F457978

General Info

Members Datasets Scaffolds Average Seq Length
516 285 1032 127

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10389342|Ga0068851_103893422
Length 144
Sequence MARSGAIQPERGASEGRPVIAADTSTWVAFLQGDDGADVELLDLALRDQQVVMPPVVLTELLSDPKLLPDVAKTLCEVPLIETDAGYWQRAGQLRGRVLASRRKARLGDALIAQSCVDRGIPLVTRDRDFKAFAAAADLDMLAS

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 1.55
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 38.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10389342 3300005834 Bacteria 818
2 Ga0065707_10123493 3300005295 Bacteria 2064
3 Ga0070658_10494522 3300005327 Bacteria 1056
4 Ga0070676_10146068 3300005328 Bacteria 1510
5 Ga0070683_101406603 3300005329 Bacteria 670
6 Ga0070690_100007181 3300005330 Bacteria 6371
7 Ga0070690_100228595 3300005330 Unclassified 1307
8 Ga0070690_100916369 3300005330 Unclassified 686
9 Ga0070677_10403714 3300005333 Unclassified 721
10 Ga0068869_100762651 3300005334 Bacteria 829
11 Ga0070680_100327840 3300005336 Unclassified 1300
12 Ga0070680_100333098 3300005336 Bacteria 1289
13 Ga0070680_100969204 3300005336 Unclassified 734
14 Ga0068868_100886858 3300005338 Unclassified 810
15 Ga0070689_100192357 3300005340 Bacteria 1662
16 Ga0070687_100062666 3300005343 Bacteria 1969
17 Ga0070687_100755784 3300005343 Unclassified 684
18 Ga0070661_100269823 3300005344 Bacteria 1317
19 Ga0070692_10354704 3300005345 Unclassified 912
20 Ga0070669_100135657 3300005353 Unclassified 1893
21 Ga0070669_100400472 3300005353 Bacteria 1123
22 Ga0070675_100605846 3300005354 Bacteria 993
23 Ga0070675_100609140 3300005354 Bacteria 991
24 Ga0070671_100085446 3300005355 Bacteria 2639
25 Ga0070674_100207027 3300005356 Bacteria 1518
26 Ga0070674_100250043 3300005356 Bacteria 1392
27 Ga0070674_100283010 3300005356 Bacteria 1315
28 Ga0070673_100001470 3300005364 Bacteria 13793
29 Ga0070688_100094540 3300005365 Bacteria 1960
30 Ga0070688_100103047 3300005365 Unclassified 1885
31 Ga0070688_100331697 3300005365 Bacteria 1108
32 Ga0070659_100753075 3300005366 Unclassified 845
33 Ga0070667_100260146 3300005367 Bacteria 1554
34 Ga0070667_100779950 3300005367 Unclassified 887
35 Ga0070667_101209242 3300005367 Unclassified 707
36 Ga0070713_100029432 3300005436 Bacteria 4350
37 Ga0070713_100131073 3300005436 Unclassified 2211
38 Ga0070713_100220296 3300005436 Unclassified 1721
39 Ga0070713_100608532 3300005436 Unclassified 1038
40 Ga0070710_10131624 3300005437 Unclassified 1526
41 Ga0070701_10074443 3300005438 Bacteria 1824
42 Ga0070711_100001047 3300005439 Bacteria 14751
43 Ga0070711_100067159 3300005439 Unclassified 2515
44 Ga0070705_100039757 3300005440 Bacteria 2671
45 Ga0070705_100379456 3300005440 Unclassified 1040
46 Ga0070700_100126184 3300005441 Bacteria 1721
47 Ga0070694_100192064 3300005444 Bacteria 1517
48 Ga0070708_100012735 3300005445 Bacteria 6869
49 Ga0070708_100026625 3300005445 Bacteria 4952
50 Ga0070708_100080277 3300005445 Bacteria 2952
51 Ga0070708_100104699 3300005445 Bacteria 2595
52 Ga0070663_100604594 3300005455 Bacteria 923
53 Ga0070678_101589204 3300005456 Bacteria 614
54 Ga0070662_100099700 3300005457 Bacteria 2196
55 Ga0068867_100006619 3300005459 Bacteria 8190
56 Ga0070685_10040690 3300005466 Unclassified 2646
57 Ga0070685_11187849 3300005466 Unclassified 579
58 Ga0070706_100012461 3300005467 Bacteria 7876
59 Ga0070706_100110142 3300005467 Bacteria 2562
60 Ga0070706_100201762 3300005467 Bacteria 1858
61 Ga0070706_101291805 3300005467 Unclassified 669
62 Ga0070707_100011723 3300005468 Bacteria 8181
63 Ga0070707_100269637 3300005468 Bacteria 1655
64 Ga0070707_100937679 3300005468 Unclassified 830
65 Ga0070707_101431981 3300005468 Unclassified 658
66 Ga0070699_100218280 3300005518 Bacteria 1699
67 Ga0070699_100963496 3300005518 Unclassified 782
68 Ga0070699_101250652 3300005518 Unclassified 681
69 Ga0070684_100341468 3300005535 Bacteria 1377
70 Ga0070697_100002376 3300005536 Bacteria 14483
71 Ga0070697_100309326 3300005536 Bacteria 1359
72 Ga0070697_100425781 3300005536 Unclassified 1154
73 Ga0068853_101309232 3300005539 Unclassified 700
74 Ga0068853_101919897 3300005539 Unclassified 574
75 Ga0070672_100005378 3300005543 Bacteria 8483
76 Ga0070672_100205847 3300005543 Bacteria 1647
77 Ga0070672_100255846 3300005543 Bacteria 1476
78 Ga0070686_100031377 3300005544 Bacteria 3248
79 Ga0070695_100174439 3300005545 Bacteria 1519
80 Ga0070696_100297722 3300005546 Unclassified 1234
81 Ga0070665_100085352 3300005548 Bacteria 3162
82 Ga0070665_100135484 3300005548 Bacteria 2464
83 Ga0070704_100013457 3300005549 Bacteria 5079
84 Ga0070704_100620687 3300005549 Bacteria 952
85 Ga0070704_101042521 3300005549 Unclassified 741
86 Ga0068855_100133157 3300005563 Bacteria 2837
87 Ga0068855_101160515 3300005563 Unclassified 805
88 Ga0070664_100091178 3300005564 Bacteria 2638
89 Ga0068857_100408005 3300005577 Unclassified 1265
90 Ga0068854_100330832 3300005578 Bacteria 1241
91 Ga0068856_102481859 3300005614 Unclassified 525
92 Ga0070702_100183309 3300005615 Bacteria 1372
93 Ga0068852_101956221 3300005616 Unclassified 608
94 Ga0068859_100042337 3300005617 Bacteria 4574
95 Ga0068859_100345472 3300005617 Bacteria 1582
96 Ga0068859_100623356 3300005617 Bacteria 1171
97 Ga0068859_101843761 3300005617 Bacteria 668
98 Ga0068864_100108490 3300005618 Bacteria 2471
99 Ga0068864_100637188 3300005618 Unclassified 1037
100 Ga0068864_101709261 3300005618 Unclassified 634
101 Ga0068866_10036167 3300005718 Bacteria 2417
102 Ga0068866_10384128 3300005718 Unclassified 901
103 Ga0068866_10423654 3300005718 Bacteria 864
104 Ga0068861_100484793 3300005719 Bacteria 1115
105 Ga0068851_10406042 3300005834 Bacteria 802
106 Ga0068870_10346060 3300005840 Bacteria 952
107 Ga0068863_100062240 3300005841 Bacteria 3529
108 Ga0068863_100073445 3300005841 Bacteria 3236
109 Ga0068863_100344252 3300005841 Bacteria 1451
110 Ga0068858_100180937 3300005842 Bacteria 1991
111 Ga0068858_100298349 3300005842 Bacteria 1537
112 Ga0068858_100481530 3300005842 Unclassified 1198
113 Ga0068860_100023921 3300005843 Bacteria 5904
114 Ga0068860_100085333 3300005843 Bacteria 3004
115 Ga0068862_100320046 3300005844 Unclassified 1431
116 Ga0068862_102230914 3300005844 Unclassified 559
117 Ga0070717_10018173 3300006028 Bacteria 5487
118 Ga0070717_10062619 3300006028 Bacteria 3085
119 Ga0070717_10115112 3300006028 Bacteria 2298
120 Ga0070717_10316527 3300006028 Bacteria 1390
121 Ga0070717_10457319 3300006028 Unclassified 1151
122 Ga0075365_10028572 3300006038 Bacteria 3558
123 Ga0075364_10052008 3300006051 Bacteria 2676
124 Ga0070716_100001017 3300006173 Bacteria 12283
125 Ga0070716_100121493 3300006173 Unclassified 1636
126 Ga0070716_100532712 3300006173 Unclassified 872
127 Ga0070716_101605030 3300006173 Unclassified 534
128 Ga0070712_100034755 3300006175 Unclassified 3417
129 Ga0075367_10290564 3300006178 Unclassified 1028
130 Ga0097621_100487277 3300006237 Unclassified 1115
131 Ga0068871_100052996 3300006358 Bacteria 3287
132 Ga0075431_100117060 3300006847 Bacteria 2750
133 Ga0075434_100163377 3300006871 Unclassified 2247
134 Ga0075434_100586253 3300006871 Bacteria 1134
135 Ga0068865_100149246 3300006881 Bacteria 1772
136 Ga0068865_100198552 3300006881 Unclassified 1556
137 Ga0075436_100012908 3300006914 Bacteria 5729
138 Ga0097620_100042340 3300006931 Bacteria 4574
139 Ga0097620_100345466 3300006931 Bacteria 1582
140 Ga0097620_100623339 3300006931 Bacteria 1171
141 Ga0097620_101844080 3300006931 Bacteria 668
142 Ga0075435_100099822 3300007076 Unclassified 2404
143 Ga0099794_10002138 3300007265 Bacteria 7186
144 Ga0099794_10005558 3300007265 Bacteria 5064
145 Ga0099794_10029807 3300007265 Bacteria 2544
146 Ga0099794_10065096 3300007265 Bacteria 1777
147 Ga0099794_10132453 3300007265 Unclassified 1259
148 Ga0099794_10315451 3300007265 Bacteria 810
149 Ga0099794_10503225 3300007265 Unclassified 638
150 Ga0099795_10009340 3300007788 Unclassified 2841
151 Ga0111539_12029865 3300009094 Unclassified 667
152 Ga0105245_10120790 3300009098 Bacteria 2447
153 Ga0105245_11335448 3300009098 Unclassified 766
154 Ga0105243_10471770 3300009148 Unclassified 1182
155 Ga0105241_10105626 3300009174 Bacteria 2246
156 Ga0105242_11836929 3300009176 Unclassified 645
157 Ga0105248_10069424 3300009177 Unclassified 3956
158 Ga0105248_10078026 3300009177 Bacteria 3724
159 Ga0105248_10144896 3300009177 Bacteria 2680
160 Ga0105248_10212471 3300009177 Unclassified 2180
161 Ga0105248_10249429 3300009177 Bacteria 1998
162 Ga0105248_10388113 3300009177 Bacteria 1572
163 Ga0105248_10724085 3300009177 Unclassified 1123
164 Ga0105237_10493096 3300009545 Bacteria 1231
165 Ga0105237_12630046 3300009545 Unclassified 514
166 Ga0105238_10358839 3300009551 Bacteria 1447
167 Ga0105238_10376224 3300009551 Bacteria 1411
168 Ga0105238_12240747 3300009551 Unclassified 581
169 Ga0105249_10424762 3300009553 Unclassified 1364
170 Ga0099796_10377551 3300010159 Unclassified 617
171 Ga0105246_10167352 3300011119 Bacteria 1680
172 Ga0157373_10595021 3300013100 Unclassified 805
173 Ga0157371_10222764 3300013102 Unclassified 1355
174 Ga0157370_10312167 3300013104 Bacteria 1451
175 Ga0157369_10027735 3300013105 Bacteria 6273
176 Ga0157369_10595677 3300013105 Bacteria 1141
177 Ga0157369_11144713 3300013105 Unclassified 795
178 Ga0157374_10150404 3300013296 Bacteria 2263
179 Ga0157378_10552075 3300013297 Bacteria 1157
180 Ga0157378_11919062 3300013297 Unclassified 641
181 Ga0163162_11019623 3300013306 Bacteria 936
182 Ga0157372_10059962 3300013307 Bacteria 4257
183 Ga0157372_10410795 3300013307 Bacteria 1577
184 Ga0157372_10507566 3300013307 Bacteria 1406
185 Ga0157375_10062315 3300013308 Bacteria 3705
186 Ga0157375_10751485 3300013308 Bacteria 1126
187 Ga0157375_12082586 3300013308 Unclassified 675
188 Ga0163163_10205265 3300014325 Bacteria 2019
189 Ga0163163_11146778 3300014325 Unclassified 840
190 Ga0157380_10215428 3300014326 Bacteria 1714
191 Ga0157380_10286641 3300014326 Bacteria 1510
192 Ga0157380_10334184 3300014326 Bacteria 1410
193 Ga0157380_13055388 3300014326 Unclassified 533
194 Ga0157376_10186668 3300014969 Unclassified 1899
195 Ga0157376_11009464 3300014969 Bacteria 855
196 Ga0157376_11892031 3300014969 Unclassified 633
197 Ga0163161_10622233 3300017792 Bacteria 892
198 Ga0213874_10009338 3300021377 Bacteria 2422
199 Ga0213874_10124571 3300021377 Unclassified 879
200 Ga0213876_10193595 3300021384 Unclassified 1081
201 Ga0213875_10003282 3300021388 Bacteria 9264
202 Ga0213875_10071973 3300021388 Bacteria 1614
203 Ga0224712_10412975 3300022467 Unclassified 644
204 Ga0224572_1003011 3300024225 Bacteria 2796
205 Ga0207697_10031878 3300025315 Bacteria 2156
206 Ga0207682_10067266 3300025893 Bacteria 1511
207 Ga0207692_10392999 3300025898 Unclassified 863
208 Ga0207642_10282982 3300025899 Bacteria 955
209 Ga0207699_10078241 3300025906 Unclassified 2042
210 Ga0207699_10235954 3300025906 Unclassified 1254
211 Ga0207645_10162731 3300025907 Bacteria 1460
212 Ga0207643_10285688 3300025908 Bacteria 1024
213 Ga0207705_10671056 3300025909 Unclassified 806
214 Ga0207684_10029191 3300025910 Bacteria 4698
215 Ga0207684_10043771 3300025910 Bacteria 3796
216 Ga0207684_10175009 3300025910 Unclassified 1850
217 Ga0207684_10336220 3300025910 Unclassified 1301
218 Ga0207707_10807438 3300025912 Bacteria 781
219 Ga0207693_10018691 3300025915 Bacteria 5517
220 Ga0207693_10081705 3300025915 Bacteria 2530
221 Ga0207693_10743350 3300025915 Unclassified 758
222 Ga0207663_10034735 3300025916 Bacteria 3019
223 Ga0207663_10122146 3300025916 Unclassified 1785
224 Ga0207660_10736335 3300025917 Unclassified 804
225 Ga0207662_10005334 3300025918 Bacteria 6842
226 Ga0207649_10270603 3300025920 Bacteria 1231
227 Ga0207649_10815771 3300025920 Unclassified 729
228 Ga0207652_10877137 3300025921 Bacteria 794
229 Ga0207646_10009626 3300025922 Bacteria 9533
230 Ga0207646_10014375 3300025922 Bacteria 7521
231 Ga0207646_10347698 3300025922 Bacteria 1340
232 Ga0207646_10359350 3300025922 Bacteria 1316
233 Ga0207646_11187845 3300025922 Unclassified 669
234 Ga0207681_10281131 3300025923 Unclassified 1310
235 Ga0207681_11639654 3300025923 Bacteria 538
236 Ga0207694_10683039 3300025924 Bacteria 866
237 Ga0207694_10853870 3300025924 Bacteria 769
238 Ga0207650_10456262 3300025925 Bacteria 1064
239 Ga0207650_10639847 3300025925 Unclassified 896
240 Ga0207659_10133007 3300025926 Bacteria 1922
241 Ga0207659_10804088 3300025926 Unclassified 808
242 Ga0207687_10228010 3300025927 Bacteria 1470
243 Ga0207700_10002191 3300025928 Bacteria 11203
244 Ga0207700_10084870 3300025928 Unclassified 2484
245 Ga0207700_11023078 3300025928 Unclassified 739
246 Ga0207664_10001736 3300025929 Bacteria 14339
247 Ga0207644_10008511 3300025931 Bacteria 6712
248 Ga0207644_10250049 3300025931 Bacteria 1414
249 Ga0207706_10360980 3300025933 Bacteria 1262
250 Ga0207686_10145491 3300025934 Bacteria 1643
251 Ga0207709_11723735 3300025935 Unclassified 521
252 Ga0207670_10554647 3300025936 Bacteria 939
253 Ga0207670_11758320 3300025936 Unclassified 527
254 Ga0207669_10026458 3300025937 Bacteria 3156
255 Ga0207669_10282206 3300025937 Bacteria 1253
256 Ga0207704_10022101 3300025938 Bacteria 3401
257 Ga0207665_10002541 3300025939 Bacteria 12272
258 Ga0207665_10036892 3300025939 Bacteria 3252
259 Ga0207665_10279408 3300025939 Bacteria 1242
260 Ga0207691_10010512 3300025940 Bacteria 8880
261 Ga0207691_10017724 3300025940 Bacteria 6750
262 Ga0207691_10082900 3300025940 Bacteria 2879
263 Ga0207711_10012331 3300025941 Bacteria 7105
264 Ga0207711_10225951 3300025941 Bacteria 1714
265 Ga0207711_10313040 3300025941 Bacteria 1449
266 Ga0207711_10679493 3300025941 Unclassified 960
267 Ga0207661_10184770 3300025944 Bacteria 1824
268 Ga0207679_10192995 3300025945 Bacteria 1695
269 Ga0207667_10261836 3300025949 Bacteria 1768
270 Ga0207667_11007821 3300025949 Unclassified 820
271 Ga0207651_10001610 3300025960 Bacteria 10342
272 Ga0207651_10054550 3300025960 Bacteria 2740
273 Ga0207712_10219303 3300025961 Bacteria 1520
274 Ga0207658_10710350 3300025986 Bacteria 909
275 Ga0207677_10338259 3300026023 Bacteria 1257
276 Ga0207703_10023111 3300026035 Unclassified 4883
277 Ga0207703_10069841 3300026035 Bacteria 2898
278 Ga0207639_10515471 3300026041 Bacteria 1094
279 Ga0207678_10681538 3300026067 Bacteria 904
280 Ga0207678_10713629 3300026067 Unclassified 883
281 Ga0207708_10699332 3300026075 Unclassified 866
282 Ga0207641_10015511 3300026088 Bacteria 6243
283 Ga0207641_10035095 3300026088 Bacteria 4177
284 Ga0207641_10448070 3300026088 Bacteria 1247
285 Ga0207641_11025507 3300026088 Unclassified 822
286 Ga0207648_10006172 3300026089 Bacteria 11938
287 Ga0207648_11762483 3300026089 Unclassified 581
288 Ga0207676_10251180 3300026095 Bacteria 1592
289 Ga0207674_10358137 3300026116 Unclassified 1410
290 Ga0207675_100016040 3300026118 Bacteria 6994
291 Ga0207675_102236476 3300026118 Unclassified 561
292 Ga0207683_10373967 3300026121 Bacteria 1309
293 Ga0207683_11403275 3300026121 Unclassified 646
294 Ga0209588_1000821 3300027671 Bacteria 7889
295 Ga0209588_1001532 3300027671 Bacteria 6091
296 Ga0209588_1044702 3300027671 Unclassified 1432
297 Ga0209588_1063737 3300027671 Bacteria 1191
298 Ga0209588_1072962 3300027671 Bacteria 1109
299 Ga0209588_1112945 3300027671 Unclassified 872
300 Ga0209588_1135429 3300027671 Unclassified 785
301 Ga0209998_10155300 3300027717 Unclassified 589
302 Ga0268266_10030332 3300028379 Bacteria 4594
303 Ga0268264_10057960 3300028381 Bacteria 3241
304 Ga0268264_10790942 3300028381 Unclassified 947
305 Ga0265338_10038502 3300028800 Bacteria 4529
306 Ga0265338_10051466 3300028800 Unclassified 3707
307 Ga0265762_1050102 3300030760 Bacteria 836
308 Ga0265762_1056302 3300030760 Unclassified 799
309 Ga0265760_10053091 3300031090 Bacteria 1222
310 Ga0265760_10153571 3300031090 Unclassified 756
311 Ga0265760_10190427 3300031090 Unclassified 689
312 Ga0265760_10270371 3300031090 Unclassified 594
313 Ga0265330_10075169 3300031235 Bacteria 1459
314 Ga0265330_10130986 3300031235 Bacteria 1067
315 Ga0265332_10011313 3300031238 Bacteria 3968
316 Ga0265328_10140150 3300031239 Bacteria 907
317 Ga0265328_10386223 3300031239 Bacteria 548
318 Ga0265325_10005869 3300031241 Bacteria 7524
319 Ga0265325_10044574 3300031241 Bacteria 2309
320 Ga0265325_10123612 3300031241 Unclassified 1245
321 Ga0265340_10010235 3300031247 Bacteria 5020
322 Ga0265340_10021774 3300031247 Bacteria 3284
323 Ga0265340_10430010 3300031247 Unclassified 582
324 Ga0265339_10013522 3300031249 Bacteria 4942
325 Ga0265339_10014281 3300031249 Bacteria 4789
326 Ga0265339_10075737 3300031249 Bacteria 1786
327 Ga0265331_10173260 3300031250 Unclassified 976
328 Ga0265327_10029065 3300031251 Bacteria 3149
329 Ga0265316_10006350 3300031344 Bacteria 11304
330 Ga0265316_10017405 3300031344 Bacteria 6214
331 Ga0265316_10123693 3300031344 Bacteria 1952
332 Ga0265316_10171685 3300031344 Unclassified 1617
333 Ga0265316_10207736 3300031344 Bacteria 1449
334 Ga0265316_10400523 3300031344 Bacteria 988
335 Ga0265316_10451937 3300031344 Unclassified 921
336 Ga0265316_10508963 3300031344 Bacteria 859
337 Ga0307408_101107039 3300031548 Bacteria 735
338 Ga0265313_10032813 3300031595 Bacteria 2645
339 Ga0265313_10245593 3300031595 Unclassified 731
340 Ga0265314_10018114 3300031711 Bacteria 5503
341 Ga0265314_10039128 3300031711 Bacteria 3419
342 Ga0265314_10063533 3300031711 Bacteria 2504
343 Ga0265342_10248156 3300031712 Bacteria 951
344 Ga0316583_10158265 3300032133 Unclassified 789
345 Ga0316214_1018129 3300033545 Unclassified 979
346 Ga0373926_0007987 3300035083 Unclassified 3526
347 Ga0373926_0008267 3300035083 Bacteria 3464
348 Ga0373951_0024328 3300035091 Bacteria 1402
349 Ga0373923_0047012 3300035111 Unclassified 1797
350 Ga0373953_0491009 3300035117 Unclassified 544
351 Ga0373954_0017285 3300035118 Unclassified 3238
352 Ga0373954_0025928 3300035118 Bacteria 2684
353 Ga0373943_0172783 3300035170 Bacteria 1183
354 Ga0373943_0775934 3300035170 Unclassified 570
355 Ga0373946_0040202 3300035171 Bacteria 1912
356 Ga0373961_0024064 3300035241 Bacteria 1644
357 Ga0373962_0028306 3300035242 Bacteria 1519
358 Ga0373931_0100622 3300035691 Bacteria 1625
359 Ga0373935_0012251 3300035692 Bacteria 5157
360 Ga0373935_0173845 3300035692 Bacteria 1475
361 Ga0373927_0000114 3300035695 Bacteria 60543
362 Ga0373927_0004472 3300035695 Bacteria 9781
363 Ga0373927_0063644 3300035695 Bacteria 2386
364 Ga0373933_0362892 3300035724 Unclassified 942
365 Ga0373933_0426818 3300035724 Unclassified 866
366 Ga0373947_0003752 3300035725 Bacteria 8966
367 Ga0373947_0009887 3300035725 Bacteria 5478
368 Ga0373947_0722770 3300035725 Bacteria 679
369 Ga0373937_0026065 3300036401 Unclassified 5282
370 Ga0373937_0138548 3300036401 Bacteria 2276
371 Ga0373937_0147084 3300036401 Bacteria 2206
372 Ga0373937_0282714 3300036401 Bacteria 1567
373 Ga0373937_0351100 3300036401 Bacteria 1397
374 Ga0373937_0891481 3300036401 Unclassified 838
375 Ga0373937_1175299 3300036401 Unclassified 716
376 Ga0265778_053905 3300036457 Unclassified 554
377 Ga0373925_0000115 3300037068 Bacteria 85776
378 Ga0373925_0127826 3300037068 Unclassified 1979
379 Ga0436364_0047706 3300037853 Bacteria 8297
380 Ga0436364_0491526 3300037853 Bacteria 1848
381 Ga0436364_0917857 3300037853 Bacteria 3300
382 Ga0436365_1091989 3300039437 Unclassified 1081
383 Ga0436360_0859571 3300039438 Unclassified 828
384 Ga0436361_0307100 3300039447 Bacteria 2363
385 Ga0436363_0377849 3300039450 Unclassified 972
386 Ga0436363_1080467 3300039450 Bacteria 4189
387 Ga0436363_1638793 3300039450 Unclassified 932
388 Ga0436362_1235603 3300039453 Bacteria 1197
389 Ga0451793_1459842 3300041452 Bacteria 1150
390 Ga0451807_1921236 3300041486 Bacteria 1055
391 Ga0439433_0070461 3300041999 Unclassified 842
392 Ga0439433_0161604 3300041999 Unclassified 580
393 Ga0439433_0180407 3300041999 Unclassified 552
394 Ga0453683_0776092 3300044673 Bacteria 630
395 Ga0466966_0056366 3300044684 Bacteria 2486
396 Ga0466961_0297473 3300044693 Bacteria 986
397 Ga0466961_0766694 3300044693 Bacteria 576
398 Ga0453684_0277302 3300044712 Bacteria 1913
399 Ga0453684_0599627 3300044712 Bacteria 1207
400 Ga0466959_0470778 3300045049 Unclassified 851
401 Ga0466958_0382992 3300045836 Bacteria 907
402 Ga0466958_0641145 3300045836 Unclassified 691
403 Ga0495592_0039329 3300046454 Unclassified 3554
404 Ga0495592_0080591 3300046454 Unclassified 2355
405 Ga0495592_0209164 3300046454 Unclassified 1311
406 Ga0495592_0431264 3300046454 Unclassified 829
407 Ga0495651_0006095 3300046462 Bacteria 9205
408 Ga0495653_0008008 3300046463 Bacteria 8654
409 Ga0495580_0020256 3300046472 Unclassified 4927
410 Ga0495580_0474058 3300046472 Bacteria 838
411 Ga0495582_0107503 3300046473 Unclassified 1566
412 Ga0495582_0332352 3300046473 Unclassified 875
413 Ga0495582_0697722 3300046473 Bacteria 587
414 Ga0495664_0056281 3300046477 Unclassified 2339
415 Ga0495664_0381509 3300046477 Unclassified 847
416 Ga0495608_0015999 3300046511 Bacteria 5192
417 Ga0495608_0953887 3300046511 Unclassified 500
418 Ga0495618_0191919 3300046514 Unclassified 1295
419 Ga0495618_0218233 3300046514 Bacteria 1204
420 Ga0495628_0021248 3300046516 Bacteria 5343
421 Ga0495628_0110452 3300046516 Bacteria 2115
422 Ga0495630_0012131 3300046517 Bacteria 6248
423 Ga0495630_0029013 3300046517 Unclassified 4112
424 Ga0495630_0247013 3300046517 Bacteria 1363
425 Ga0495666_0069918 3300046526 Unclassified 1670
426 Ga0495652_0061512 3300046529 Unclassified 3169
427 Ga0495665_0005363 3300046531 Bacteria 6910
428 Ga0495665_0599065 3300046531 Bacteria 551
429 Ga0495640_0015358 3300046533 Bacteria 5765
430 Ga0495640_0133902 3300046533 Unclassified 1602
431 Ga0495640_0164917 3300046533 Unclassified 1418
432 Ga0495586_0233308 3300046535 Bacteria 1047
433 Ga0495587_0040320 3300046536 Bacteria 2792
434 Ga0495645_0050574 3300046543 Unclassified 3026
435 Ga0495645_0573464 3300046543 Unclassified 697
436 Ga0495667_0014013 3300046559 Bacteria 5413
437 Ga0495667_0453805 3300046559 Unclassified 805
438 Ga0495667_0489097 3300046559 Bacteria 771
439 Ga0495634_0321038 3300046642 Bacteria 932
440 Ga0495635_0022861 3300046663 Unclassified 4358
441 Ga0495588_0405084 3300046674 Unclassified 716
442 Ga0495599_0461162 3300046678 Unclassified 751
443 Ga0495599_0697544 3300046678 Unclassified 585
444 Ga0495623_0001794 3300046679 Bacteria 14428
445 Ga0495623_0050365 3300046679 Bacteria 2637
446 Ga0495646_0012553 3300046680 Bacteria 5382
447 Ga0495646_0359917 3300046680 Unclassified 761
448 Ga0495613_0098281 3300046689 Unclassified 2115
449 Ga0495624_0018742 3300046690 Unclassified 4625
450 Ga0495600_0128438 3300046809 Unclassified 1648
451 Ga0495604_0039516 3300047317 Bacteria 3708
452 Ga0495604_0046492 3300047317 Unclassified 3383
453 Ga0495604_0108319 3300047317 Bacteria 2030
454 Ga0495604_0811663 3300047317 Unclassified 589
455 Ga0495674_0032474 3300047319 Bacteria 4734
456 Ga0495674_0035883 3300047319 Unclassified 4469
457 Ga0495674_1215911 3300047319 Unclassified 569
458 Ga0495676_0307340 3300047321 Unclassified 1068
459 Ga0495676_0653830 3300047321 Unclassified 682
460 Ga0495680_0047376 3300047322 Bacteria 3382
461 Ga0495680_0168792 3300047322 Unclassified 1585
462 Ga0495675_0011345 3300047444 Bacteria 5591
463 Ga0495684_0001989 3300047471 Bacteria 16424
464 Ga0495684_0039383 3300047471 Bacteria 3622
465 Ga0495684_0867101 3300047471 Unclassified 584
466 Ga0495593_0028603 3300047673 Bacteria 3061
467 Ga0495602_0017462 3300048088 Bacteria 7194
468 Ga0495602_0048177 3300048088 Bacteria 3834
469 Ga0495602_0063632 3300048088 Bacteria 3195
470 Ga0495614_0462312 3300048089 Unclassified 601
471 Ga0496102_0482384 3300048905 Bacteria 1161
472 Ga0496106_0207566 3300048909 Bacteria 1560
473 Ga0496107_1042916 3300048910 Bacteria 592
474 Ga0496108_0853048 3300048911 Bacteria 784
475 Ga0496108_0898211 3300048911 Unclassified 760
476 Ga0496112_0924366 3300048915 Unclassified 794
477 Ga0501032_0271595 3300049569 Bacteria 1099
478 Ga0501033_0084713 3300049570 Unclassified 2323
479 Ga0501034_0477433 3300049571 Bacteria 1162
480 Ga0501037_0214387 3300049573 Unclassified 1357
481 Ga0501038_0561399 3300049574 Unclassified 867
482 Ga0501047_0025167 3300049581 Bacteria 5719
483 Ga0501047_0283075 3300049581 Unclassified 1502
484 Ga0501067_0031244 3300049583 Bacteria 2955
485 Ga0501068_0294824 3300049584 Unclassified 1038
486 Ga0501070_0227676 3300049586 Unclassified 1528
487 Ga0501072_0116421 3300049588 Unclassified 2129
488 Ga0501072_0772951 3300049588 Bacteria 753
489 Ga0501072_0977206 3300049588 Bacteria 660
490 Ga0501073_0014860 3300049589 Bacteria 5650
491 Ga0501073_0035752 3300049589 Unclassified 3529
492 Ga0501074_0983758 3300049590 Unclassified 593
493 Ga0501075_0750914 3300049591 Bacteria 743
494 Ga0501079_0610012 3300049741 Bacteria 859
495 Ga0501080_0000727 3300049742 Bacteria 26556
496 Ga0501080_0003247 3300049742 Bacteria 14347
497 Ga0501083_0038450 3300049744 Unclassified 3253
498 Ga0501083_0835566 3300049744 Unclassified 599
499 Ga0501083_1091174 3300049744 Unclassified 519
500 Ga0501035_0005162 3300049822 Bacteria 12353
501 Ga0501044_0207482 3300049823 Bacteria 1915
502 nmdc:mga03683_112186_c1 3300050489 Unclassified 1206
503 nmdc:mga00v17_30671_c1 3300050491 Bacteria 3164
504 nmdc:mga0k408_486066_c1 3300050493 Bacteria 732
505 nmdc:mga06z11_32774_c1 3300050494 Bacteria 2536
506 nmdc:mga06r32_18857_c1 3300050510 Bacteria 6324
507 nmdc:mga0n895_1143867_c1 3300050512 Unclassified 754
508 nmdc:mga0rr50_2828_c1 3300050513 Bacteria 9869
509 nmdc:mga0rr50_91266_c1 3300050513 Bacteria 2372
510 nmdc:mga08x19_66506_c1 3300050514 Bacteria 2342
511 Ga0495612_0000580 3300053078 Bacteria 14735
512 Ga0495595_0390713 3300053084 Unclassified 704
513 Ga0495619_0020484 3300053085 Bacteria 4212
514 Ga0500641_0000174 3300053096 Bacteria 24259
515 Ga0501082_0066986 3300060353 Bacteria 3092
516 Ga0501082_0909010 3300060353 Unclassified 770
517 Ga0068851_10389342
518 Ga0065707_10123493
519 Ga0070658_10494522
520 Ga0070676_10146068
521 Ga0070683_101406603
522 Ga0070690_100007181
523 Ga0070690_100228595
524 Ga0070690_100916369
525 Ga0070677_10403714
526 Ga0068869_100762651
527 Ga0070680_100327840
528 Ga0070680_100333098
529 Ga0070680_100969204
530 Ga0068868_100886858
531 Ga0070689_100192357
532 Ga0070687_100062666
533 Ga0070687_100755784
534 Ga0070661_100269823
535 Ga0070692_10354704
536 Ga0070669_100135657
537 Ga0070669_100400472
538 Ga0070675_100605846
539 Ga0070675_100609140
540 Ga0070671_100085446
541 Ga0070674_100207027
542 Ga0070674_100250043
543 Ga0070674_100283010
544 Ga0070673_100001470
545 Ga0070688_100094540
546 Ga0070688_100103047
547 Ga0070688_100331697
548 Ga0070659_100753075
549 Ga0070667_100260146
550 Ga0070667_100779950
551 Ga0070667_101209242
552 Ga0070713_100029432
553 Ga0070713_100131073
554 Ga0070713_100220296
555 Ga0070713_100608532
556 Ga0070710_10131624
557 Ga0070701_10074443
558 Ga0070711_100001047
559 Ga0070711_100067159
560 Ga0070705_100039757
561 Ga0070705_100379456
562 Ga0070700_100126184
563 Ga0070694_100192064
564 Ga0070708_100012735
565 Ga0070708_100026625
566 Ga0070708_100080277
567 Ga0070708_100104699
568 Ga0070663_100604594
569 Ga0070678_101589204
570 Ga0070662_100099700
571 Ga0068867_100006619
572 Ga0070685_10040690
573 Ga0070685_11187849
574 Ga0070706_100012461
575 Ga0070706_100110142
576 Ga0070706_100201762
577 Ga0070706_101291805
578 Ga0070707_100011723
579 Ga0070707_100269637
580 Ga0070707_100937679
581 Ga0070707_101431981
582 Ga0070699_100218280
583 Ga0070699_100963496
584 Ga0070699_101250652
585 Ga0070684_100341468
586 Ga0070697_100002376
587 Ga0070697_100309326
588 Ga0070697_100425781
589 Ga0068853_101309232
590 Ga0068853_101919897
591 Ga0070672_100005378
592 Ga0070672_100205847
593 Ga0070672_100255846
594 Ga0070686_100031377
595 Ga0070695_100174439
596 Ga0070696_100297722
597 Ga0070665_100085352
598 Ga0070665_100135484
599 Ga0070704_100013457
600 Ga0070704_100620687
601 Ga0070704_101042521
602 Ga0068855_100133157
603 Ga0068855_101160515
604 Ga0070664_100091178
605 Ga0068857_100408005
606 Ga0068854_100330832
607 Ga0068856_102481859
608 Ga0070702_100183309
609 Ga0068852_101956221
610 Ga0068859_100042337
611 Ga0068859_100345472
612 Ga0068859_100623356
613 Ga0068859_101843761
614 Ga0068864_100108490
615 Ga0068864_100637188
616 Ga0068864_101709261
617 Ga0068866_10036167
618 Ga0068866_10384128
619 Ga0068866_10423654
620 Ga0068861_100484793
621 Ga0068851_10406042
622 Ga0068870_10346060
623 Ga0068863_100062240
624 Ga0068863_100073445
625 Ga0068863_100344252
626 Ga0068858_100180937
627 Ga0068858_100298349
628 Ga0068858_100481530
629 Ga0068860_100023921
630 Ga0068860_100085333
631 Ga0068862_100320046
632 Ga0068862_102230914
633 Ga0070717_10018173
634 Ga0070717_10062619
635 Ga0070717_10115112
636 Ga0070717_10316527
637 Ga0070717_10457319
638 Ga0075365_10028572
639 Ga0075364_10052008
640 Ga0070716_100001017
641 Ga0070716_100121493
642 Ga0070716_100532712
643 Ga0070716_101605030
644 Ga0070712_100034755
645 Ga0075367_10290564
646 Ga0097621_100487277
647 Ga0068871_100052996
648 Ga0075431_100117060
649 Ga0075434_100163377
650 Ga0075434_100586253
651 Ga0068865_100149246
652 Ga0068865_100198552
653 Ga0075436_100012908
654 Ga0097620_100042340
655 Ga0097620_100345466
656 Ga0097620_100623339
657 Ga0097620_101844080
658 Ga0075435_100099822
659 Ga0099794_10002138
660 Ga0099794_10005558
661 Ga0099794_10029807
662 Ga0099794_10065096
663 Ga0099794_10132453
664 Ga0099794_10315451
665 Ga0099794_10503225
666 Ga0099795_10009340
667 Ga0111539_12029865
668 Ga0105245_10120790
669 Ga0105245_11335448
670 Ga0105243_10471770
671 Ga0105241_10105626
672 Ga0105242_11836929
673 Ga0105248_10069424
674 Ga0105248_10078026
675 Ga0105248_10144896
676 Ga0105248_10212471
677 Ga0105248_10249429
678 Ga0105248_10388113
679 Ga0105248_10724085
680 Ga0105237_10493096
681 Ga0105237_12630046
682 Ga0105238_10358839
683 Ga0105238_10376224
684 Ga0105238_12240747
685 Ga0105249_10424762
686 Ga0099796_10377551
687 Ga0105246_10167352
688 Ga0157373_10595021
689 Ga0157371_10222764
690 Ga0157370_10312167
691 Ga0157369_10027735
692 Ga0157369_10595677
693 Ga0157369_11144713
694 Ga0157374_10150404
695 Ga0157378_10552075
696 Ga0157378_11919062
697 Ga0163162_11019623
698 Ga0157372_10059962
699 Ga0157372_10410795
700 Ga0157372_10507566
701 Ga0157375_10062315
702 Ga0157375_10751485
703 Ga0157375_12082586
704 Ga0163163_10205265
705 Ga0163163_11146778
706 Ga0157380_10215428
707 Ga0157380_10286641
708 Ga0157380_10334184
709 Ga0157380_13055388
710 Ga0157376_10186668
711 Ga0157376_11009464
712 Ga0157376_11892031
713 Ga0163161_10622233
714 Ga0213874_10009338
715 Ga0213874_10124571
716 Ga0213876_10193595
717 Ga0213875_10003282
718 Ga0213875_10071973
719 Ga0224712_10412975
720 Ga0224572_1003011
721 Ga0207697_10031878
722 Ga0207682_10067266
723 Ga0207692_10392999
724 Ga0207642_10282982
725 Ga0207699_10078241
726 Ga0207699_10235954
727 Ga0207645_10162731
728 Ga0207643_10285688
729 Ga0207705_10671056
730 Ga0207684_10029191
731 Ga0207684_10043771
732 Ga0207684_10175009
733 Ga0207684_10336220
734 Ga0207707_10807438
735 Ga0207693_10018691
736 Ga0207693_10081705
737 Ga0207693_10743350
738 Ga0207663_10034735
739 Ga0207663_10122146
740 Ga0207660_10736335
741 Ga0207662_10005334
742 Ga0207649_10270603
743 Ga0207649_10815771
744 Ga0207652_10877137
745 Ga0207646_10009626
746 Ga0207646_10014375
747 Ga0207646_10347698
748 Ga0207646_10359350
749 Ga0207646_11187845
750 Ga0207681_10281131
751 Ga0207681_11639654
752 Ga0207694_10683039
753 Ga0207694_10853870
754 Ga0207650_10456262
755 Ga0207650_10639847
756 Ga0207659_10133007
757 Ga0207659_10804088
758 Ga0207687_10228010
759 Ga0207700_10002191
760 Ga0207700_10084870
761 Ga0207700_11023078
762 Ga0207664_10001736
763 Ga0207644_10008511
764 Ga0207644_10250049
765 Ga0207706_10360980
766 Ga0207686_10145491
767 Ga0207709_11723735
768 Ga0207670_10554647
769 Ga0207670_11758320
770 Ga0207669_10026458
771 Ga0207669_10282206
772 Ga0207704_10022101
773 Ga0207665_10002541
774 Ga0207665_10036892
775 Ga0207665_10279408
776 Ga0207691_10010512
777 Ga0207691_10017724
778 Ga0207691_10082900
779 Ga0207711_10012331
780 Ga0207711_10225951
781 Ga0207711_10313040
782 Ga0207711_10679493
783 Ga0207661_10184770
784 Ga0207679_10192995
785 Ga0207667_10261836
786 Ga0207667_11007821
787 Ga0207651_10001610
788 Ga0207651_10054550
789 Ga0207712_10219303
790 Ga0207658_10710350
791 Ga0207677_10338259
792 Ga0207703_10023111
793 Ga0207703_10069841
794 Ga0207639_10515471
795 Ga0207678_10681538
796 Ga0207678_10713629
797 Ga0207708_10699332
798 Ga0207641_10015511
799 Ga0207641_10035095
800 Ga0207641_10448070
801 Ga0207641_11025507
802 Ga0207648_10006172
803 Ga0207648_11762483
804 Ga0207676_10251180
805 Ga0207674_10358137
806 Ga0207675_100016040
807 Ga0207675_102236476
808 Ga0207683_10373967
809 Ga0207683_11403275
810 Ga0209588_1000821
811 Ga0209588_1001532
812 Ga0209588_1044702
813 Ga0209588_1063737
814 Ga0209588_1072962
815 Ga0209588_1112945
816 Ga0209588_1135429
817 Ga0209998_10155300
818 Ga0268266_10030332
819 Ga0268264_10057960
820 Ga0268264_10790942
821 Ga0265338_10038502
822 Ga0265338_10051466
823 Ga0265762_1050102
824 Ga0265762_1056302
825 Ga0265760_10053091
826 Ga0265760_10153571
827 Ga0265760_10190427
828 Ga0265760_10270371
829 Ga0265330_10075169
830 Ga0265330_10130986
831 Ga0265332_10011313
832 Ga0265328_10140150
833 Ga0265328_10386223
834 Ga0265325_10005869
835 Ga0265325_10044574
836 Ga0265325_10123612
837 Ga0265340_10010235
838 Ga0265340_10021774
839 Ga0265340_10430010
840 Ga0265339_10013522
841 Ga0265339_10014281
842 Ga0265339_10075737
843 Ga0265331_10173260
844 Ga0265327_10029065
845 Ga0265316_10006350
846 Ga0265316_10017405
847 Ga0265316_10123693
848 Ga0265316_10171685
849 Ga0265316_10207736
850 Ga0265316_10400523
851 Ga0265316_10451937
852 Ga0265316_10508963
853 Ga0307408_101107039
854 Ga0265313_10032813
855 Ga0265313_10245593
856 Ga0265314_10018114
857 Ga0265314_10039128
858 Ga0265314_10063533
859 Ga0265342_10248156
860 Ga0316583_10158265
861 Ga0316214_1018129
862 Ga0373926_0007987
863 Ga0373926_0008267
864 Ga0373951_0024328
865 Ga0373923_0047012
866 Ga0373953_0491009
867 Ga0373954_0017285
868 Ga0373954_0025928
869 Ga0373943_0172783
870 Ga0373943_0775934
871 Ga0373946_0040202
872 Ga0373961_0024064
873 Ga0373962_0028306
874 Ga0373931_0100622
875 Ga0373935_0012251
876 Ga0373935_0173845
877 Ga0373927_0000114
878 Ga0373927_0004472
879 Ga0373927_0063644
880 Ga0373933_0362892
881 Ga0373933_0426818
882 Ga0373947_0003752
883 Ga0373947_0009887
884 Ga0373947_0722770
885 Ga0373937_0026065
886 Ga0373937_0138548
887 Ga0373937_0147084
888 Ga0373937_0282714
889 Ga0373937_0351100
890 Ga0373937_0891481
891 Ga0373937_1175299
892 Ga0265778_053905
893 Ga0373925_0000115
894 Ga0373925_0127826
895 Ga0436364_0047706
896 Ga0436364_0491526
897 Ga0436364_0917857
898 Ga0436365_1091989
899 Ga0436360_0859571
900 Ga0436361_0307100
901 Ga0436363_0377849
902 Ga0436363_1080467
903 Ga0436363_1638793
904 Ga0436362_1235603
905 Ga0451793_1459842
906 Ga0451807_1921236
907 Ga0439433_0070461
908 Ga0439433_0161604
909 Ga0439433_0180407
910 Ga0453683_0776092
911 Ga0466966_0056366
912 Ga0466961_0297473
913 Ga0466961_0766694
914 Ga0453684_0277302
915 Ga0453684_0599627
916 Ga0466959_0470778
917 Ga0466958_0382992
918 Ga0466958_0641145
919 Ga0495592_0039329
920 Ga0495592_0080591
921 Ga0495592_0209164
922 Ga0495592_0431264
923 Ga0495651_0006095
924 Ga0495653_0008008
925 Ga0495580_0020256
926 Ga0495580_0474058
927 Ga0495582_0107503
928 Ga0495582_0332352
929 Ga0495582_0697722
930 Ga0495664_0056281
931 Ga0495664_0381509
932 Ga0495608_0015999
933 Ga0495608_0953887
934 Ga0495618_0191919
935 Ga0495618_0218233
936 Ga0495628_0021248
937 Ga0495628_0110452
938 Ga0495630_0012131
939 Ga0495630_0029013
940 Ga0495630_0247013
941 Ga0495666_0069918
942 Ga0495652_0061512
943 Ga0495665_0005363
944 Ga0495665_0599065
945 Ga0495640_0015358
946 Ga0495640_0133902
947 Ga0495640_0164917
948 Ga0495586_0233308
949 Ga0495587_0040320
950 Ga0495645_0050574
951 Ga0495645_0573464
952 Ga0495667_0014013
953 Ga0495667_0453805
954 Ga0495667_0489097
955 Ga0495634_0321038
956 Ga0495635_0022861
957 Ga0495588_0405084
958 Ga0495599_0461162
959 Ga0495599_0697544
960 Ga0495623_0001794
961 Ga0495623_0050365
962 Ga0495646_0012553
963 Ga0495646_0359917
964 Ga0495613_0098281
965 Ga0495624_0018742
966 Ga0495600_0128438
967 Ga0495604_0039516
968 Ga0495604_0046492
969 Ga0495604_0108319
970 Ga0495604_0811663
971 Ga0495674_0032474
972 Ga0495674_0035883
973 Ga0495674_1215911
974 Ga0495676_0307340
975 Ga0495676_0653830
976 Ga0495680_0047376
977 Ga0495680_0168792
978 Ga0495675_0011345
979 Ga0495684_0001989
980 Ga0495684_0039383
981 Ga0495684_0867101
982 Ga0495593_0028603
983 Ga0495602_0017462
984 Ga0495602_0048177
985 Ga0495602_0063632
986 Ga0495614_0462312
987 Ga0496102_0482384
988 Ga0496106_0207566
989 Ga0496107_1042916
990 Ga0496108_0853048
991 Ga0496108_0898211
992 Ga0496112_0924366
993 Ga0501032_0271595
994 Ga0501033_0084713
995 Ga0501034_0477433
996 Ga0501037_0214387
997 Ga0501038_0561399
998 Ga0501047_0025167
999 Ga0501047_0283075
1000 Ga0501067_0031244
1001 Ga0501068_0294824
1002 Ga0501070_0227676
1003 Ga0501072_0116421
1004 Ga0501072_0772951
1005 Ga0501072_0977206
1006 Ga0501073_0014860
1007 Ga0501073_0035752
1008 Ga0501074_0983758
1009 Ga0501075_0750914
1010 Ga0501079_0610012
1011 Ga0501080_0000727
1012 Ga0501080_0003247
1013 Ga0501083_0038450
1014 Ga0501083_0835566
1015 Ga0501083_1091174
1016 Ga0501035_0005162
1017 Ga0501044_0207482
1018 nmdc:mga03683_112186_c1
1019 nmdc:mga00v17_30671_c1
1020 nmdc:mga0k408_486066_c1
1021 nmdc:mga06z11_32774_c1
1022 nmdc:mga06r32_18857_c1
1023 nmdc:mga0n895_1143867_c1
1024 nmdc:mga0rr50_2828_c1
1025 nmdc:mga0rr50_91266_c1
1026 nmdc:mga08x19_66506_c1
1027 Ga0495612_0000580
1028 Ga0495595_0390713
1029 Ga0495619_0020484
1030 Ga0500641_0000174
1031 Ga0501082_0066986
1032 Ga0501082_0909010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

20

136

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8776 2 126
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8675 1 123
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8237 2 126
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.8077 2 125
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.787 2 125
ID Description Score Start End Superfamily
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8738 1 125 3.40.50.1010
4chgB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8347 3 126 3.40.50.1010
af_P95007_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8303 1 124 3.40.50.1010
3h87A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8077 3 126 3.40.50.1010
af_P9WF73_1_115_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.803 1 118 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2V9AGH1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.998 1 124 GO:0000287
GO:0004540
GO:0090729
AF-A0A2W0CN10-F1-model_v4 Uncharacterized protein 0.9953 37 102
AF-A0A7Y5U0T4-F1-model_v4 PIN domain-containing protein 0.9922 1 124
AF-A0A523DL58-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9921 1 124 GO:0000287
GO:0004540
GO:0090729
AF-A0A317JJA8-F1-model_v4 PIN domain-containing protein 0.9851 1 124 GO:0004540

Map