901_0089498 3300038443 Bacteria 3221
161 Ga0395901_0212832 3300038443 Bacteria 2022
162 Ga0395901_2071292 3300038443 Unclassified 514
163 Ga0436361_0036409 3300039447 Bacteria 23805
164 Ga0436361_0139111 3300039447 Bacteria 16913
165 Ga0436361_0168778 3300039447 Bacteria 51987
166 Ga0436361_0204163 3300039447 Bacteria 16983
167 Ga0436361_0710706 3300039447 Bacteria 6343
168 Ga0436361_0993359 3300039447 Bacteria 43823
169 Ga0451845_0428513 3300041501 Bacteria 879
170 Ga0451853_3716941 3300041512 Bacteria 645
171 Ga0439443_029825 3300042003 Bacteria 895
172 Ga0450890_025283 3300042127 Bacteria 823
173 Ga0439435_0012340 3300042436 Bacteria 2068
174 Ga0439459_0015016 3300042438 Bacteria 1415
175 Ga0450893_0085820 3300042532 Bacteria 627
176 Ga0466972_0403413 3300044658 Unclassified 641
177 Ga0466968_0019279 3300044735 Bacteria 2746
178 Ga0466968_0398633 3300044735 Bacteria 674
179 Ga0495617_000042 3300046452 Bacteria 122225
180 Ga0495617_006001 3300046452 Bacteria 4282
181 Ga0495617_133613 3300046452 Bacteria 794
182 Ga0495617_145135 3300046452 Bacteria 756
183 Ga0495627_000057 3300046453 Bacteria 144773
184 Ga0495627_002244 3300046453 Bacteria 9569
185 Ga0495590_0000010 3300046457 Bacteria 317890
186 Ga0495590_0000733 3300046457 Bacteria 14963
187 Ga0495590_0030334 3300046457 Bacteria 1894
188 Ga0495638_0000027 3300046460 Bacteria 337569
189 Ga0495638_0002687 3300046460 Bacteria 14323
190 Ga0495638_0005797 3300046460 Bacteria 9090
191 Ga0495638_0020825 3300046460 Bacteria 4331
192 Ga0495638_0056006 3300046460 Bacteria 2447
193 Ga0495638_0088249 3300046460 Bacteria 1872
194 Ga0495638_0255562 3300046460 Bacteria 964
195 Ga0495638_0325111 3300046460 Bacteria 820
196 Ga0495638_0492442 3300046460 Bacteria 619
197 Ga0495653_0000010 3300046463 Bacteria 274131
198 Ga0495653_0266060 3300046463 Bacteria 1131
199 Ga0495650_0000044 3300046471 Bacteria 355139
200 Ga0495650_0000066 3300046471 Bacteria 272883
201 Ga0495650_0001129 3300046471 Bacteria 29018
202 Ga0495650_0003132 3300046471 Bacteria 12383
203 Ga0495650_0030602 3300046471 Bacteria 2435
204 Ga0495650_0061959 3300046471 Bacteria 1496
205 Ga0495605_0000027 3300046474 Bacteria 220680
206 Ga0495605_0001915 3300046474 Bacteria 13247
207 Ga0495639_0013547 3300046475 Bacteria 3524
208 Ga0495584_0051603 3300046491 Bacteria 2070
209 Ga0495585_0002878 3300046492 Bacteria 11968
210 Ga0495585_0006877 3300046492 Bacteria 7010
211 Ga0495585_0025346 3300046492 Bacteria 3398
212 Ga0495585_0114066 3300046492 Bacteria 1434
213 Ga0495607_0005509 3300046501 Bacteria 9041
214 Ga0495607_0006835 3300046501 Bacteria 7961
215 Ga0495607_0009712 3300046501 Bacteria 6496
216 Ga0495607_0078044 3300046501 Bacteria 1828
217 Ga0495607_0113418 3300046501 Bacteria 1433
218 Ga0495607_0124648 3300046501 Bacteria 1348
219 Ga0495583_0000002 3300046506 Bacteria 782521
220 Ga0495583_0000006 3300046506 Bacteria 436893
221 Ga0495583_0000021 3300046506 Bacteria 287046
222 Ga0495583_0000117 3300046506 Bacteria 135061
223 Ga0495583_0028047 3300046506 Bacteria 2772
224 Ga0495606_0000015 3300046507 Bacteria 288808
225 Ga0495606_0000125 3300046507 Bacteria 130102
226 Ga0495606_0000128 3300046507 Bacteria 128179
227 Ga0495606_0000557 3300046507 Bacteria 59505
228 Ga0495606_0001352 3300046507 Bacteria 33283
229 Ga0495606_0004948 3300046507 Bacteria 13007
230 Ga0495606_0005861 3300046507 Bacteria 11582
231 Ga0495606_0007239 3300046507 Bacteria 9999
232 Ga0495606_0080822 3300046507 Bacteria 2022
233 Ga0495606_0158869 3300046507 Bacteria 1320
234 Ga0495606_0201391 3300046507 Bacteria 1134
235 Ga0495610_0000008 3300046512 Bacteria 622732
236 Ga0495610_0002638 3300046512 Bacteria 14832
237 Ga0495610_0005058 3300046512 Bacteria 9508
238 Ga0495610_0008136 3300046512 Bacteria 6848
239 Ga0495610_0009097 3300046512 Bacteria 6328
240 Ga0495610_0009298 3300046512 Bacteria 6230
241 Ga0495610_0011098 3300046512 Bacteria 5533
242 Ga0495610_0014019 3300046512 Bacteria 4734
243 Ga0495610_0017960 3300046512 Bacteria 4012
244 Ga0495610_0022093 3300046512 Bacteria 3485
245 Ga0495616_0000206 3300046513 Bacteria 49005
246 Ga0495616_0002340 3300046513 Bacteria 12645
247 Ga0495616_0005858 3300046513 Bacteria 7500
248 Ga0495616_0008471 3300046513 Bacteria 6090
249 Ga0495631_0002493 3300046518 Bacteria 10362
250 Ga0495632_0000727 3300046519 Bacteria 29842
251 Ga0495632_0034763 3300046519 Bacteria 2576
252 Ga0495637_0000067 3300046520 Bacteria 86002
253 Ga0495637_0011788 3300046520 Bacteria 4192
254 Ga0495637_0048526 3300046520 Bacteria 1787
255 Ga0495637_0067378 3300046520 Bacteria 1453
256 Ga0495643_0000022 3300046522 Bacteria 289691
257 Ga0495643_0000065 3300046522 Bacteria 179031
258 Ga0495643_0073832 3300046522 Bacteria 1787
259 Ga0495643_0255865 3300046522 Bacteria 815
260 Ga0495643_0352547 3300046522 Bacteria 659
261 Ga0495643_0403802 3300046522 Bacteria 602
262 Ga0495644_0000729 3300046523 Bacteria 13643
263 Ga0495644_0032412 3300046523 Bacteria 1974
264 Ga0495644_0139790 3300046523 Bacteria 924
265 Ga0495648_0000078 3300046524 Bacteria 127397
266 Ga0495648_0000223 3300046524 Bacteria 64966
267 Ga0495648_0002119 3300046524 Bacteria 18687
268 Ga0495648_0002624 3300046524 Bacteria 16378
269 Ga0495648_0021870 3300046524 Bacteria 4417
270 Ga0495648_0063607 3300046524 Bacteria 2177
271 Ga0495648_0095649 3300046524 Bacteria 1652
272 Ga0495648_0466085 3300046524 Bacteria 549
273 Ga0495663_0002360 3300046525 Bacteria 5701
274 Ga0495663_0006083 3300046525 Bacteria 3337
275 Ga0495663_0062727 3300046525 Bacteria 1171
276 Ga0495642_0000919 3300046528 Bacteria 13828
277 Ga0495642_0064643 3300046528 Bacteria 1522
278 Ga0495642_0071136 3300046528 Bacteria 1455
279 Ga0495654_0000002 3300046530 Bacteria 1021205
280 Ga0495609_0001345 3300046538 Bacteria 16585
281 Ga0495609_0003504 3300046538 Bacteria 8967
282 Ga0495609_0004160 3300046538 Bacteria 8036
283 Ga0495609_0055969 3300046538 Bacteria 1748
284 Ga0495609_0196103 3300046538 Bacteria 845
285 Ga0495609_0283953 3300046538 Bacteria 676
286 Ga0495609_0416348 3300046538 Bacteria 536
287 Ga0495597_0000107 3300046542 Bacteria 73749
288 Ga0495597_0000466 3300046542 Bacteria 34350
289 Ga0495597_0057702 3300046542 Bacteria 1698
290 Ga0495597_0145439 3300046542 Bacteria 975
291 Ga0495597_0321862 3300046542 Bacteria 597
292 Ga0495622_0000009 3300046557 Bacteria 224622
293 Ga0495622_0000043 3300046557 Bacteria 115796
294 Ga0495622_0058507 3300046557 Bacteria 1785
295 Ga0495622_0132981 3300046557 Bacteria 1132
296 Ga0495622_0160908 3300046557 Bacteria 1012
297 Ga0495633_0000381 3300046558 Bacteria 47007
298 Ga0495633_0001071 3300046558 Bacteria 22118
299 Ga0495633_0001381 3300046558 Bacteria 18966
300 Ga0495633_0006010 3300046558 Bacteria 7293
301 Ga0495633_0011906 3300046558 Bacteria 4656
302 Ga0495633_0017835 3300046558 Bacteria 3616
303 Ga0495633_0038540 3300046558 Bacteria 2282
304 Ga0495633_0041795 3300046558 Bacteria 2179
305 Ga0495633_0058009 3300046558 Bacteria 1817
306 Ga0495633_0080110 3300046558 Unclassified 1520
307 Ga0495656_0027465 3300046615 Bacteria 2273
308 Ga0495656_0134972 3300046615 Bacteria 1178
309 Ga0495656_0237660 3300046615 Bacteria 916
310 Ga0495656_0547965 3300046615 Bacteria 616
311 Ga0495668_0000006 3300046616 Bacteria 553404
312 Ga0495668_0000027 3300046616 Bacteria 297194
313 Ga0495668_0000096 3300046616 Bacteria 139693
314 Ga0495668_0001010 3300046616 Bacteria 30202
315 Ga0495668_0002945 3300046616 Bacteria 13432
316 Ga0495668_0006316 3300046616 Bacteria 7797
317 Ga0495668_0009642 3300046616 Bacteria 5908
318 Ga0495668_0024144 3300046616 Bacteria 3459
319 Ga0495668_0047397 3300046616 Bacteria 2386
320 Ga0495668_0162294 3300046616 Bacteria 1224
321 Ga0495668_0571079 3300046616 Bacteria 624
322 Ga0495611_0000739 3300046648 Bacteria 18411
323 Ga0495611_0001112 3300046648 Bacteria 14159
324 Ga0495611_0027310 3300046648 Bacteria 2494
325 Ga0495625_0000053 3300046660 Bacteria 190575
326 Ga0495625_0000058 3300046660 Bacteria 180863
327 Ga0495625_0002139 3300046660 Bacteria 21993
328 Ga0495625_0008285 3300046660 Bacteria 8884
329 Ga0495625_0008684 3300046660 Bacteria 8631
330 Ga0495625_0009909 3300046660 Bacteria 7924
331 Ga0495625_0040469 3300046660 Bacteria 3399
332 Ga0495625_0054292 3300046660 Bacteria 2862
333 Ga0495625_0098052 3300046660 Bacteria 2016
334 Ga0495625_0170284 3300046660 Bacteria 1454
335 Ga0495625_0831638 3300046660 Bacteria 534
336 Ga0495659_0000001 3300046664 Bacteria 325846
337 Ga0495659_0000826 3300046664 Bacteria 11000
338 Ga0495659_0042167 3300046664 Bacteria 1633
339 Ga0495659_0067585 3300046664 Bacteria 1333
340 Ga0495659_0253127 3300046664 Bacteria 734
341 Ga0495661_0008008 3300046665 Bacteria 7338
342 Ga0495661_0055022 3300046665 Bacteria 2387
343 Ga0495661_0085283 3300046665 Bacteria 1810
344 Ga0495669_0000429 3300046684 Bacteria 19950
345 Ga0495670_0036802 3300046691 Bacteria 2439
346 Ga0495670_0042045 3300046691 Bacteria 2280
347 Ga0495670_0280515 3300046691 Bacteria 891
348 Ga0495670_0688516 3300046691 Bacteria 557
349 Ga0495670_0720954 3300046691 Bacteria 544
350 Ga0495671_0000002 3300046692 Bacteria 1136189
351 Ga0495671_0000035 3300046692 Bacteria 188543
352 Ga0495671_0002321 3300046692 Bacteria 12087
353 Ga0495671_0028825 3300046692 Bacteria 2856
354 Ga0495671_0048524 3300046692 Bacteria 2118
355 Ga0495671_0073374 3300046692 Bacteria 1680
356 Ga0495671_0282428 3300046692 Bacteria 799
357 Ga0495649_0002789 3300046694 Bacteria 12166
358 Ga0495649_0023726 3300046694 Bacteria 3426
359 Ga0495649_0348901 3300046694 Bacteria 748
360 Ga0495660_0000069 3300046810 Bacteria 115654
361 Ga0495660_0001231 3300046810 Bacteria 17853
362 Ga0495660_0009064 3300046810 Bacteria 5810
363 Ga0495660_0018729 3300046810 Bacteria 3976
364 Ga0495660_0025019 3300046810 Bacteria 3393
365 Ga0495660_0050374 3300046810 Bacteria 2269
366 Ga0495660_0066348 3300046810 Bacteria 1925
367 Ga0495660_0080596 3300046810 Bacteria 1708
368 Ga0495660_0235097 3300046810 Bacteria 857
369 Ga0495636_0004270 3300047318 Bacteria 5605
370 Ga0495636_0014845 3300047318 Bacteria 3099
371 Ga0495636_0015425 3300047318 Bacteria 3046
372 Ga0495636_0036446 3300047318 Bacteria 2028
373 Ga0495636_0091306 3300047318 Bacteria 1322
374 Ga0495636_0629542 3300047318 Bacteria 526
375 Ga0495672_0000066 3300047320 Bacteria 193318
376 Ga0495672_0000095 3300047320 Bacteria 143883
377 Ga0495672_0047244 3300047320 Bacteria 2561
378 Ga0495672_0092513 3300047320 Bacteria 1657
379 Ga0495683_0016696 3300047323 Bacteria 3809
380 Ga0495687_001158 3300047443 Bacteria 25533
381 Ga0495687_004020 3300047443 Bacteria 10212
382 Ga0495687_051886 3300047443 Bacteria 1737
383 Ga0495677_0025554 3300047445 Bacteria 2142
384 Ga0495677_0307758 3300047445 Bacteria 623
385 Ga0495679_005149 3300047446 Bacteria 5856
386 Ga0495679_021023 3300047446 Bacteria 2263
387 Ga0495679_067817 3300047446 Bacteria 1033
388 Ga0495685_000332 3300047447 Bacteria 15267
389 Ga0495685_005026 3300047447 Bacteria 4304
390 Ga0495673_0000005 3300047469 Bacteria 943364
391 Ga0495673_0000059 3300047469 Bacteria 233234
392 Ga0495673_0000064 3300047469 Bacteria 225793
393 Ga0495673_0000225 3300047469 Bacteria 83589
394 Ga0495673_0004384 3300047469 Bacteria 8851
395 Ga0495673_0006534 3300047469 Bacteria 6840
396 Ga0495673_0033705 3300047469 Bacteria 2374
397 Ga0495681_0003868 3300047470 Bacteria 10347
398 Ga0495681_0009347 3300047470 Bacteria 6047
399 Ga0495681_0025458 3300047470 Bacteria 3095
400 Ga0495686_0000462 3300047472 Bacteria 61070
401 Ga0495686_0001427 3300047472 Bacteria 26117
402 Ga0495686_0003346 3300047472 Bacteria 13989
403 Ga0495686_0007226 3300047472 Bacteria 8362
404 Ga0495686_0036829 3300047472 Bacteria 3138
405 Ga0495686_0043025 3300047472 Bacteria 2867
406 Ga0495686_0084708 3300047472 Bacteria 1931
407 Ga0495686_0240022 3300047472 Bacteria 1022
408 Ga0495686_0395909 3300047472 Bacteria 742
409 Ga0495615_0000340 3300048090 Bacteria 7684
410 Ga0496102_0000182 3300048905 Bacteria 84891
411 Ga0496102_0050177 3300048905 Bacteria 3799
412 Ga0496102_0061923 3300048905 Bacteria 3426
413 Ga0496102_0792193 3300048905 Bacteria 870
414 Ga0496103_0069924 3300048906 Bacteria 2196
415 Ga0496106_0008622 3300048909 Bacteria 7545
416 Ga0496107_0000058 3300048910 Bacteria 54924
417 Ga0496108_0953565 3300048911 Bacteria 734
418 Ga0496111_0154702 3300048914 Bacteria 1701
419 Ga0496116_0015645 3300048919 Bacteria 5989
420 Ga0496116_0074770 3300048919 Bacteria 2129
421 Ga0496117_0000001 3300048920 Bacteria 2526244
422 Ga0496118_0000002 3300048921 Bacteria 1690764
423 Ga0496121_0007795 3300048924 Bacteria 12820
424 Ga0496121_0008882 3300048924 Bacteria 11682
425 Ga0496121_0011077 3300048924 Bacteria 10062
426 Ga0496121_0204706 3300048924 Bacteria 1403
427 Ga0496121_0281271 3300048924 Bacteria 1138
428 Ga0496121_0502829 3300048924 Bacteria 769
429 Ga0496121_0649218 3300048924 Bacteria 643
430 Ga0496122_0013372 3300048925 Bacteria 8035
431 Ga0496122_0075194 3300048925 Bacteria 2385
432 Ga0496122_0460610 3300048925 Bacteria 628
433 Ga0496123_0012122 3300048926 Bacteria 7385
434 Ga0496124_0012443 3300048927 Bacteria 8400
435 Ga0496124_0029879 3300048927 Bacteria 4848
436 Ga0496124_0065386 3300048927 Bacteria 3033
437 Ga0496125_0034021 3300048928 Bacteria 4498
438 Ga0496125_0086440 3300048928 Bacteria 2371
439 Ga0495678_000588 3300049459 Bacteria 34196
440 Ga0495678_002236 3300049459 Bacteria 13490
441 Ga0495678_007047 3300049459 Bacteria 5890
442 Ga0495678_008805 3300049459 Bacteria 5052
443 Ga0495678_017062 3300049459 Bacteria 3300
444 Ga0495678_026830 3300049459 Bacteria 2451
445 Ga0495682_0000302 3300049460 Bacteria 37440
446 Ga0495682_0000965 3300049460 Bacteria 17295
447 Ga0495682_0012517 3300049460 Bacteria 3250
448 Ga0501207_146034 3300049654 Bacteria 507
449 Ga0501222_006577 3300049662 Bacteria 1561
450 Ga0501227_002037 3300049665 Bacteria 4484
451 Ga0501233_281042 3300049668 Bacteria 509
452 Ga0501235_172503 3300049669 Bacteria 572
453 Ga0501238_045365 3300049671 Bacteria 652
454 Ga0501250_080279 3300049680 Bacteria 553
455 Ga0501221_241331 3300049704 Bacteria 516
456 Ga0501241_026866 3300049758 Bacteria 1075
457 Ga0501269_000423 3300049766 Bacteria 9533
458 Ga0501269_007654 3300049766 Bacteria 1305
459 Ga0501279_003529 3300049775 Bacteria 2040
460 Ga0501279_004382 3300049775 Bacteria 1851
461 nmdc:mga03n38_26634_c1 3300050490 Bacteria 2389
462 nmdc:mga0k408_87260_c1 3300050493 Bacteria 1832
463 Ga0500578_0001551 3300053086 Bacteria 22505
464 Ga0500643_039930 3300053087 Bacteria 1384
465 Ga0500643_108048 3300053087 Bacteria 752
466 Ga0500644_0004985 3300053088 Bacteria 3340
467 Ga0500641_0250129 3300053096 Bacteria 743
468 Ga0500562_010250 3300053108 Bacteria 2373
469 Ga0500594_0000389 3300053118 Bacteria 9821
470 Ga0500594_0002295 3300053118 Bacteria 4147
471 Ga0500594_0004222 3300053118 Bacteria 3168
472 Ga0500614_037674 3300053123 Bacteria 1215
473 Ga0500618_000064 3300053125 Bacteria 91120
474 Ga0500618_000137 3300053125 Bacteria 61561
475 Ga0500559_0000056 3300053136 Bacteria 88545
476 Ga0500559_0002417 3300053136 Bacteria 9667
477 Ga0500564_001125 3300053138 Bacteria 8907
478 Ga0500577_0014764 3300053142 Bacteria 2423
479 Ga0500586_000227 3300053145 Bacteria 11155
480 Ga0500586_001150 3300053145 Bacteria 5489
481 Ga0500616_0364918 3300053153 Bacteria 584
482 Ga0500622_0005232 3300053156 Bacteria 7841
483 Ga0500622_0036983 3300053156 Bacteria 2551
484 Ga0500609_000278 3300053731 Bacteria 7501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510917020 2511123490 114
2 iso_pu_bacteria 2582581279 2585148316 114
3 iso_pu_bacteria 2582581280 2585151447 114
4 iso_pu_bacteria 2582581293 2585196161 114
5 iso_pu_bacteria 2600255292 2601667867 114
6 iso_pu_bacteria 2643221552 2643782268 114
7 iso_pu_bacteria 2643221554 2643792132 114
8 iso_pu_bacteria 2643221583 2643926508 114
9 iso_pu_bacteria 2643221584 2643928943 114
10 iso_pu_bacteria 2643221645 2644251531 114
11 iso_pu_bacteria 2643221664 2644357400 114
12 iso_pu_bacteria 2738541297 2738828590 114
13 iso_pu_bacteria 2738541357 2739152386 114
14 iso_pu_bacteria 2738543003 2739194306 114
15 iso_pu_bacteria 2738543026 2739320782 114
16 iso_pu_bacteria 2738543029 2739339023 114
17 iso_pu_bacteria 2818991435 2819536961 114
18 iso_pu_bacteria 2818991454 2819645373 114
19 iso_pu_bacteria 2821131069 2821132835 114
20 iso_pu_bacteria 2842711865 2842717563 114
21 iso_pu_bacteria 2857547612 2857550100 114
22 iso_pu_bacteria 2857553236 2857558216 114
23 iso_pu_bacteria 2857558681 2857564515 114
24 iso_pu_bacteria 2857564685 2857568748 114
25 iso_pu_bacteria 2885080285 2885084752 114
26 iso_pu_bacteria 2919476304 2919480199 114
27 iso_pu_bacteria 2932410948 2932411483 114
28 iso_pu_bacteria 2932416698 2932418950 114
29 3300017792 Ga0163161_11550267 Ga0163161_115502671 115
30 3300046660 Ga0495625_0008285 Ga0495625_0008285_1950_2306 117
31 3300047320 Ga0495672_0047244 Ga0495672_0047244_964_1317 117
32 3300002738 JGI25154J39366_1000716 JGI25154J39366_10007168 118
33 3300002773 JGI25152J39213_1000005 JGI25152J39213_1000005115 118
34 3300002774 JGI25150J39212_1000571 JGI25150J39212_10005718 118
35 3300002774 JGI25150J39212_1011165 JGI25150J39212_10111652 118
36 3300002987 JGI25159J45721_1003493 JGI25159J45721_10034934 118
37 3300002987 JGI25159J45721_1004574 JGI25159J45721_10045742 118
38 3300002987 JGI25159J45721_1023617 JGI25159J45721_10236172 118
39 3300003187 JGI25151J46595_10065835 JGI25151J46595_100658353 118
40 3300003215 JGI25153J46596_10005856 JGI25153J46596_100058565 118
41 3300003215 JGI25153J46596_10079000 JGI25153J46596_100790002 118
42 3300003215 JGI25153J46596_10100130 JGI25153J46596_101001302 118
43 3300003322 rootL2_10079717 rootL2_100797172 118
44 3300003323 rootH1_10094760 rootH1_100947603 118
45 3300003323 rootH1_10246408 rootH1_102464081 118
46 3300003354 JGI25160J50197_1022198 JGI25160J50197_10221982 118
47 3300003374 JGI25161J50226_1006667 JGI25161J50226_10066672 118
48 3300003763 Ga0055529_1000068 Ga0055529_100006854 118
49 3300003771 Ga0055526_1000013 Ga0055526_100001339 118
50 3300003771 Ga0055526_1000048 Ga0055526_100004836 118
51 3300003771 Ga0055526_1000934 Ga0055526_100093417 118
52 3300003771 Ga0055526_1004533 Ga0055526_100453310 118
53 3300003771 Ga0055526_1005682 Ga0055526_10056825 118
54 3300003771 Ga0055526_1018641 Ga0055526_10186412 118
55 3300003773 Ga0055537_1000039 Ga0055537_100003946 118
56 3300003773 Ga0055537_1002487 Ga0055537_10024878 118
57 3300003773 Ga0055537_1025918 Ga0055537_10259182 118
58 3300003775 Ga0055524_1000008 Ga0055524_1000008258 118
59 3300003775 Ga0055524_1003496 Ga0055524_10034969 118
60 3300003775 Ga0055524_1003858 Ga0055524_10038589 118
61 3300003775 Ga0055524_1004427 Ga0055524_10044276 118
62 3300003775 Ga0055524_1007872 Ga0055524_10078725 118
63 3300003784 Ga0055534_1000174 Ga0055534_100017411 118
64 3300003784 Ga0055534_1001797 Ga0055534_10017976 118
65 3300003790 Ga0055528_1000066 Ga0055528_100006648 118
66 3300003790 Ga0055528_1009249 Ga0055528_10092492 118
67 3300003790 Ga0055528_1054680 Ga0055528_10546801 118
68 3300003791 Ga0055530_10061291 Ga0055530_100612912 118
69 3300003794 Ga0055531_10001853 Ga0055531_1000185315 118
70 3300003794 Ga0055531_10005354 Ga0055531_100053548 118
71 3300004625 Ga0055543_1000112 Ga0055543_100011228 118
72 3300004625 Ga0055543_1004521 Ga0055543_10045214 118
73 3300005262 Ga0065165_1000005 Ga0065165_1000005254 118
74 3300005262 Ga0065165_1001216 Ga0065165_100121628 118
75 3300005262 Ga0065165_1001578 Ga0065165_100157810 118
76 3300005262 Ga0065165_1013430 Ga0065165_10134303 118
77 3300005262 Ga0065165_1118482 Ga0065165_11184821 118
78 3300005288 Ga0065714_10335023 Ga0065714_103350231 118
79 3300005293 Ga0065715_10118162 Ga0065715_101181623 118
80 3300005333 Ga0070677_10716420 Ga0070677_107164201 118
81 3300005335 Ga0070666_11325145 Ga0070666_113251451 118
82 3300005338 Ga0068868_100138152 Ga0068868_1001381523 118
83 3300005355 Ga0070671_100457356 Ga0070671_1004573562 118
84 3300005544 Ga0070686_100165240 Ga0070686_1001652402 118
85 3300005719 Ga0068861_100613493 Ga0068861_1006134931 118
86 3300005842 Ga0068858_100264798 Ga0068858_1002647983 118
87 3300006028 Ga0070717_10025687 Ga0070717_100256875 118
88 3300006177 Ga0075362_10126751 Ga0075362_101267512 118
89 3300006195 Ga0075366_10080296 Ga0075366_100802962 118
90 3300006881 Ga0068865_100313571 Ga0068865_1003135711 118
91 3300006948 Ga0099826_10000001 Ga0099826_10000001344 118
92 3300009036 Ga0105244_10002659 Ga0105244_100026597 118
93 3300009036 Ga0105244_10018702 Ga0105244_100187022 118
94 3300009098 Ga0105245_10139938 Ga0105245_101399383 118
95 3300009176 Ga0105242_10140458 Ga0105242_101404583 118
96 3300009177 Ga0105248_10495731 Ga0105248_104957312 118
97 3300009545 Ga0105237_10960857 Ga0105237_109608571 118
98 3300009551 Ga0105238_10298680 Ga0105238_102986802 118
99 3300010375 Ga0105239_11221890 Ga0105239_112218901 118
100 3300014497 Ga0182008_10004711 Ga0182008_100047113 118
101 3300014497 Ga0182008_10308150 Ga0182008_103081502 118
102 3300015261 Ga0182006_1000002 Ga0182006_1000002784 118
103 3300015262 Ga0182007_10000997 Ga0182007_1000099714 118
104 3300015262 Ga0182007_10086640 Ga0182007_100866402 118
105 3300015265 Ga0182005_1000002 Ga0182005_1000002319 118
106 3300015265 Ga0182005_1000012 Ga0182005_100001274 118
107 3300017792 Ga0163161_12097926 Ga0163161_120979261 118
108 3300021361 Ga0213872_10000032 Ga0213872_1000003295 118
109 3300021361 Ga0213872_10003798 Ga0213872_100037981 118
110 3300021361 Ga0213872_10005831 Ga0213872_100058313 118
111 3300021361 Ga0213872_10017689 Ga0213872_100176893 118
112 3300021361 Ga0213872_10019146 Ga0213872_100191463 118
113 3300021361 Ga0213872_10259215 Ga0213872_102592152 118
114 3300025233 Ga0209437_105566 Ga0209437_1055663 118
115 3300025245 Ga0207425_1000001 Ga0207425_1000001201 118
116 3300025245 Ga0207425_1000130 Ga0207425_100013026 118
117 3300025245 Ga0207425_1000132 Ga0207425_100013231 118
118 3300025246 Ga0209646_1000007 Ga0209646_1000007287 118
119 3300025258 Ga0209129_1000003 Ga0209129_1000003201 118
120 3300025258 Ga0209129_1028701 Ga0209129_10287011 118
121 3300025263 Ga0209565_1000003 Ga0209565_1000003318 118
122 3300025263 Ga0209565_1002141 Ga0209565_10021411 118
123 3300025263 Ga0209565_1008265 Ga0209565_10082654 118
124 3300025263 Ga0209565_1017592 Ga0209565_10175921 118
125 3300025263 Ga0209565_1025098 Ga0209565_10250982 118
126 3300025272 Ga0209455_1000026 Ga0209455_1000026458 118
127 3300025273 Ga0209673_1000003 Ga0209673_1000003204 118
128 3300025273 Ga0209673_1030493 Ga0209673_10304933 118
129 3300025273 Ga0209673_1047843 Ga0209673_10478431 118
130 3300025284 Ga0209130_1000084 Ga0209130_100008446 118
131 3300025284 Ga0209130_1000237 Ga0209130_100023755 118
132 3300025291 Ga0209675_1000003 Ga0209675_1000003720 118
133 3300025291 Ga0209675_1043659 Ga0209675_10436593 118
134 3300025294 Ga0209025_1006230 Ga0209025_10062305 118
135 3300025295 Ga0209564_1000002 Ga0209564_1000002970 118
136 3300025295 Ga0209564_1000007 Ga0209564_1000007317 118
137 3300025295 Ga0209564_1000012 Ga0209564_1000012528 118
138 3300025295 Ga0209564_1000311 Ga0209564_100031152 118
139 3300025295 Ga0209564_1005699 Ga0209564_10056995 118
140 3300025295 Ga0209564_1007305 Ga0209564_10073054 118
141 3300025295 Ga0209564_1009926 Ga0209564_10099266 118
142 3300025295 Ga0209564_1010971 Ga0209564_10109716 118
143 3300025297 Ga0209758_1000041 Ga0209758_1000041149 118
144 3300025297 Ga0209758_1000757 Ga0209758_100075718 118
145 3300025297 Ga0209758_1000919 Ga0209758_100091920 118
146 3300025298 Ga0209050_1000011 Ga0209050_1000011227 118
147 3300025298 Ga0209050_1000164 Ga0209050_100016428 118
148 3300025298 Ga0209050_1000664 Ga0209050_100066421 118
149 3300025299 Ga0209256_1000005 Ga0209256_10000051204 118
150 3300025299 Ga0209256_1000068 Ga0209256_100006877 118
151 3300025299 Ga0209256_1000395 Ga0209256_100039537 118
152 3300025299 Ga0209256_1000952 Ga0209256_100095228 118
153 3300025299 Ga0209256_1003000 Ga0209256_10030008 118
154 3300025299 Ga0209256_1072913 Ga0209256_10729131 118
155 3300025302 Ga0207426_1011742 Ga0207426_10117424 118
156 3300025303 Ga0209051_1104371 Ga0209051_11043712 118
157 3300025304 Ga0209257_1000003 Ga0209257_1000003999 118
158 3300025304 Ga0209257_1000187 Ga0209257_100018716 118
159 3300025728 Ga0207655_1004019 Ga0207655_100401911 118
160 3300025728 Ga0207655_1020403 Ga0207655_10204032 118
161 3300025924 Ga0207694_10558959 Ga0207694_105589592 118
162 3300025927 Ga0207687_10114815 Ga0207687_101148151 118
163 3300025934 Ga0207686_11816504 Ga0207686_118165041 118
164 3300025941 Ga0207711_11565774 Ga0207711_115657742 118
165 3300025986 Ga0207658_10214930 Ga0207658_102149301 118
166 3300026035 Ga0207703_10782430 Ga0207703_107824302 118
167 3300026118 Ga0207675_100344375 Ga0207675_1003443751 118
168 3300027111 Ga0209281_1003014 Ga0209281_10030141 118
169 3300027111 Ga0209281_1005961 Ga0209281_10059612 118
170 3300027666 Ga0209282_1000001 Ga0209282_10000011482 118
171 3300028794 Ga0307515_10049411 Ga0307515_100494114 118
172 3300028794 Ga0307515_10132054 Ga0307515_101320542 118
173 3300028794 Ga0307515_10142342 Ga0307515_101423421 118
174 3300031240 Ga0265320_10385501 Ga0265320_103855011 118
175 3300031456 Ga0307513_10497343 Ga0307513_104973432 118
176 3300031548 Ga0307408_100001129 Ga0307408_10000112914 118
177 3300031548 Ga0307408_100001185 Ga0307408_10000118514 118
178 3300031548 Ga0307408_100003316 Ga0307408_10000331610 118
179 3300031548 Ga0307408_100004137 Ga0307408_10000413711 118
180 3300031548 Ga0307408_101723167 Ga0307408_1017231671 118
181 3300032002 Ga0307416_100618853 Ga0307416_1006188532 118
182 3300032004 Ga0307414_10003286 Ga0307414_100032865 118
183 3300035114 Ga0373939_0041605 Ga0373939_0041605_361_720 118
184 3300037312 Ga0395899_0004163 Ga0395899_0004163_9437_9799 118
185 3300037312 Ga0395899_0016120 Ga0395899_0016120_4113_4475 118
186 3300037312 Ga0395899_0264455 Ga0395899_0264455_65_424 118
187 3300037418 Ga0395900_0208607 Ga0395900_0208607_518_880 118
188 3300037466 Ga0395898_0008173 Ga0395898_0008173_5386_5748 118
189 3300037471 Ga0395905_1189806 Ga0395905_1189806_231_590 118
190 3300038443 Ga0395901_0089498 Ga0395901_0089498_1240_1602 118
191 3300038443 Ga0395901_0212832 Ga0395901_0212832_926_1288 118
192 3300038443 Ga0395901_2071292 Ga0395901_2071292_134_493 118
193 3300039447 Ga0436361_0036409 Ga0436361_0036409_22688_23047 118
194 3300039447 Ga0436361_0139111 Ga0436361_0139111_7710_8069 118
195 3300039447 Ga0436361_0168778 Ga0436361_0168778_15446_15805 118
196 3300039447 Ga0436361_0204163 Ga0436361_0204163_3866_4225 118
197 3300039447 Ga0436361_0710706 Ga0436361_0710706_5790_6149 118
198 3300039447 Ga0436361_0993359 Ga0436361_0993359_43271_43630 118
199 3300041501 Ga0451845_0428513 Ga0451845_0428513_468_827 118
200 3300041512 Ga0451853_3716941 Ga0451853_3716941_55_414 118
201 3300042003 Ga0439443_029825 Ga0439443_029825_104_463 118
202 3300042127 Ga0450890_025283 Ga0450890_025283_448_807 118
203 3300042436 Ga0439435_0012340 Ga0439435_0012340_1566_1925 118
204 3300042438 Ga0439459_0015016 Ga0439459_0015016_240_599 118
205 3300042532 Ga0450893_0085820 Ga0450893_0085820_55_414 118
206 3300044658 Ga0466972_0403413 Ga0466972_0403413_194_550 118
207 3300044735 Ga0466968_0019279 Ga0466968_0019279_1376_1732 118
208 3300044735 Ga0466968_0398633 Ga0466968_0398633_197_556 118
209 3300046452 Ga0495617_000042 Ga0495617_000042_13795_14154 118
210 3300046452 Ga0495617_006001 Ga0495617_006001_518_874 118
211 3300046452 Ga0495617_133613 Ga0495617_133613_421_777 118
212 3300046452 Ga0495617_145135 Ga0495617_145135_81_440 118
213 3300046453 Ga0495627_000057 Ga0495627_000057_25787_26146 118
214 3300046453 Ga0495627_002244 Ga0495627_002244_7789_8148 118
215 3300046457 Ga0495590_0000010 Ga0495590_0000010_239232_239591 118
216 3300046457 Ga0495590_0000733 Ga0495590_0000733_10019_10378 118
217 3300046457 Ga0495590_0030334 Ga0495590_0030334_1193_1552 118
218 3300046460 Ga0495638_0000027 Ga0495638_0000027_281282_281641 118
219 3300046460 Ga0495638_0002687 Ga0495638_0002687_786_1145 118
220 3300046460 Ga0495638_0005797 Ga0495638_0005797_4745_5104 118
221 3300046460 Ga0495638_0020825 Ga0495638_0020825_1888_2247 118
222 3300046460 Ga0495638_0056006 Ga0495638_0056006_1755_2114 118
223 3300046460 Ga0495638_0088249 Ga0495638_0088249_792_1151 118
224 3300046460 Ga0495638_0255562 Ga0495638_0255562_491_850 118
225 3300046460 Ga0495638_0325111 Ga0495638_0325111_12_368 118
226 3300046460 Ga0495638_0492442 Ga0495638_0492442_181_576 118
227 3300046463 Ga0495653_0000010 Ga0495653_0000010_16115_16474 118
228 3300046463 Ga0495653_0266060 Ga0495653_0266060_621_980 118
229 3300046471 Ga0495650_0000044 Ga0495650_0000044_254658_255017 118
230 3300046471 Ga0495650_0000066 Ga0495650_0000066_220974_221333 118
231 3300046471 Ga0495650_0001129 Ga0495650_0001129_13489_13848 118
232 3300046471 Ga0495650_0003132 Ga0495650_0003132_6418_6777 118
233 3300046471 Ga0495650_0030602 Ga0495650_0030602_945_1304 118
234 3300046471 Ga0495650_0061959 Ga0495650_0061959_898_1257 118
235 3300046474 Ga0495605_0000027 Ga0495605_0000027_80246_80605 118
236 3300046474 Ga0495605_0001915 Ga0495605_0001915_970_1326 118
237 3300046475 Ga0495639_0013547 Ga0495639_0013547_213_572 118
238 3300046491 Ga0495584_0051603 Ga0495584_0051603_1200_1559 118
239 3300046492 Ga0495585_0002878 Ga0495585_0002878_4995_5354 118
240 3300046492 Ga0495585_0006877 Ga0495585_0006877_3700_4056 118
241 3300046492 Ga0495585_0025346 Ga0495585_0025346_428_784 118
242 3300046492 Ga0495585_0114066 Ga0495585_0114066_222_581 118
243 3300046501 Ga0495607_0005509 Ga0495607_0005509_2082_2438 118
244 3300046501 Ga0495607_0006835 Ga0495607_0006835_4293_4652 118
245 3300046501 Ga0495607_0009712 Ga0495607_0009712_5663_6019 118
246 3300046501 Ga0495607_0078044 Ga0495607_0078044_43_402 118
247 3300046501 Ga0495607_0113418 Ga0495607_0113418_438_797 118
248 3300046501 Ga0495607_0124648 Ga0495607_0124648_592_951 118
249 3300046506 Ga0495583_0000002 Ga0495583_0000002_11589_11945 118
250 3300046506 Ga0495583_0000006 Ga0495583_0000006_269854_270213 118
251 3300046506 Ga0495583_0000021 Ga0495583_0000021_148750_149106 118
252 3300046506 Ga0495583_0000117 Ga0495583_0000117_122617_122976 118
253 3300046506 Ga0495583_0028047 Ga0495583_0028047_2243_2602 118
254 3300046507 Ga0495606_0000015 Ga0495606_0000015_133302_133661 118
255 3300046507 Ga0495606_0000125 Ga0495606_0000125_84165_84524 118
256 3300046507 Ga0495606_0000128 Ga0495606_0000128_41986_42345 118
257 3300046507 Ga0495606_0000557 Ga0495606_0000557_7407_7766 118
258 3300046507 Ga0495606_0001352 Ga0495606_0001352_23635_23994 118
259 3300046507 Ga0495606_0004948 Ga0495606_0004948_3090_3449 118
260 3300046507 Ga0495606_0005861 Ga0495606_0005861_3564_3920 118
261 3300046507 Ga0495606_0007239 Ga0495606_0007239_8089_8448 118
262 3300046507 Ga0495606_0080822 Ga0495606_0080822_533_892 118
263 3300046507 Ga0495606_0158869 Ga0495606_0158869_837_1208 118
264 3300046507 Ga0495606_0201391 Ga0495606_0201391_161_520 118
265 3300046512 Ga0495610_0000008 Ga0495610_0000008_169777_170136 118
266 3300046512 Ga0495610_0002638 Ga0495610_0002638_4898_5257 118
267 3300046512 Ga0495610_0005058 Ga0495610_0005058_5014_5373 118
268 3300046512 Ga0495610_0008136 Ga0495610_0008136_515_874 118
269 3300046512 Ga0495610_0009097 Ga0495610_0009097_3558_3917 118
270 3300046512 Ga0495610_0009298 Ga0495610_0009298_4412_4771 118
271 3300046512 Ga0495610_0011098 Ga0495610_0011098_3548_3904 118
272 3300046512 Ga0495610_0014019 Ga0495610_0014019_2092_2454 118
273 3300046512 Ga0495610_0017960 Ga0495610_0017960_2802_3161 118
274 3300046512 Ga0495610_0022093 Ga0495610_0022093_215_574 118
275 3300046513 Ga0495616_0000206 Ga0495616_0000206_28101_28460 118
276 3300046513 Ga0495616_0002340 Ga0495616_0002340_6485_6841 118
277 3300046513 Ga0495616_0005858 Ga0495616_0005858_691_1047 118
278 3300046513 Ga0495616_0008471 Ga0495616_0008471_2261_2620 118
279 3300046518 Ga0495631_0002493 Ga0495631_0002493_9220_9579 118
280 3300046519 Ga0495632_0000727 Ga0495632_0000727_27344_27703 118
281 3300046519 Ga0495632_0034763 Ga0495632_0034763_284_643 118
282 3300046520 Ga0495637_0000067 Ga0495637_0000067_58514_58909 118
283 3300046520 Ga0495637_0011788 Ga0495637_0011788_74_433 118
284 3300046520 Ga0495637_0048526 Ga0495637_0048526_169_528 118
285 3300046520 Ga0495637_0067378 Ga0495637_0067378_360_719 118
286 3300046522 Ga0495643_0000022 Ga0495643_0000022_138692_139051 118
287 3300046522 Ga0495643_0000065 Ga0495643_0000065_14167_14526 118
288 3300046522 Ga0495643_0073832 Ga0495643_0073832_1099_1458 118
289 3300046522 Ga0495643_0255865 Ga0495643_0255865_378_737 118
290 3300046522 Ga0495643_0352547 Ga0495643_0352547_86_445 118
291 3300046522 Ga0495643_0403802 Ga0495643_0403802_167_526 118
292 3300046523 Ga0495644_0000729 Ga0495644_0000729_33_389 118
293 3300046523 Ga0495644_0032412 Ga0495644_0032412_853_1212 118
294 3300046523 Ga0495644_0139790 Ga0495644_0139790_33_389 118
295 3300046524 Ga0495648_0000078 Ga0495648_0000078_47500_47859 118
296 3300046524 Ga0495648_0000223 Ga0495648_0000223_1401_1757 118
297 3300046524 Ga0495648_0002119 Ga0495648_0002119_7244_7603 118
298 3300046524 Ga0495648_0002624 Ga0495648_0002624_1624_1983 118
299 3300046524 Ga0495648_0021870 Ga0495648_0021870_3721_4080 118
300 3300046524 Ga0495648_0063607 Ga0495648_0063607_998_1357 118
301 3300046524 Ga0495648_0095649 Ga0495648_0095649_922_1281 118
302 3300046524 Ga0495648_0466085 Ga0495648_0466085_47_406 118
303 3300046525 Ga0495663_0002360 Ga0495663_0002360_1535_1909 118
304 3300046525 Ga0495663_0006083 Ga0495663_0006083_1556_1927 118
305 3300046525 Ga0495663_0062727 Ga0495663_0062727_541_900 118
306 3300046528 Ga0495642_0000919 Ga0495642_0000919_11130_11489 118
307 3300046528 Ga0495642_0064643 Ga0495642_0064643_435_794 118
308 3300046528 Ga0495642_0071136 Ga0495642_0071136_193_564 118
309 3300046530 Ga0495654_0000002 Ga0495654_0000002_705550_705945 118
310 3300046538 Ga0495609_0001345 Ga0495609_0001345_5681_6037 118
311 3300046538 Ga0495609_0003504 Ga0495609_0003504_7581_7940 118
312 3300046538 Ga0495609_0004160 Ga0495609_0004160_6246_6605 118
313 3300046538 Ga0495609_0055969 Ga0495609_0055969_207_566 118
314 3300046538 Ga0495609_0196103 Ga0495609_0196103_462_818 118
315 3300046538 Ga0495609_0283953 Ga0495609_0283953_54_413 118
316 3300046538 Ga0495609_0416348 Ga0495609_0416348_124_483 118
317 3300046542 Ga0495597_0000107 Ga0495597_0000107_69512_69871 118
318 3300046542 Ga0495597_0000466 Ga0495597_0000466_7132_7491 118
319 3300046542 Ga0495597_0057702 Ga0495597_0057702_93_452 118
320 3300046542 Ga0495597_0145439 Ga0495597_0145439_108_479 118
321 3300046542 Ga0495597_0321862 Ga0495597_0321862_214_576 118
322 3300046557 Ga0495622_0000009 Ga0495622_0000009_202627_202986 118
323 3300046557 Ga0495622_0000043 Ga0495622_0000043_104113_104472 118
324 3300046557 Ga0495622_0058507 Ga0495622_0058507_1008_1367 118
325 3300046557 Ga0495622_0132981 Ga0495622_0132981_100_456 118
326 3300046557 Ga0495622_0160908 Ga0495622_0160908_297_653 118
327 3300046558 Ga0495633_0000381 Ga0495633_0000381_32657_33016 118
328 3300046558 Ga0495633_0001071 Ga0495633_0001071_20867_21229 118
329 3300046558 Ga0495633_0001381 Ga0495633_0001381_4828_5187 118
330 3300046558 Ga0495633_0006010 Ga0495633_0006010_2539_2898 118
331 3300046558 Ga0495633_0011906 Ga0495633_0011906_1155_1511 118
332 3300046558 Ga0495633_0017835 Ga0495633_0017835_144_500 118
333 3300046558 Ga0495633_0038540 Ga0495633_0038540_1295_1654 118
334 3300046558 Ga0495633_0041795 Ga0495633_0041795_1462_1821 118
335 3300046558 Ga0495633_0058009 Ga0495633_0058009_1447_1803 118
336 3300046558 Ga0495633_0080110 Ga0495633_0080110_88_447 118
337 3300046615 Ga0495656_0027465 Ga0495656_0027465_1036_1410 118
338 3300046615 Ga0495656_0134972 Ga0495656_0134972_178_537 118
339 3300046615 Ga0495656_0237660 Ga0495656_0237660_146_502 118
340 3300046615 Ga0495656_0547965 Ga0495656_0547965_40_399 118
341 3300046616 Ga0495668_0000006 Ga0495668_0000006_260440_260799 118
342 3300046616 Ga0495668_0000027 Ga0495668_0000027_45513_45872 118
343 3300046616 Ga0495668_0000096 Ga0495668_0000096_13446_13805 118
344 3300046616 Ga0495668_0001010 Ga0495668_0001010_11354_11713 118
345 3300046616 Ga0495668_0002945 Ga0495668_0002945_132_491 118
346 3300046616 Ga0495668_0006316 Ga0495668_0006316_5056_5415 118
347 3300046616 Ga0495668_0009642 Ga0495668_0009642_5297_5656 118
348 3300046616 Ga0495668_0024144 Ga0495668_0024144_2481_2840 118
349 3300046616 Ga0495668_0047397 Ga0495668_0047397_1732_2091 118
350 3300046616 Ga0495668_0162294 Ga0495668_0162294_305_676 118
351 3300046616 Ga0495668_0571079 Ga0495668_0571079_41_400 118
352 3300046648 Ga0495611_0000739 Ga0495611_0000739_12874_13230 118
353 3300046648 Ga0495611_0001112 Ga0495611_0001112_8123_8479 118
354 3300046648 Ga0495611_0027310 Ga0495611_0027310_131_487 118
355 3300046660 Ga0495625_0000053 Ga0495625_0000053_13712_14071 118
356 3300046660 Ga0495625_0000058 Ga0495625_0000058_69616_69975 118
357 3300046660 Ga0495625_0002139 Ga0495625_0002139_14660_15019 118
358 3300046660 Ga0495625_0008684 Ga0495625_0008684_3855_4214 118
359 3300046660 Ga0495625_0009909 Ga0495625_0009909_2723_3082 118
360 3300046660 Ga0495625_0040469 Ga0495625_0040469_1469_1825 118
361 3300046660 Ga0495625_0054292 Ga0495625_0054292_653_1012 118
362 3300046660 Ga0495625_0098052 Ga0495625_0098052_1213_1584 118
363 3300046660 Ga0495625_0170284 Ga0495625_0170284_439_798 118
364 3300046660 Ga0495625_0831638 Ga0495625_0831638_129_485 118
365 3300046664 Ga0495659_0000001 Ga0495659_0000001_275939_276310 118
366 3300046664 Ga0495659_0000826 Ga0495659_0000826_7690_8046 118
367 3300046664 Ga0495659_0042167 Ga0495659_0042167_175_534 118
368 3300046664 Ga0495659_0067585 Ga0495659_0067585_449_820 118
369 3300046664 Ga0495659_0253127 Ga0495659_0253127_48_404 118
370 3300046665 Ga0495661_0008008 Ga0495661_0008008_5982_6341 118
371 3300046665 Ga0495661_0055022 Ga0495661_0055022_231_587 118
372 3300046665 Ga0495661_0085283 Ga0495661_0085283_1380_1736 118
373 3300046684 Ga0495669_0000429 Ga0495669_0000429_14014_14373 118
374 3300046691 Ga0495670_0036802 Ga0495670_0036802_1592_1951 118
375 3300046691 Ga0495670_0042045 Ga0495670_0042045_945_1301 118
376 3300046691 Ga0495670_0280515 Ga0495670_0280515_334_693 118
377 3300046691 Ga0495670_0688516 Ga0495670_0688516_85_444 118
378 3300046691 Ga0495670_0720954 Ga0495670_0720954_174_533 118
379 3300046692 Ga0495671_0000002 Ga0495671_0000002_766952_767311 118
380 3300046692 Ga0495671_0000035 Ga0495671_0000035_132909_133280 118
381 3300046692 Ga0495671_0002321 Ga0495671_0002321_10999_11358 118
382 3300046692 Ga0495671_0028825 Ga0495671_0028825_901_1257 118
383 3300046692 Ga0495671_0048524 Ga0495671_0048524_1581_1940 118
384 3300046692 Ga0495671_0073374 Ga0495671_0073374_1282_1641 118
385 3300046692 Ga0495671_0282428 Ga0495671_0282428_431_787 118
386 3300046694 Ga0495649_0002789 Ga0495649_0002789_3751_4110 118
387 3300046694 Ga0495649_0023726 Ga0495649_0023726_138_497 118
388 3300046694 Ga0495649_0348901 Ga0495649_0348901_207_566 118
389 3300046810 Ga0495660_0000069 Ga0495660_0000069_65377_65736 118
390 3300046810 Ga0495660_0001231 Ga0495660_0001231_9670_10029 118
391 3300046810 Ga0495660_0009064 Ga0495660_0009064_4540_4899 118
392 3300046810 Ga0495660_0018729 Ga0495660_0018729_1885_2244 118
393 3300046810 Ga0495660_0025019 Ga0495660_0025019_2403_2762 118
394 3300046810 Ga0495660_0050374 Ga0495660_0050374_1818_2177 118
395 3300046810 Ga0495660_0066348 Ga0495660_0066348_1030_1389 118
396 3300046810 Ga0495660_0080596 Ga0495660_0080596_275_646 118
397 3300046810 Ga0495660_0235097 Ga0495660_0235097_270_626 118
398 3300047318 Ga0495636_0004270 Ga0495636_0004270_2399_2758 118
399 3300047318 Ga0495636_0014845 Ga0495636_0014845_694_1050 118
400 3300047318 Ga0495636_0015425 Ga0495636_0015425_2376_2735 118
401 3300047318 Ga0495636_0036446 Ga0495636_0036446_967_1326 118
402 3300047318 Ga0495636_0091306 Ga0495636_0091306_860_1219 118
403 3300047318 Ga0495636_0629542 Ga0495636_0629542_27_386 118
404 3300047320 Ga0495672_0000066 Ga0495672_0000066_77253_77624 118
405 3300047320 Ga0495672_0000095 Ga0495672_0000095_52494_52853 118
406 3300047320 Ga0495672_0092513 Ga0495672_0092513_1120_1476 118
407 3300047323 Ga0495683_0016696 Ga0495683_0016696_3442_3798 118
408 3300047443 Ga0495687_001158 Ga0495687_001158_20328_20687 118
409 3300047443 Ga0495687_004020 Ga0495687_004020_8181_8537 118
410 3300047443 Ga0495687_051886 Ga0495687_051886_334_693 118
411 3300047445 Ga0495677_0025554 Ga0495677_0025554_670_1026 118
412 3300047445 Ga0495677_0307758 Ga0495677_0307758_94_453 118
413 3300047446 Ga0495679_005149 Ga0495679_005149_383_742 118
414 3300047446 Ga0495679_021023 Ga0495679_021023_1845_2204 118
415 3300047446 Ga0495679_067817 Ga0495679_067817_460_819 118
416 3300047447 Ga0495685_000332 Ga0495685_000332_5587_5943 118
417 3300047447 Ga0495685_005026 Ga0495685_005026_1755_2126 118
418 3300047469 Ga0495673_0000005 Ga0495673_0000005_592004_592363 118
419 3300047469 Ga0495673_0000059 Ga0495673_0000059_18818_19177 118
420 3300047469 Ga0495673_0000064 Ga0495673_0000064_153434_153793 118
421 3300047469 Ga0495673_0000225 Ga0495673_0000225_15557_15916 118
422 3300047469 Ga0495673_0004384 Ga0495673_0004384_1576_1935 118
423 3300047469 Ga0495673_0006534 Ga0495673_0006534_3116_3472 118
424 3300047469 Ga0495673_0033705 Ga0495673_0033705_1027_1386 118
425 3300047470 Ga0495681_0003868 Ga0495681_0003868_2820_3179 118
426 3300047470 Ga0495681_0009347 Ga0495681_0009347_2373_2732 118
427 3300047470 Ga0495681_0025458 Ga0495681_0025458_496_855 118
428 3300047472 Ga0495686_0000462 Ga0495686_0000462_48091_48450 118
429 3300047472 Ga0495686_0001427 Ga0495686_0001427_12069_12428 118
430 3300047472 Ga0495686_0003346 Ga0495686_0003346_13283_13642 118
431 3300047472 Ga0495686_0007226 Ga0495686_0007226_5713_6075 118
432 3300047472 Ga0495686_0036829 Ga0495686_0036829_2295_2654 118
433 3300047472 Ga0495686_0043025 Ga0495686_0043025_605_964 118
434 3300047472 Ga0495686_0084708 Ga0495686_0084708_1148_1507 118
435 3300047472 Ga0495686_0240022 Ga0495686_0240022_249_611 118
436 3300047472 Ga0495686_0395909 Ga0495686_0395909_188_544 118
437 3300048090 Ga0495615_0000340 Ga0495615_0000340_3653_4027 118
438 3300048905 Ga0496102_0000182 Ga0496102_0000182_25498_25857 118
439 3300048905 Ga0496102_0050177 Ga0496102_0050177_2618_2977 118
440 3300048905 Ga0496102_0061923 Ga0496102_0061923_1579_1938 118
441 3300048905 Ga0496102_0792193 Ga0496102_0792193_155_514 118
442 3300048906 Ga0496103_0069924 Ga0496103_0069924_299_658 118
443 3300048909 Ga0496106_0008622 Ga0496106_0008622_343_702 118
444 3300048910 Ga0496107_0000058 Ga0496107_0000058_53062_53421 118
445 3300048911 Ga0496108_0953565 Ga0496108_0953565_209_568 118
446 3300048914 Ga0496111_0154702 Ga0496111_0154702_870_1232 118
447 3300048919 Ga0496116_0015645 Ga0496116_0015645_850_1212 118
448 3300048919 Ga0496116_0074770 Ga0496116_0074770_1271_1630 118
449 3300048920 Ga0496117_0000001 Ga0496117_0000001_1224502_1224864 118
450 3300048921 Ga0496118_0000002 Ga0496118_0000002_1224502_1224864 118
451 3300048924 Ga0496121_0007795 Ga0496121_0007795_3783_4145 118
452 3300048924 Ga0496121_0008882 Ga0496121_0008882_508_867 118
453 3300048924 Ga0496121_0011077 Ga0496121_0011077_7836_8198 118
454 3300048924 Ga0496121_0204706 Ga0496121_0204706_78_440 118
455 3300048924 Ga0496121_0281271 Ga0496121_0281271_220_579 118
456 3300048924 Ga0496121_0502829 Ga0496121_0502829_218_577 118
457 3300048924 Ga0496121_0649218 Ga0496121_0649218_225_584 118
458 3300048925 Ga0496122_0013372 Ga0496122_0013372_4006_4368 118
459 3300048925 Ga0496122_0075194 Ga0496122_0075194_1084_1443 118
460 3300048925 Ga0496122_0460610 Ga0496122_0460610_65_424 118
461 3300048926 Ga0496123_0012122 Ga0496123_0012122_1742_2101 118
462 3300048927 Ga0496124_0012443 Ga0496124_0012443_3806_4165 118
463 3300048927 Ga0496124_0029879 Ga0496124_0029879_43_402 118
464 3300048927 Ga0496124_0065386 Ga0496124_0065386_2038_2400 118
465 3300048928 Ga0496125_0034021 Ga0496125_0034021_36_398 118
466 3300048928 Ga0496125_0086440 Ga0496125_0086440_1964_2326 118
467 3300049459 Ga0495678_000588 Ga0495678_000588_26183_26542 118
468 3300049459 Ga0495678_002236 Ga0495678_002236_8120_8479 118
469 3300049459 Ga0495678_007047 Ga0495678_007047_5313_5672 118
470 3300049459 Ga0495678_008805 Ga0495678_008805_932_1291 118
471 3300049459 Ga0495678_017062 Ga0495678_017062_1904_2260 118
472 3300049459 Ga0495678_026830 Ga0495678_026830_1206_1565 118
473 3300049460 Ga0495682_0000302 Ga0495682_0000302_12981_13337 118
474 3300049460 Ga0495682_0000965 Ga0495682_0000965_10186_10542 118
475 3300049460 Ga0495682_0012517 Ga0495682_0012517_1142_1504 118
476 3300049654 Ga0501207_146034 Ga0501207_146034_112_471 118
477 3300049662 Ga0501222_006577 Ga0501222_006577_1022_1381 118
478 3300049665 Ga0501227_002037 Ga0501227_002037_2646_3005 118
479 3300049668 Ga0501233_281042 Ga0501233_281042_95_457 118
480 3300049669 Ga0501235_172503 Ga0501235_172503_159_518 118
481 3300049671 Ga0501238_045365 Ga0501238_045365_175_534 118
482 3300049680 Ga0501250_080279 Ga0501250_080279_131_490 118
483 3300049704 Ga0501221_241331 Ga0501221_241331_18_377 118
484 3300049758 Ga0501241_026866 Ga0501241_026866_439_798 118
485 3300049766 Ga0501269_000423 Ga0501269_000423_8617_8976 118
486 3300049766 Ga0501269_007654 Ga0501269_007654_173_532 118
487 3300049775 Ga0501279_003529 Ga0501279_003529_724_1083 118
488 3300049775 Ga0501279_004382 Ga0501279_004382_144_503 118
489 3300050490 nmdc:mga03n38_26634_c1 nmdc:mga03n38_26634_c1_978_1337 118
490 3300050493 nmdc:mga0k408_87260_c1 nmdc:mga0k408_87260_c1_817_1176 118
491 3300053086 Ga0500578_0001551 Ga0500578_0001551_21897_22256 118
492 3300053087 Ga0500643_039930 Ga0500643_039930_522_881 118
493 3300053087 Ga0500643_108048 Ga0500643_108048_60_419 118
494 3300053088 Ga0500644_0004985 Ga0500644_0004985_1594_1953 118
495 3300053096 Ga0500641_0250129 Ga0500641_0250129_250_609 118
496 3300053108 Ga0500562_010250 Ga0500562_010250_205_564 118
497 3300053118 Ga0500594_0000389 Ga0500594_0000389_9222_9581 118
498 3300053118 Ga0500594_0002295 Ga0500594_0002295_552_911 118
499 3300053118 Ga0500594_0004222 Ga0500594_0004222_16_375 118
500 3300053123 Ga0500614_037674 Ga0500614_037674_744_1103 118
501 3300053125 Ga0500618_000064 Ga0500618_000064_41094_41453 118
502 3300053125 Ga0500618_000137 Ga0500618_000137_2844_3203 118
503 3300053136 Ga0500559_0000056 Ga0500559_0000056_10032_10391 118
504 3300053136 Ga0500559_0002417 Ga0500559_0002417_9157_9516 118
505 3300053138 Ga0500564_001125 Ga0500564_001125_2870_3229 118
506 3300053142 Ga0500577_0014764 Ga0500577_0014764_1473_1832 118
507 3300053145 Ga0500586_000227 Ga0500586_000227_6966_7325 118
508 3300053145 Ga0500586_001150 Ga0500586_001150_1407_1766 118
509 3300053153 Ga0500616_0364918 Ga0500616_0364918_48_407 118
510 3300053156 Ga0500622_0005232 Ga0500622_0005232_7232_7591 118
511 3300053156 Ga0500622_0036983 Ga0500622_0036983_922_1281 118
512 3300053731 Ga0500609_000278 Ga0500609_000278_4172_4531 118
513 iso_pu_bacteria 2738541280 2738739992 118
514 iso_pu_bacteria 2738541300 2738844253 118
515 iso_pu_bacteria 2738543018 2739274187 118
516 iso_pu_bacteria 2738543030 2739343231 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06993

DUF1304

Protein of unknown function (DUF1304)

22

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5522 5 117
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5428 8 117
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5225 5 117
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5172 8 117
7jpv-assembly1.cif.gz_E rabbit cav1.1 in the presence of 1 micromolar (s)-(-)-bay k8644 in nanodiscs at 3.4 angstrom resolution 0.4348 6 116
ID Description Score Start End Superfamily
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7202 5 117 1.20.120.550
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6895 5 117 1.20.120.550
af_F4HWQ8_22_164_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.675 4 118 1.20.140.40
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6639 5 118 1.20.1280.290
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6506 5 118 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A1I3YXW7-F1-model_v4 Putative membrane protein 0.9789 1 117 GO:0016020
AF-A0A0Q8FQ75-F1-model_v4 Epimerase 0.977 1 117 GO:0016020
AF-A0A1I0VN24-F1-model_v4 Putative membrane protein 0.9733 1 118 GO:0016020
AF-A0A255HK25-F1-model_v4 DUF1304 domain-containing protein 0.9722 1 118 GO:0016020
AF-A0A1S1UAN9-F1-model_v4 Membrane protein 0.9718 3 118 GO:0016020

Feature Viewer

pLDDT pTM Quality
96.67 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map