F458033

General Info

Members Datasets Scaffolds Average Seq Length
516 216 1032 127

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0003614|Ga0466963_0003614_700_1083
Length 122
Sequence MNSDEIRLVIPAEEDFRPIAHLVTGGLASRLDVTYDDLDDLQVGIEALLALRDVVSLSADGGTLRASLGPFTPEALHEDGAHRDLDLERVLSTVCDTHEIQQRDGAAWVELTKRIATPAGAS

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
96 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
212 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 4.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 11.05
Rhizosphere 88.37
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0003614 3300044694 Bacteria 8885
2 Ga0070683_100039696 3300005329 Bacteria 4323
3 Ga0070683_100298086 3300005329 Bacteria 1533
4 Ga0070680_100882221 3300005336 Bacteria 771
5 Ga0070680_101413262 3300005336 Bacteria 602
6 Ga0070682_100449274 3300005337 Bacteria 987
7 Ga0070682_100556406 3300005337 Bacteria 898
8 Ga0070682_100775255 3300005337 Bacteria 777
9 Ga0068868_100624786 3300005338 Bacteria 957
10 Ga0068868_101664276 3300005338 Bacteria 601
11 Ga0070660_100159793 3300005339 Unclassified 1815
12 Ga0070660_101209567 3300005339 Bacteria 641
13 Ga0070691_10055053 3300005341 Unclassified 1905
14 Ga0070661_101133343 3300005344 Bacteria 652
15 Ga0070659_100009486 3300005366 Bacteria 7151
16 Ga0070659_101300990 3300005366 Bacteria 645
17 Ga0070709_10167002 3300005434 Bacteria 1535
18 Ga0070709_11098872 3300005434 Unclassified 636
19 Ga0070714_100011686 3300005435 Bacteria 6972
20 Ga0070714_100042846 3300005435 Bacteria 3825
21 Ga0070714_100049219 3300005435 Bacteria 3587
22 Ga0070714_100111526 3300005435 Bacteria 2422
23 Ga0070714_100336630 3300005435 Bacteria 1414
24 Ga0070713_100042261 3300005436 Bacteria 3719
25 Ga0070713_100071565 3300005436 Bacteria 2931
26 Ga0070713_100201101 3300005436 Bacteria 1799
27 Ga0070710_10010246 3300005437 Bacteria 4601
28 Ga0070710_10049093 3300005437 Bacteria 2359
29 Ga0070710_10356413 3300005437 Unclassified 970
30 Ga0070711_100006378 3300005439 Bacteria 7110
31 Ga0070711_100008987 3300005439 Bacteria 6132
32 Ga0070705_100061590 3300005440 Bacteria 2231
33 Ga0070705_100246949 3300005440 Bacteria 1250
34 Ga0070694_100358350 3300005444 Bacteria 1132
35 Ga0070678_100841065 3300005456 Bacteria 836
36 Ga0070681_10039456 3300005458 Bacteria 4733
37 Ga0070681_10827116 3300005458 Bacteria 843
38 Ga0070706_100400804 3300005467 Bacteria 1277
39 Ga0070707_100585019 3300005468 Bacteria 1079
40 Ga0070699_100485323 3300005518 Bacteria 1122
41 Ga0070679_100071559 3300005530 Bacteria 3459
42 Ga0070679_100117606 3300005530 Bacteria 2643
43 Ga0070679_100347367 3300005530 Bacteria 1431
44 Ga0070684_100096880 3300005535 Bacteria 2630
45 Ga0070684_100263586 3300005535 Bacteria 1576
46 Ga0070686_100419751 3300005544 Bacteria 1022
47 Ga0070695_100000023 3300005545 Bacteria 60293
48 Ga0070696_100548570 3300005546 Unclassified 926
49 Ga0068855_100269270 3300005563 Bacteria 1894
50 Ga0068856_100058295 3300005614 Bacteria 3813
51 Ga0068856_100389265 3300005614 Bacteria 1414
52 Ga0068856_100389370 3300005614 Bacteria 1413
53 Ga0068856_102351312 3300005614 Bacteria 541
54 Ga0068858_100515002 3300005842 Bacteria 1157
55 Ga0070717_10014102 3300006028 Bacteria 6142
56 Ga0070717_10025379 3300006028 Bacteria 4712
57 Ga0070717_10061249 3300006028 Bacteria 3118
58 Ga0070717_10113640 3300006028 Bacteria 2312
59 Ga0070715_10000231 3300006163 Bacteria 13317
60 Ga0070715_10544741 3300006163 Bacteria 672
61 Ga0070716_100002634 3300006173 Bacteria 8295
62 Ga0070716_100271557 3300006173 Bacteria 1165
63 Ga0070716_100863334 3300006173 Bacteria 706
64 Ga0070712_100141056 3300006175 Bacteria 1839
65 Ga0070712_100930126 3300006175 Bacteria 750
66 Ga0070712_101789734 3300006175 Unclassified 538
67 Ga0068871_101024312 3300006358 Bacteria 770
68 Ga0075433_10221619 3300006852 Unclassified 1680
69 Ga0075434_100000658 3300006871 Bacteria 26789
70 Ga0075436_101416356 3300006914 Unclassified 527
71 Ga0105240_10006035 3300009093 Bacteria 17912
72 Ga0105240_10140992 3300009093 Bacteria 2882
73 Ga0105245_10109515 3300009098 Bacteria 2567
74 Ga0105245_11126793 3300009098 Bacteria 831
75 Ga0105247_10260622 3300009101 Bacteria 1189
76 Ga0105241_10262998 3300009174 Bacteria 1467
77 Ga0105241_12194029 3300009174 Bacteria 548
78 Ga0105242_10637560 3300009176 Bacteria 1034
79 Ga0105248_10425246 3300009177 Bacteria 1496
80 Ga0105248_11148673 3300009177 Bacteria 878
81 Ga0105237_10078267 3300009545 Bacteria 3296
82 Ga0105237_11023203 3300009545 Bacteria 833
83 Ga0105237_11541647 3300009545 Bacteria 671
84 Ga0105238_11098964 3300009551 Unclassified 818
85 Ga0105239_10360037 3300010375 Bacteria 1643
86 Ga0105246_10108146 3300011119 Bacteria 2038
87 Ga0157371_11096198 3300013102 Bacteria 610
88 Ga0157370_10127463 3300013104 Bacteria 2376
89 Ga0157369_10205878 3300013105 Bacteria 2064
90 Ga0157369_10408158 3300013105 Bacteria 1409
91 Ga0157374_10113986 3300013296 Bacteria 2602
92 Ga0157374_11688808 3300013296 Bacteria 658
93 Ga0157378_12548800 3300013297 Bacteria 564
94 Ga0163162_10524967 3300013306 Bacteria 1313
95 Ga0157372_10085803 3300013307 Bacteria 3571
96 Ga0157372_10394561 3300013307 Bacteria 1613
97 Ga0157372_10847809 3300013307 Bacteria 1061
98 Ga0182008_10056520 3300014497 Unclassified 1939
99 Ga0182008_10483149 3300014497 Bacteria 678
100 Ga0157377_10246568 3300014745 Bacteria 1155
101 Ga0157379_10286647 3300014968 Bacteria 1499
102 Ga0157379_11225877 3300014968 Bacteria 722
103 Ga0157376_10274135 3300014969 Bacteria 1586
104 Ga0157376_11440991 3300014969 Bacteria 721
105 Ga0206356_11802331 3300020070 Bacteria 1341
106 Ga0206349_1004918 3300020075 Unclassified 891
107 Ga0206349_1017270 3300020075 Bacteria 1264
108 Ga0206349_1641620 3300020075 Bacteria 525
109 Ga0206349_1861308 3300020075 Bacteria 632
110 Ga0206351_10594931 3300020077 Unclassified 740
111 Ga0206350_10124179 3300020080 Bacteria 731
112 Ga0206350_11654165 3300020080 Unclassified 683
113 Ga0206354_10556677 3300020081 Unclassified 558
114 Ga0206353_11158783 3300020082 Bacteria 742
115 Ga0224712_10021925 3300022467 Bacteria 2194
116 Ga0224712_10246197 3300022467 Bacteria 825
117 Ga0224712_10290080 3300022467 Unclassified 763
118 Ga0224712_10296458 3300022467 Unclassified 755
119 Ga0207692_10005469 3300025898 Bacteria 5092
120 Ga0207692_10017136 3300025898 Bacteria 3224
121 Ga0207710_10112570 3300025900 Bacteria 1293
122 Ga0207680_10604569 3300025903 Bacteria 784
123 Ga0207685_10175392 3300025905 Bacteria 990
124 Ga0207685_10415846 3300025905 Unclassified 692
125 Ga0207685_10861108 3300025905 Bacteria 502
126 Ga0207699_10008513 3300025906 Bacteria 5069
127 Ga0207699_10117705 3300025906 Bacteria 1713
128 Ga0207707_10085918 3300025912 Bacteria 2749
129 Ga0207707_10142763 3300025912 Bacteria 2093
130 Ga0207695_10052943 3300025913 Bacteria 4249
131 Ga0207671_10064040 3300025914 Bacteria 2733
132 Ga0207693_10000198 3300025915 Bacteria 54576
133 Ga0207693_10001236 3300025915 Bacteria 22780
134 Ga0207663_10017495 3300025916 Bacteria 3996
135 Ga0207660_10275639 3300025917 Bacteria 1333
136 Ga0207657_10018647 3300025919 Bacteria 6615
137 Ga0207649_10987038 3300025920 Bacteria 662
138 Ga0207652_10101502 3300025921 Bacteria 2541
139 Ga0207687_10204264 3300025927 Bacteria 1546
140 Ga0207700_10250797 3300025928 Bacteria 1512
141 Ga0207664_10002217 3300025929 Bacteria 12795
142 Ga0207664_10035486 3300025929 Bacteria 3848
143 Ga0207664_10067528 3300025929 Bacteria 2870
144 Ga0207664_10078382 3300025929 Bacteria 2679
145 Ga0207664_10166493 3300025929 Bacteria 1884
146 Ga0207664_10176018 3300025929 Bacteria 1834
147 Ga0207644_10604088 3300025931 Unclassified 911
148 Ga0207690_10034795 3300025932 Bacteria 3248
149 Ga0207706_10211536 3300025933 Unclassified 1700
150 Ga0207665_10006250 3300025939 Bacteria 7903
151 Ga0207665_10878480 3300025939 Bacteria 710
152 Ga0207711_10297659 3300025941 Bacteria 1488
153 Ga0207711_10781851 3300025941 Bacteria 889
154 Ga0207689_11547431 3300025942 Bacteria 553
155 Ga0207679_10133503 3300025945 Bacteria 1995
156 Ga0207677_10329711 3300026023 Bacteria 1271
157 Ga0207677_11723277 3300026023 Bacteria 581
158 Ga0207702_10467241 3300026078 Bacteria 1226
159 Ga0207702_10733030 3300026078 Bacteria 975
160 Ga0207676_11821291 3300026095 Bacteria 607
161 Ga0373959_0061182 3300034820 Bacteria 834
162 Ga0373934_0116483 3300035086 Bacteria 1086
163 Ga0373940_0042383 3300035088 Bacteria 1254
164 Ga0373949_0062034 3300035090 Bacteria 964
165 Ga0373951_0168515 3300035091 Bacteria 623
166 Ga0373923_0385093 3300035111 Unclassified 673
167 Ga0373936_0029224 3300035113 Bacteria 2169
168 Ga0373941_0044254 3300035115 Bacteria 1389
169 Ga0373945_0042203 3300035116 Bacteria 1652
170 Ga0373957_0092245 3300035120 Bacteria 1205
171 Ga0373943_0482684 3300035170 Bacteria 723
172 Ga0373962_0110972 3300035242 Bacteria 865
173 Ga0373924_0074368 3300035410 Bacteria 1437
174 Ga0373924_0349904 3300035410 Bacteria 658
175 Ga0373924_0538183 3300035410 Bacteria 526
176 Ga0373931_0055756 3300035691 Bacteria 2116
177 Ga0373933_0037296 3300035724 Bacteria 2851
178 Ga0373933_0497862 3300035724 Bacteria 798
179 Ga0373947_0009946 3300035725 Bacteria 5463
180 Ga0373937_0013935 3300036401 Bacteria 7088
181 Ga0373937_0893414 3300036401 Bacteria 837
182 Ga0395899_0542175 3300037312 Bacteria 749
183 Ga0395898_1114047 3300037466 Bacteria 722
184 Ga0395898_1685154 3300037466 Unclassified 557
185 Ga0395905_0840198 3300037471 Bacteria 821
186 Ga0395901_0034600 3300038443 Bacteria 5218
187 Ga0451789_0654972 3300041443 Bacteria 610
188 Ga0466969_0302751 3300044656 Bacteria 724
189 Ga0466965_0062396 3300044683 Bacteria 1864
190 Ga0466966_0023584 3300044684 Bacteria 4027
191 Ga0466961_0011110 3300044693 Bacteria 5755
192 Ga0466961_0012105 3300044693 Bacteria 5515
193 Ga0466961_0018914 3300044693 Bacteria 4432
194 Ga0466961_0220814 3300044693 Bacteria 1168
195 Ga0466963_0000263 3300044694 Bacteria 23137
196 Ga0466963_0003533 3300044694 Bacteria 8969
197 Ga0466963_0010385 3300044694 Bacteria 5636
198 Ga0466963_0012514 3300044694 Bacteria 5196
199 Ga0466963_0021378 3300044694 Bacteria 4081
200 Ga0466963_0024772 3300044694 Bacteria 3821
201 Ga0466963_0024928 3300044694 Bacteria 3810
202 Ga0466963_0042429 3300044694 Bacteria 2987
203 Ga0466963_0068759 3300044694 Bacteria 2379
204 Ga0466963_0119799 3300044694 Bacteria 1810
205 Ga0466963_0196706 3300044694 Bacteria 1409
206 Ga0466963_0245769 3300044694 Bacteria 1255
207 Ga0466964_0004321 3300044706 Bacteria 5237
208 Ga0466964_0012795 3300044706 Bacteria 3178
209 Ga0466964_0021556 3300044706 Bacteria 2493
210 Ga0466964_0025202 3300044706 Bacteria 2321
211 Ga0466964_0053223 3300044706 Unclassified 1665
212 Ga0466964_0461305 3300044706 Bacteria 675
213 Ga0466964_0795200 3300044706 Unclassified 534
214 Ga0466971_0021829 3300044719 Bacteria 2849
215 Ga0466971_0026945 3300044719 Bacteria 2572
216 Ga0466971_0041107 3300044719 Bacteria 2076
217 Ga0466971_0057684 3300044719 Bacteria 1752
218 Ga0466968_0002839 3300044735 Bacteria 6402
219 Ga0466968_0004035 3300044735 Bacteria 5458
220 Ga0466968_0022546 3300044735 Bacteria 2559
221 Ga0466968_0044800 3300044735 Unclassified 1875
222 Ga0466968_0145237 3300044735 Bacteria 1087
223 Ga0466970_0174979 3300044765 Bacteria 1190
224 Ga0466957_0004887 3300044842 Bacteria 7497
225 Ga0466957_0008787 3300044842 Bacteria 5751
226 Ga0466957_0027415 3300044842 Bacteria 3385
227 Ga0466957_0029450 3300044842 Bacteria 3274
228 Ga0466957_0039677 3300044842 Bacteria 2841
229 Ga0466957_0051255 3300044842 Bacteria 2512
230 Ga0466957_0063954 3300044842 Bacteria 2263
231 Ga0466957_0181656 3300044842 Bacteria 1374
232 Ga0466957_0269869 3300044842 Bacteria 1136
233 Ga0466957_0277596 3300044842 Bacteria 1120
234 Ga0466960_0083961 3300044901 Bacteria 1611
235 Ga0466960_0654862 3300044901 Unclassified 627
236 Ga0466959_0002970 3300045049 Bacteria 10947
237 Ga0466959_0028599 3300045049 Bacteria 4133
238 Ga0466958_0005696 3300045836 Bacteria 6729
239 Ga0466958_0006324 3300045836 Bacteria 6436
240 Ga0466958_0008951 3300045836 Bacteria 5563
241 Ga0466958_0016826 3300045836 Bacteria 4217
242 Ga0466958_0032405 3300045836 Bacteria 3108
243 Ga0466958_0053558 3300045836 Bacteria 2446
244 Ga0466958_0236359 3300045836 Bacteria 1167
245 Ga0466958_0242628 3300045836 Bacteria 1151
246 Ga0466967_0002824 3300045976 Bacteria 11017
247 Ga0466967_0003544 3300045976 Bacteria 10221
248 Ga0466967_0011891 3300045976 Bacteria 6626
249 Ga0466967_0028702 3300045976 Bacteria 4648
250 Ga0466967_0030743 3300045976 Bacteria 4509
251 Ga0466967_0031133 3300045976 Bacteria 4487
252 Ga0466967_0035496 3300045976 Bacteria 4245
253 Ga0466967_0053600 3300045976 Bacteria 3545
254 Ga0466967_0078098 3300045976 Bacteria 2981
255 Ga0466967_0087734 3300045976 Bacteria 2821
256 Ga0466967_0110278 3300045976 Bacteria 2527
257 Ga0466967_0145145 3300045976 Bacteria 2213
258 Ga0466967_0174507 3300045976 Bacteria 2024
259 Ga0466967_0212256 3300045976 Bacteria 1836
260 Ga0466967_0257209 3300045976 Bacteria 1669
261 Ga0466967_0327154 3300045976 Bacteria 1479
262 Ga0466967_1260355 3300045976 Bacteria 736
263 Ga0495592_0000708 3300046454 Bacteria 23320
264 Ga0495592_0146450 3300046454 Bacteria 1637
265 Ga0495592_0163340 3300046454 Unclassified 1530
266 Ga0495592_0273818 3300046454 Bacteria 1106
267 Ga0495603_0432428 3300046455 Bacteria 754
268 Ga0495603_0586100 3300046455 Bacteria 638
269 Ga0495629_0003233 3300046459 Bacteria 12343
270 Ga0495629_0071276 3300046459 Bacteria 2425
271 Ga0495629_0119423 3300046459 Bacteria 1837
272 Ga0495629_0309209 3300046459 Bacteria 1081
273 Ga0495629_0321559 3300046459 Bacteria 1057
274 Ga0495641_0005630 3300046461 Bacteria 8372
275 Ga0495641_0113273 3300046461 Bacteria 1210
276 Ga0495641_0118980 3300046461 Bacteria 1178
277 Ga0495651_0000885 3300046462 Bacteria 23327
278 Ga0495653_0001808 3300046463 Bacteria 16847
279 Ga0495653_0038945 3300046463 Bacteria 3728
280 Ga0495653_0118421 3300046463 Bacteria 1891
281 Ga0495653_0207030 3300046463 Bacteria 1327
282 Ga0495582_0000711 3300046473 Bacteria 18383
283 Ga0495582_0254713 3300046473 Unclassified 1007
284 Ga0495582_0276065 3300046473 Unclassified 965
285 Ga0495582_0343324 3300046473 Bacteria 859
286 Ga0495582_0521763 3300046473 Bacteria 687
287 Ga0495605_0090575 3300046474 Bacteria 1418
288 Ga0495639_0000520 3300046475 Bacteria 18060
289 Ga0495639_0068996 3300046475 Bacteria 1630
290 Ga0495639_0234031 3300046475 Bacteria 905
291 Ga0495662_0039026 3300046476 Bacteria 2294
292 Ga0495662_0102970 3300046476 Bacteria 1397
293 Ga0495664_0002367 3300046477 Bacteria 10105
294 Ga0495664_0078543 3300046477 Bacteria 1977
295 Ga0495664_0093958 3300046477 Bacteria 1804
296 Ga0495664_0184926 3300046477 Bacteria 1263
297 Ga0495664_0561899 3300046477 Bacteria 679
298 Ga0495584_0142671 3300046491 Bacteria 1216
299 Ga0495585_0054760 3300046492 Bacteria 2205
300 Ga0495596_0092930 3300046500 Bacteria 1171
301 Ga0495607_0100989 3300046501 Bacteria 1545
302 Ga0495608_0015658 3300046511 Bacteria 5251
303 Ga0495608_0017691 3300046511 Bacteria 4928
304 Ga0495608_0152680 3300046511 Bacteria 1471
305 Ga0495608_0305543 3300046511 Bacteria 984
306 Ga0495618_0024029 3300046514 Bacteria 3773
307 Ga0495618_0058845 3300046514 Bacteria 2435
308 Ga0495618_0077750 3300046514 Bacteria 2114
309 Ga0495618_0222094 3300046514 Bacteria 1191
310 Ga0495628_0001243 3300046516 Bacteria 23312
311 Ga0495628_0020893 3300046516 Bacteria 5392
312 Ga0495628_0110894 3300046516 Bacteria 2110
313 Ga0495628_0359819 3300046516 Bacteria 1068
314 Ga0495630_0001392 3300046517 Bacteria 16705
315 Ga0495630_0004401 3300046517 Bacteria 9895
316 Ga0495630_0036630 3300046517 Bacteria 3667
317 Ga0495644_0004369 3300046523 Bacteria 5552
318 Ga0495666_0000272 3300046526 Bacteria 22361
319 Ga0495642_0138782 3300046528 Bacteria 1049
320 Ga0495652_0003720 3300046529 Bacteria 14931
321 Ga0495652_0040958 3300046529 Bacteria 4001
322 Ga0495652_0067742 3300046529 Bacteria 2992
323 Ga0495652_0111985 3300046529 Bacteria 2193
324 Ga0495652_0257095 3300046529 Bacteria 1291
325 Ga0495665_0100156 3300046531 Bacteria 1521
326 Ga0495665_0135612 3300046531 Bacteria 1287
327 Ga0495640_0012871 3300046533 Bacteria 6381
328 Ga0495640_0197982 3300046533 Bacteria 1274
329 Ga0495640_0271060 3300046533 Bacteria 1058
330 Ga0495640_0357586 3300046533 Bacteria 900
331 Ga0495586_0088187 3300046535 Bacteria 1711
332 Ga0495586_0105012 3300046535 Bacteria 1570
333 Ga0495586_0417537 3300046535 Bacteria 772
334 Ga0495586_0560848 3300046535 Unclassified 659
335 Ga0495587_0000675 3300046536 Bacteria 22859
336 Ga0495587_0063092 3300046536 Bacteria 2168
337 Ga0495645_0000684 3300046543 Bacteria 23313
338 Ga0495645_0065078 3300046543 Bacteria 2637
339 Ga0495645_0223493 3300046543 Bacteria 1265
340 Ga0495667_0042831 3300046559 Bacteria 3001
341 Ga0495667_0045455 3300046559 Bacteria 2908
342 Ga0495667_0074564 3300046559 Bacteria 2209
343 Ga0495667_0446955 3300046559 Bacteria 812
344 Ga0495667_0647876 3300046559 Unclassified 656
345 Ga0495656_0001261 3300046615 Bacteria 8225
346 Ga0495634_0041780 3300046642 Bacteria 3113
347 Ga0495634_0146885 3300046642 Bacteria 1493
348 Ga0495634_0169101 3300046642 Bacteria 1374
349 Ga0495634_0391677 3300046642 Bacteria 826
350 Ga0495611_0114199 3300046648 Bacteria 1258
351 Ga0495635_0045501 3300046663 Bacteria 3029
352 Ga0495635_0484296 3300046663 Bacteria 816
353 Ga0495657_0005553 3300046675 Bacteria 9960
354 Ga0495657_0056557 3300046675 Bacteria 2611
355 Ga0495657_0435712 3300046675 Bacteria 768
356 Ga0495599_0000455 3300046678 Bacteria 23331
357 Ga0495599_0065564 3300046678 Bacteria 2268
358 Ga0495599_0122120 3300046678 Bacteria 1619
359 Ga0495599_0760205 3300046678 Bacteria 555
360 Ga0495623_0000578 3300046679 Bacteria 24437
361 Ga0495623_0144455 3300046679 Bacteria 1412
362 Ga0495623_0566522 3300046679 Bacteria 593
363 Ga0495646_0034360 3300046680 Bacteria 3149
364 Ga0495646_0166386 3300046680 Bacteria 1217
365 Ga0495646_0595828 3300046680 Bacteria 562
366 Ga0495647_0001653 3300046681 Bacteria 6905
367 Ga0495647_0005702 3300046681 Bacteria 4093
368 Ga0495647_0224261 3300046681 Unclassified 830
369 Ga0495658_0013818 3300046683 Bacteria 4115
370 Ga0495658_0091095 3300046683 Bacteria 1805
371 Ga0495613_0004240 3300046689 Bacteria 10743
372 Ga0495613_0007635 3300046689 Bacteria 8045
373 Ga0495613_0132168 3300046689 Bacteria 1787
374 Ga0495613_0274635 3300046689 Bacteria 1171
375 Ga0495613_0389803 3300046689 Bacteria 951
376 Ga0495613_0534095 3300046689 Bacteria 786
377 Ga0495613_1045660 3300046689 Bacteria 523
378 Ga0495624_0002049 3300046690 Bacteria 15346
379 Ga0495624_0017518 3300046690 Bacteria 4808
380 Ga0495624_0120788 3300046690 Bacteria 1609
381 Ga0495624_0538588 3300046690 Bacteria 697
382 Ga0495670_0212743 3300046691 Bacteria 1026
383 Ga0495589_0061720 3300046794 Bacteria 1839
384 Ga0495600_0006544 3300046809 Bacteria 7091
385 Ga0495600_0039508 3300046809 Bacteria 3073
386 Ga0495600_0104470 3300046809 Bacteria 1846
387 Ga0495660_0133347 3300046810 Bacteria 1244
388 Ga0495581_0002214 3300047315 Bacteria 10948
389 Ga0495581_0039745 3300047315 Bacteria 2723
390 Ga0495581_0455872 3300047315 Bacteria 744
391 Ga0495604_0001028 3300047317 Bacteria 23261
392 Ga0495604_0190425 3300047317 Bacteria 1430
393 Ga0495604_0232398 3300047317 Bacteria 1264
394 Ga0495604_0415645 3300047317 Unclassified 883
395 Ga0495604_0455020 3300047317 Bacteria 836
396 Ga0495604_0476374 3300047317 Bacteria 812
397 Ga0495636_0059441 3300047318 Bacteria 1613
398 Ga0495674_0014416 3300047319 Bacteria 7399
399 Ga0495674_0071159 3300047319 Bacteria 3003
400 Ga0495674_0139843 3300047319 Bacteria 2035
401 Ga0495674_0169685 3300047319 Bacteria 1821
402 Ga0495674_0612885 3300047319 Bacteria 861
403 Ga0495674_0647537 3300047319 Bacteria 833
404 Ga0495674_1312113 3300047319 Unclassified 543
405 Ga0495676_0018323 3300047321 Bacteria 6173
406 Ga0495676_0171352 3300047321 Bacteria 1527
407 Ga0495676_0537745 3300047321 Bacteria 764
408 Ga0495680_0006575 3300047322 Bacteria 10783
409 Ga0495680_0043586 3300047322 Bacteria 3551
410 Ga0495680_0082531 3300047322 Bacteria 2425
411 Ga0495680_0109600 3300047322 Bacteria 2047
412 Ga0495680_0763159 3300047322 Bacteria 634
413 Ga0495683_0328244 3300047323 Bacteria 651
414 Ga0495675_0000592 3300047444 Bacteria 23327
415 Ga0495675_0030138 3300047444 Bacteria 3462
416 Ga0495675_0103180 3300047444 Bacteria 1783
417 Ga0495675_0258740 3300047444 Bacteria 1043
418 Ga0495684_0044269 3300047471 Bacteria 3407
419 Ga0495684_0203998 3300047471 Bacteria 1456
420 Ga0495593_0061960 3300047673 Bacteria 1956
421 Ga0495602_0001484 3300048088 Bacteria 23328
422 Ga0495602_0031585 3300048088 Bacteria 5004
423 Ga0495602_0122603 3300048088 Bacteria 2088
424 Ga0495602_0188192 3300048088 Bacteria 1585
425 Ga0495614_0000132 3300048089 Bacteria 26286
426 Ga0496100_0342733 3300048903 Bacteria 1127
427 Ga0496101_0004136 3300048904 Bacteria 9084
428 Ga0496101_0178663 3300048904 Bacteria 1634
429 Ga0496101_0245753 3300048904 Bacteria 1393
430 Ga0496102_0061864 3300048905 Bacteria 3427
431 Ga0496102_0063022 3300048905 Bacteria 3394
432 Ga0496102_0161738 3300048905 Bacteria 2106
433 Ga0496103_0005199 3300048906 Bacteria 7827
434 Ga0496103_0029005 3300048906 Bacteria 3361
435 Ga0496104_0140649 3300048907 Bacteria 2318
436 Ga0496104_0252456 3300048907 Bacteria 1676
437 Ga0496104_0408784 3300048907 Bacteria 1269
438 Ga0496104_0564196 3300048907 Bacteria 1049
439 Ga0496105_0000926 3300048908 Bacteria 19982
440 Ga0496105_0009437 3300048908 Bacteria 7631
441 Ga0496105_0103590 3300048908 Bacteria 2350
442 Ga0496105_0752213 3300048908 Unclassified 744
443 Ga0496106_0009895 3300048909 Bacteria 7039
444 Ga0496106_0228795 3300048909 Bacteria 1484
445 Ga0496106_0792532 3300048909 Bacteria 752
446 Ga0496106_0891598 3300048909 Bacteria 703
447 Ga0496107_0010895 3300048910 Bacteria 6325
448 Ga0496107_0083617 3300048910 Bacteria 2328
449 Ga0496107_0448676 3300048910 Bacteria 958
450 Ga0496107_0599671 3300048910 Bacteria 814
451 Ga0496108_0007571 3300048911 Bacteria 8796
452 Ga0496108_0021350 3300048911 Bacteria 5321
453 Ga0496108_0298732 3300048911 Bacteria 1402
454 Ga0496109_0010381 3300048912 Bacteria 7953
455 Ga0496109_0024236 3300048912 Bacteria 5392
456 Ga0496109_0092275 3300048912 Bacteria 2801
457 Ga0496109_0208970 3300048912 Bacteria 1835
458 Ga0496109_0246385 3300048912 Unclassified 1682
459 Ga0496109_0843661 3300048912 Unclassified 854
460 Ga0496109_1644629 3300048912 Bacteria 576
461 Ga0496110_0084586 3300048913 Bacteria 2831
462 Ga0496110_0421497 3300048913 Bacteria 1217
463 Ga0496110_0503185 3300048913 Bacteria 1103
464 Ga0496111_0030646 3300048914 Bacteria 3825
465 Ga0496111_0208397 3300048914 Bacteria 1452
466 Ga0496111_0276679 3300048914 Bacteria 1245
467 Ga0496111_1185198 3300048914 Unclassified 542
468 Ga0496112_0120326 3300048915 Bacteria 2595
469 Ga0496112_0209835 3300048915 Bacteria 1905
470 Ga0496112_0479528 3300048915 Bacteria 1180
471 Ga0496113_0011588 3300048916 Bacteria 5891
472 Ga0496113_0287735 3300048916 Bacteria 1314
473 Ga0496114_0070963 3300048917 Bacteria 2926
474 Ga0496114_0204495 3300048917 Bacteria 1730
475 Ga0496114_0294494 3300048917 Bacteria 1432
476 Ga0496114_0986335 3300048917 Bacteria 725
477 Ga0496115_0006470 3300048918 Bacteria 8587
478 Ga0496115_0011993 3300048918 Bacteria 6513
479 Ga0496115_0045976 3300048918 Bacteria 3486
480 Ga0496115_0188280 3300048918 Bacteria 1705
481 Ga0496115_0320286 3300048918 Bacteria 1268
482 Ga0501069_0556954 3300049585 Bacteria 686
483 nmdc:mga0n895_7957_c1 3300050512 Bacteria 9142
484 nmdc:mga0rr50_77106_c1 3300050513 Bacteria 2560
485 nmdc:mga0a205_64211_c1 3300050515 Bacteria 3546
486 Ga0495601_0001546 3300053077 Bacteria 12721
487 Ga0495601_0046616 3300053077 Bacteria 2728
488 Ga0495601_0050412 3300053077 Bacteria 2625
489 Ga0495601_0492154 3300053077 Bacteria 792
490 Ga0495601_0753608 3300053077 Bacteria 619
491 Ga0495612_0011115 3300053078 Bacteria 3632
492 Ga0495612_0083774 3300053078 Bacteria 1342
493 Ga0495655_0053812 3300053083 Bacteria 1075
494 Ga0495595_0009464 3300053084 Bacteria 4032
495 Ga0495595_0011661 3300053084 Bacteria 3678
496 Ga0495595_0611037 3300053084 Bacteria 558
497 Ga0495619_0032404 3300053085 Bacteria 3391
498 Ga0495619_0038884 3300053085 Bacteria 3104
499 Ga0495619_0078171 3300053085 Bacteria 2224
500 Ga0495619_0134749 3300053085 Bacteria 1698
501 Ga0495619_0338967 3300053085 Bacteria 1040
502 Ga0495619_0473583 3300053085 Bacteria 862
503 Ga0500566_0062337 3300053094 Bacteria 2108
504 Ga0500566_0394019 3300053094 Unclassified 622
505 Ga0500657_211440 3300053728 Bacteria 629
506 Ga0587082_150813 3300059504 Unclassified 549
507 Ga0587083_0120605 3300059505 Bacteria 677
508 Ga0587113_019659 3300059625 Bacteria 701
509 Ga0587114_016614 3300059655 Bacteria 988
510 Ga0587114_020164 3300059655 Bacteria 932
511 Ga0587114_021572 3300059655 Bacteria 914
512 Ga0587114_026792 3300059655 Bacteria 855
513 Ga0587114_096740 3300059655 Bacteria 570
514 Ga0466962_0045858 3300061719 Bacteria 2089
515 Ga0466962_0053369 3300061719 Bacteria 1932
516 Ga0466962_0077746 3300061719 Bacteria 1586
517 Ga0466963_0003614
518 Ga0070683_100039696
519 Ga0070683_100298086
520 Ga0070680_100882221
521 Ga0070680_101413262
522 Ga0070682_100449274
523 Ga0070682_100556406
524 Ga0070682_100775255
525 Ga0068868_100624786
526 Ga0068868_101664276
527 Ga0070660_100159793
528 Ga0070660_101209567
529 Ga0070691_10055053
530 Ga0070661_101133343
531 Ga0070659_100009486
532 Ga0070659_101300990
533 Ga0070709_10167002
534 Ga0070709_11098872
535 Ga0070714_100011686
536 Ga0070714_100042846
537 Ga0070714_100049219
538 Ga0070714_100111526
539 Ga0070714_100336630
540 Ga0070713_100042261
541 Ga0070713_100071565
542 Ga0070713_100201101
543 Ga0070710_10010246
544 Ga0070710_10049093
545 Ga0070710_10356413
546 Ga0070711_100006378
547 Ga0070711_100008987
548 Ga0070705_100061590
549 Ga0070705_100246949
550 Ga0070694_100358350
551 Ga0070678_100841065
552 Ga0070681_10039456
553 Ga0070681_10827116
554 Ga0070706_100400804
555 Ga0070707_100585019
556 Ga0070699_100485323
557 Ga0070679_100071559
558 Ga0070679_100117606
559 Ga0070679_100347367
560 Ga0070684_100096880
561 Ga0070684_100263586
562 Ga0070686_100419751
563 Ga0070695_100000023
564 Ga0070696_100548570
565 Ga0068855_100269270
566 Ga0068856_100058295
567 Ga0068856_100389265
568 Ga0068856_100389370
569 Ga0068856_102351312
570 Ga0068858_100515002
571 Ga0070717_10014102
572 Ga0070717_10025379
573 Ga0070717_10061249
574 Ga0070717_10113640
575 Ga0070715_10000231
576 Ga0070715_10544741
577 Ga0070716_100002634
578 Ga0070716_100271557
579 Ga0070716_100863334
580 Ga0070712_100141056
581 Ga0070712_100930126
582 Ga0070712_101789734
583 Ga0068871_101024312
584 Ga0075433_10221619
585 Ga0075434_100000658
586 Ga0075436_101416356
587 Ga0105240_10006035
588 Ga0105240_10140992
589 Ga0105245_10109515
590 Ga0105245_11126793
591 Ga0105247_10260622
592 Ga0105241_10262998
593 Ga0105241_12194029
594 Ga0105242_10637560
595 Ga0105248_10425246
596 Ga0105248_11148673
597 Ga0105237_10078267
598 Ga0105237_11023203
599 Ga0105237_11541647
600 Ga0105238_11098964
601 Ga0105239_10360037
602 Ga0105246_10108146
603 Ga0157371_11096198
604 Ga0157370_10127463
605 Ga0157369_10205878
606 Ga0157369_10408158
607 Ga0157374_10113986
608 Ga0157374_11688808
609 Ga0157378_12548800
610 Ga0163162_10524967
611 Ga0157372_10085803
612 Ga0157372_10394561
613 Ga0157372_10847809
614 Ga0182008_10056520
615 Ga0182008_10483149
616 Ga0157377_10246568
617 Ga0157379_10286647
618 Ga0157379_11225877
619 Ga0157376_10274135
620 Ga0157376_11440991
621 Ga0206356_11802331
622 Ga0206349_1004918
623 Ga0206349_1017270
624 Ga0206349_1641620
625 Ga0206349_1861308
626 Ga0206351_10594931
627 Ga0206350_10124179
628 Ga0206350_11654165
629 Ga0206354_10556677
630 Ga0206353_11158783
631 Ga0224712_10021925
632 Ga0224712_10246197
633 Ga0224712_10290080
634 Ga0224712_10296458
635 Ga0207692_10005469
636 Ga0207692_10017136
637 Ga0207710_10112570
638 Ga0207680_10604569
639 Ga0207685_10175392
640 Ga0207685_10415846
641 Ga0207685_10861108
642 Ga0207699_10008513
643 Ga0207699_10117705
644 Ga0207707_10085918
645 Ga0207707_10142763
646 Ga0207695_10052943
647 Ga0207671_10064040
648 Ga0207693_10000198
649 Ga0207693_10001236
650 Ga0207663_10017495
651 Ga0207660_10275639
652 Ga0207657_10018647
653 Ga0207649_10987038
654 Ga0207652_10101502
655 Ga0207687_10204264
656 Ga0207700_10250797
657 Ga0207664_10002217
658 Ga0207664_10035486
659 Ga0207664_10067528
660 Ga0207664_10078382
661 Ga0207664_10166493
662 Ga0207664_10176018
663 Ga0207644_10604088
664 Ga0207690_10034795
665 Ga0207706_10211536
666 Ga0207665_10006250
667 Ga0207665_10878480
668 Ga0207711_10297659
669 Ga0207711_10781851
670 Ga0207689_11547431
671 Ga0207679_10133503
672 Ga0207677_10329711
673 Ga0207677_11723277
674 Ga0207702_10467241
675 Ga0207702_10733030
676 Ga0207676_11821291
677 Ga0373959_0061182
678 Ga0373934_0116483
679 Ga0373940_0042383
680 Ga0373949_0062034
681 Ga0373951_0168515
682 Ga0373923_0385093
683 Ga0373936_0029224
684 Ga0373941_0044254
685 Ga0373945_0042203
686 Ga0373957_0092245
687 Ga0373943_0482684
688 Ga0373962_0110972
689 Ga0373924_0074368
690 Ga0373924_0349904
691 Ga0373924_0538183
692 Ga0373931_0055756
693 Ga0373933_0037296
694 Ga0373933_0497862
695 Ga0373947_0009946
696 Ga0373937_0013935
697 Ga0373937_0893414
698 Ga0395899_0542175
699 Ga0395898_1114047
700 Ga0395898_1685154
701 Ga0395905_0840198
702 Ga0395901_0034600
703 Ga0451789_0654972
704 Ga0466969_0302751
705 Ga0466965_0062396
706 Ga0466966_0023584
707 Ga0466961_0011110
708 Ga0466961_0012105
709 Ga0466961_0018914
710 Ga0466961_0220814
711 Ga0466963_0000263
712 Ga0466963_0003533
713 Ga0466963_0010385
714 Ga0466963_0012514
715 Ga0466963_0021378
716 Ga0466963_0024772
717 Ga0466963_0024928
718 Ga0466963_0042429
719 Ga0466963_0068759
720 Ga0466963_0119799
721 Ga0466963_0196706
722 Ga0466963_0245769
723 Ga0466964_0004321
724 Ga0466964_0012795
725 Ga0466964_0021556
726 Ga0466964_0025202
727 Ga0466964_0053223
728 Ga0466964_0461305
729 Ga0466964_0795200
730 Ga0466971_0021829
731 Ga0466971_0026945
732 Ga0466971_0041107
733 Ga0466971_0057684
734 Ga0466968_0002839
735 Ga0466968_0004035
736 Ga0466968_0022546
737 Ga0466968_0044800
738 Ga0466968_0145237
739 Ga0466970_0174979
740 Ga0466957_0004887
741 Ga0466957_0008787
742 Ga0466957_0027415
743 Ga0466957_0029450
744 Ga0466957_0039677
745 Ga0466957_0051255
746 Ga0466957_0063954
747 Ga0466957_0181656
748 Ga0466957_0269869
749 Ga0466957_0277596
750 Ga0466960_0083961
751 Ga0466960_0654862
752 Ga0466959_0002970
753 Ga0466959_0028599
754 Ga0466958_0005696
755 Ga0466958_0006324
756 Ga0466958_0008951
757 Ga0466958_0016826
758 Ga0466958_0032405
759 Ga0466958_0053558
760 Ga0466958_0236359
761 Ga0466958_0242628
762 Ga0466967_0002824
763 Ga0466967_0003544
764 Ga0466967_0011891
765 Ga0466967_0028702
766 Ga0466967_0030743
767 Ga0466967_0031133
768 Ga0466967_0035496
769 Ga0466967_0053600
770 Ga0466967_0078098
771 Ga0466967_0087734
772 Ga0466967_0110278
773 Ga0466967_0145145
774 Ga0466967_0174507
775 Ga0466967_0212256
776 Ga0466967_0257209
777 Ga0466967_0327154
778 Ga0466967_1260355
779 Ga0495592_0000708
780 Ga0495592_0146450
781 Ga0495592_0163340
782 Ga0495592_0273818
783 Ga0495603_0432428
784 Ga0495603_0586100
785 Ga0495629_0003233
786 Ga0495629_0071276
787 Ga0495629_0119423
788 Ga0495629_0309209
789 Ga0495629_0321559
790 Ga0495641_0005630
791 Ga0495641_0113273
792 Ga0495641_0118980
793 Ga0495651_0000885
794 Ga0495653_0001808
795 Ga0495653_0038945
796 Ga0495653_0118421
797 Ga0495653_0207030
798 Ga0495582_0000711
799 Ga0495582_0254713
800 Ga0495582_0276065
801 Ga0495582_0343324
802 Ga0495582_0521763
803 Ga0495605_0090575
804 Ga0495639_0000520
805 Ga0495639_0068996
806 Ga0495639_0234031
807 Ga0495662_0039026
808 Ga0495662_0102970
809 Ga0495664_0002367
810 Ga0495664_0078543
811 Ga0495664_0093958
812 Ga0495664_0184926
813 Ga0495664_0561899
814 Ga0495584_0142671
815 Ga0495585_0054760
816 Ga0495596_0092930
817 Ga0495607_0100989
818 Ga0495608_0015658
819 Ga0495608_0017691
820 Ga0495608_0152680
821 Ga0495608_0305543
822 Ga0495618_0024029
823 Ga0495618_0058845
824 Ga0495618_0077750
825 Ga0495618_0222094
826 Ga0495628_0001243
827 Ga0495628_0020893
828 Ga0495628_0110894
829 Ga0495628_0359819
830 Ga0495630_0001392
831 Ga0495630_0004401
832 Ga0495630_0036630
833 Ga0495644_0004369
834 Ga0495666_0000272
835 Ga0495642_0138782
836 Ga0495652_0003720
837 Ga0495652_0040958
838 Ga0495652_0067742
839 Ga0495652_0111985
840 Ga0495652_0257095
841 Ga0495665_0100156
842 Ga0495665_0135612
843 Ga0495640_0012871
844 Ga0495640_0197982
845 Ga0495640_0271060
846 Ga0495640_0357586
847 Ga0495586_0088187
848 Ga0495586_0105012
849 Ga0495586_0417537
850 Ga0495586_0560848
851 Ga0495587_0000675
852 Ga0495587_0063092
853 Ga0495645_0000684
854 Ga0495645_0065078
855 Ga0495645_0223493
856 Ga0495667_0042831
857 Ga0495667_0045455
858 Ga0495667_0074564
859 Ga0495667_0446955
860 Ga0495667_0647876
861 Ga0495656_0001261
862 Ga0495634_0041780
863 Ga0495634_0146885
864 Ga0495634_0169101
865 Ga0495634_0391677
866 Ga0495611_0114199
867 Ga0495635_0045501
868 Ga0495635_0484296
869 Ga0495657_0005553
870 Ga0495657_0056557
871 Ga0495657_0435712
872 Ga0495599_0000455
873 Ga0495599_0065564
874 Ga0495599_0122120
875 Ga0495599_0760205
876 Ga0495623_0000578
877 Ga0495623_0144455
878 Ga0495623_0566522
879 Ga0495646_0034360
880 Ga0495646_0166386
881 Ga0495646_0595828
882 Ga0495647_0001653
883 Ga0495647_0005702
884 Ga0495647_0224261
885 Ga0495658_0013818
886 Ga0495658_0091095
887 Ga0495613_0004240
888 Ga0495613_0007635
889 Ga0495613_0132168
890 Ga0495613_0274635
891 Ga0495613_0389803
892 Ga0495613_0534095
893 Ga0495613_1045660
894 Ga0495624_0002049
895 Ga0495624_0017518
896 Ga0495624_0120788
897 Ga0495624_0538588
898 Ga0495670_0212743
899 Ga0495589_0061720
900 Ga0495600_0006544
901 Ga0495600_0039508
902 Ga0495600_0104470
903 Ga0495660_0133347
904 Ga0495581_0002214
905 Ga0495581_0039745
906 Ga0495581_0455872
907 Ga0495604_0001028
908 Ga0495604_0190425
909 Ga0495604_0232398
910 Ga0495604_0415645
911 Ga0495604_0455020
912 Ga0495604_0476374
913 Ga0495636_0059441
914 Ga0495674_0014416
915 Ga0495674_0071159
916 Ga0495674_0139843
917 Ga0495674_0169685
918 Ga0495674_0612885
919 Ga0495674_0647537
920 Ga0495674_1312113
921 Ga0495676_0018323
922 Ga0495676_0171352
923 Ga0495676_0537745
924 Ga0495680_0006575
925 Ga0495680_0043586
926 Ga0495680_0082531
927 Ga0495680_0109600
928 Ga0495680_0763159
929 Ga0495683_0328244
930 Ga0495675_0000592
931 Ga0495675_0030138
932 Ga0495675_0103180
933 Ga0495675_0258740
934 Ga0495684_0044269
935 Ga0495684_0203998
936 Ga0495593_0061960
937 Ga0495602_0001484
938 Ga0495602_0031585
939 Ga0495602_0122603
940 Ga0495602_0188192
941 Ga0495614_0000132
942 Ga0496100_0342733
943 Ga0496101_0004136
944 Ga0496101_0178663
945 Ga0496101_0245753
946 Ga0496102_0061864
947 Ga0496102_0063022
948 Ga0496102_0161738
949 Ga0496103_0005199
950 Ga0496103_0029005
951 Ga0496104_0140649
952 Ga0496104_0252456
953 Ga0496104_0408784
954 Ga0496104_0564196
955 Ga0496105_0000926
956 Ga0496105_0009437
957 Ga0496105_0103590
958 Ga0496105_0752213
959 Ga0496106_0009895
960 Ga0496106_0228795
961 Ga0496106_0792532
962 Ga0496106_0891598
963 Ga0496107_0010895
964 Ga0496107_0083617
965 Ga0496107_0448676
966 Ga0496107_0599671
967 Ga0496108_0007571
968 Ga0496108_0021350
969 Ga0496108_0298732
970 Ga0496109_0010381
971 Ga0496109_0024236
972 Ga0496109_0092275
973 Ga0496109_0208970
974 Ga0496109_0246385
975 Ga0496109_0843661
976 Ga0496109_1644629
977 Ga0496110_0084586
978 Ga0496110_0421497
979 Ga0496110_0503185
980 Ga0496111_0030646
981 Ga0496111_0208397
982 Ga0496111_0276679
983 Ga0496111_1185198
984 Ga0496112_0120326
985 Ga0496112_0209835
986 Ga0496112_0479528
987 Ga0496113_0011588
988 Ga0496113_0287735
989 Ga0496114_0070963
990 Ga0496114_0204495
991 Ga0496114_0294494
992 Ga0496114_0986335
993 Ga0496115_0006470
994 Ga0496115_0011993
995 Ga0496115_0045976
996 Ga0496115_0188280
997 Ga0496115_0320286
998 Ga0501069_0556954
999 nmdc:mga0n895_7957_c1
1000 nmdc:mga0rr50_77106_c1
1001 nmdc:mga0a205_64211_c1
1002 Ga0495601_0001546
1003 Ga0495601_0046616
1004 Ga0495601_0050412
1005 Ga0495601_0492154
1006 Ga0495601_0753608
1007 Ga0495612_0011115
1008 Ga0495612_0083774
1009 Ga0495655_0053812
1010 Ga0495595_0009464
1011 Ga0495595_0011661
1012 Ga0495595_0611037
1013 Ga0495619_0032404
1014 Ga0495619_0038884
1015 Ga0495619_0078171
1016 Ga0495619_0134749
1017 Ga0495619_0338967
1018 Ga0495619_0473583
1019 Ga0500566_0062337
1020 Ga0500566_0394019
1021 Ga0500657_211440
1022 Ga0587082_150813
1023 Ga0587083_0120605
1024 Ga0587113_019659
1025 Ga0587114_016614
1026 Ga0587114_020164
1027 Ga0587114_021572
1028 Ga0587114_026792
1029 Ga0587114_096740
1030 Ga0466962_0045858
1031 Ga0466962_0053369
1032 Ga0466962_0077746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8opn-assembly1.cif.gz_B human coronavirus hku1 spike glycoprotein in complex with an alpha2,8-linked 9-o-acetylated disialoside (1-up state) 0.8476 56 74
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8281 4 120
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8136 4 120
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8099 4 120
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8026 4 120
ID Description Score Start End Superfamily
af_Q5A1Q0_1_294_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8242 57 73 2.70.98.10
af_P9WLZ7_398_539_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7852 1 121 3.30.565.10
af_F1Q8K1_519_671_2.60.34.10 Mainly Beta;Sandwich;Substrate Binding Domain Of DNAk; Chain A, domain 1;Substrate Binding Domain Of DNAk; Chain A, domain 1 0.7805 57 73 2.60.34.10
af_P71568_133_255_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7611 4 119 3.30.565.10
af_Q55EJ0_121_346_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.761 57 120 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A7V9CBG8-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.888 3 123
AF-A0A838PTD5-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.8771 2 120
AF-A0A7X7IA09-F1-model_v4 Uncharacterized protein 0.8755 3 121
AF-A0A7V9EEV7-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.8743 1 120
AF-A0A7V9BBG5-F1-model_v4 Anti-sigma factor 0.8674 1 119

Map