F457969

General Info

Members Datasets Scaffolds Average Seq Length
516 274 516 91

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100312260|Ga0070708_1003122603
Length 88
Sequence MTSYRYAVNVTPKPGILDPQGRAVEGSLGHVRVGRRVELTVDAVDEASARAVVDRLARELLSNPLIEAYDVEAIGGASSAMSGAAREA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
163 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
195 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 4.07
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10196667 3300001990 Bacteria 595
2 JGI24743J22301_10054863 3300001991 Bacteria 815
3 JGI24749J21850_1081646 3300002076 Bacteria 509
4 JGI24744J21845_10045089 3300002077 Bacteria 819
5 JGI24034J26672_10058564 3300002239 Bacteria 673
6 JGI24742J22300_10106820 3300002244 Bacteria 545
7 Ga0070683_100355674 3300005329 Bacteria 1394
8 Ga0070690_100030603 3300005330 Bacteria 3347
9 Ga0070690_101461922 3300005330 Bacteria 551
10 Ga0070670_100075377 3300005331 Bacteria 2898
11 Ga0070677_10454376 3300005333 Bacteria 686
12 Ga0068869_100800326 3300005334 Bacteria 810
13 Ga0070666_10374826 3300005335 Bacteria 1021
14 Ga0070680_101169298 3300005336 Bacteria 665
15 Ga0070682_100052344 3300005337 Bacteria 2555
16 Ga0070682_100145400 3300005337 Bacteria 1621
17 Ga0070682_100232671 3300005337 Bacteria 1318
18 Ga0068868_100678282 3300005338 Bacteria 920
19 Ga0068868_100714146 3300005338 Bacteria 898
20 Ga0070660_100656171 3300005339 Bacteria 879
21 Ga0070689_100021019 3300005340 Bacteria 4852
22 Ga0070691_10126244 3300005341 Bacteria 1292
23 Ga0070691_10220427 3300005341 Bacteria 1005
24 Ga0070687_100004804 3300005343 Bacteria 5409
25 Ga0070661_100073743 3300005344 Bacteria 2513
26 Ga0070661_100923811 3300005344 Bacteria 721
27 Ga0070692_10014742 3300005345 Bacteria 3680
28 Ga0070692_10941911 3300005345 Bacteria 600
29 Ga0070692_11405426 3300005345 Bacteria 504
30 Ga0070668_100052938 3300005347 Bacteria 3130
31 Ga0070668_101273500 3300005347 Bacteria 668
32 Ga0070668_101731110 3300005347 Bacteria 574
33 Ga0070675_100035406 3300005354 Bacteria 4056
34 Ga0070675_101644095 3300005354 Bacteria 593
35 Ga0070671_100433274 3300005355 Bacteria 1127
36 Ga0070674_100001116 3300005356 Bacteria 14090
37 Ga0070674_100613595 3300005356 Bacteria 921
38 Ga0070674_100819059 3300005356 Bacteria 805
39 Ga0070673_100760703 3300005364 Bacteria 892
40 Ga0070688_100052109 3300005365 Bacteria 2555
41 Ga0070688_100055476 3300005365 Bacteria 2485
42 Ga0070659_100034131 3300005366 Bacteria 3956
43 Ga0070713_100380576 3300005436 Bacteria 1315
44 Ga0070701_10003243 3300005438 Bacteria 6406
45 Ga0070701_10296755 3300005438 Bacteria 992
46 Ga0070705_100044327 3300005440 Bacteria 2555
47 Ga0070700_100008655 3300005441 Bacteria 5549
48 Ga0070700_101144841 3300005441 Bacteria 647
49 Ga0070700_101149304 3300005441 Bacteria 646
50 Ga0070694_100543298 3300005444 Bacteria 930
51 Ga0070708_100003051 3300005445 Bacteria 13005
52 Ga0070708_100312260 3300005445 Bacteria 1481
53 Ga0070708_100487835 3300005445 Bacteria 1162
54 Ga0070663_100682358 3300005455 Bacteria 872
55 Ga0070678_100103774 3300005456 Bacteria 2209
56 Ga0070662_100086261 3300005457 Bacteria 2348
57 Ga0068867_100006532 3300005459 Bacteria 8236
58 Ga0070685_10037135 3300005466 Bacteria 2758
59 Ga0070706_100014757 3300005467 Bacteria 7218
60 Ga0070707_100005880 3300005468 Bacteria 11440
61 Ga0070707_100457523 3300005468 Bacteria 1237
62 Ga0070698_100102317 3300005471 Bacteria 2835
63 Ga0070698_100168925 3300005471 Bacteria 2129
64 Ga0070698_100196533 3300005471 Bacteria 1953
65 Ga0070698_100607583 3300005471 Bacteria 1034
66 Ga0070698_101693931 3300005471 Bacteria 585
67 Ga0070699_100084891 3300005518 Bacteria 2763
68 Ga0070699_100223527 3300005518 Bacteria 1678
69 Ga0070699_100370505 3300005518 Bacteria 1292
70 Ga0070699_100785580 3300005518 Bacteria 871
71 Ga0070699_100866369 3300005518 Bacteria 827
72 Ga0070699_102010454 3300005518 Bacteria 528
73 Ga0070679_100248020 3300005530 Bacteria 1737
74 Ga0070684_100035818 3300005535 Bacteria 4250
75 Ga0070684_101050354 3300005535 Bacteria 765
76 Ga0070684_101770486 3300005535 Bacteria 583
77 Ga0070697_100224337 3300005536 Bacteria 1602
78 Ga0070697_100604996 3300005536 Bacteria 964
79 Ga0068853_100204624 3300005539 Bacteria 1797
80 Ga0068853_101703445 3300005539 Bacteria 611
81 Ga0070672_100081408 3300005543 Bacteria 2596
82 Ga0070672_101016771 3300005543 Bacteria 735
83 Ga0070686_100052794 3300005544 Bacteria 2593
84 Ga0070695_100007429 3300005545 Bacteria 6499
85 Ga0070695_100869977 3300005545 Bacteria 726
86 Ga0070696_100007321 3300005546 Bacteria 7370
87 Ga0070696_100126796 3300005546 Bacteria 1853
88 Ga0070696_100537746 3300005546 Bacteria 934
89 Ga0070704_100329566 3300005549 Bacteria 1282
90 Ga0070704_102002253 3300005549 Bacteria 537
91 Ga0068855_100357044 3300005563 Bacteria 1609
92 Ga0070664_101973825 3300005564 Bacteria 554
93 Ga0068854_100158487 3300005578 Bacteria 1751
94 Ga0068854_100313470 3300005578 Bacteria 1273
95 Ga0068856_101968524 3300005614 Bacteria 595
96 Ga0070702_100002279 3300005615 Bacteria 8215
97 Ga0070702_101734757 3300005615 Unclassified 520
98 Ga0068852_100089976 3300005616 Bacteria 2744
99 Ga0068859_100008240 3300005617 Bacteria 10570
100 Ga0068864_100006074 3300005618 Bacteria 9911
101 Ga0068866_10126138 3300005718 Bacteria 1449
102 Ga0068866_11169078 3300005718 Bacteria 554
103 Ga0068861_100368126 3300005719 Bacteria 1266
104 Ga0068861_100412161 3300005719 Bacteria 1202
105 Ga0068861_100840612 3300005719 Bacteria 865
106 Ga0068861_101143820 3300005719 Bacteria 750
107 Ga0068870_10004617 3300005840 Bacteria 5942
108 Ga0068870_11021437 3300005840 Bacteria 591
109 Ga0068870_11215909 3300005840 Bacteria 546
110 Ga0068863_101056057 3300005841 Bacteria 816
111 Ga0068858_100034505 3300005842 Bacteria 4693
112 Ga0068858_101521953 3300005842 Bacteria 660
113 Ga0068860_100133271 3300005843 Bacteria 2385
114 Ga0068862_101150167 3300005844 Bacteria 773
115 Ga0075365_10179613 3300006038 Bacteria 1479
116 Ga0075364_10380327 3300006051 Bacteria 963
117 Ga0075432_10206831 3300006058 Bacteria 779
118 Ga0070716_101080209 3300006173 Bacteria 639
119 Ga0097621_101637303 3300006237 Bacteria 612
120 Ga0068871_100207136 3300006358 Bacteria 1695
121 Ga0075428_100014023 3300006844 Bacteria 8919
122 Ga0075428_100068180 3300006844 Bacteria 3892
123 Ga0075428_100752646 3300006844 Bacteria 1037
124 Ga0075428_101075886 3300006844 Bacteria 850
125 Ga0075431_100558472 3300006847 Bacteria 1132
126 Ga0075433_10040240 3300006852 Bacteria 4045
127 Ga0075433_10444372 3300006852 Bacteria 1143
128 Ga0075433_10461067 3300006852 Bacteria 1120
129 Ga0075434_100259133 3300006871 Bacteria 1758
130 Ga0075434_101976775 3300006871 Bacteria 588
131 Ga0068865_100026965 3300006881 Bacteria 3792
132 Ga0068865_101627590 3300006881 Bacteria 581
133 Ga0075436_100294019 3300006914 Bacteria 1163
134 Ga0097620_100008241 3300006931 Bacteria 10570
135 Ga0075435_100149478 3300007076 Bacteria 1963
136 Ga0075435_100335239 3300007076 Bacteria 1296
137 Ga0075435_100634647 3300007076 Bacteria 927
138 Ga0105244_10237623 3300009036 Bacteria 851
139 Ga0111539_10015164 3300009094 Bacteria 9601
140 Ga0111539_10227587 3300009094 Bacteria 2172
141 Ga0111539_10232256 3300009094 Bacteria 2148
142 Ga0111539_10480164 3300009094 Bacteria 1448
143 Ga0105245_10280686 3300009098 Bacteria 1628
144 Ga0105245_11616373 3300009098 Bacteria 700
145 Ga0105245_12990895 3300009098 Bacteria 524
146 Ga0105247_10172237 3300009101 Bacteria 1440
147 Ga0114129_10063351 3300009147 Bacteria 5163
148 Ga0114129_10085876 3300009147 Bacteria 4365
149 Ga0114129_10096952 3300009147 Bacteria 4082
150 Ga0114129_13273352 3300009147 Bacteria 525
151 Ga0105243_10004531 3300009148 Bacteria 10980
152 Ga0105243_11713333 3300009148 Bacteria 658
153 Ga0105241_10206978 3300009174 Bacteria 1642
154 Ga0105241_10808239 3300009174 Bacteria 864
155 Ga0105242_10043927 3300009176 Bacteria 3617
156 Ga0105242_11042296 3300009176 Bacteria 828
157 Ga0105237_10512843 3300009545 Bacteria 1206
158 Ga0105238_10042511 3300009551 Bacteria 4601
159 Ga0105249_10034163 3300009553 Bacteria 4605
160 Ga0105249_10690147 3300009553 Bacteria 1080
161 Ga0105239_10007925 3300010375 Bacteria 12143
162 Ga0105239_10356053 3300010375 Bacteria 1652
163 Ga0105246_10292960 3300011119 Bacteria 1310
164 Ga0157374_10494394 3300013296 Bacteria 1227
165 Ga0157374_12655874 3300013296 Archaea 528
166 Ga0157378_10044955 3300013297 Bacteria 3922
167 Ga0157378_10786702 3300013297 Bacteria 976
168 Ga0163162_11317937 3300013306 Bacteria 820
169 Ga0163162_12439180 3300013306 Bacteria 601
170 Ga0157375_10005306 3300013308 Bacteria 11194
171 Ga0157375_10622710 3300013308 Bacteria 1237
172 Ga0163163_10256102 3300014325 Bacteria 1801
173 Ga0163163_10533310 3300014325 Bacteria 1236
174 Ga0157380_10010874 3300014326 Bacteria 6562
175 Ga0157380_10739036 3300014326 Bacteria 994
176 Ga0157380_10877772 3300014326 Bacteria 921
177 Ga0157380_10998434 3300014326 Bacteria 870
178 Ga0157380_11191564 3300014326 Bacteria 805
179 Ga0157380_13063648 3300014326 Bacteria 533
180 Ga0157377_10001395 3300014745 Bacteria 10417
181 Ga0157379_10199802 3300014968 Bacteria 1808
182 Ga0157379_10542151 3300014968 Bacteria 1082
183 Ga0157379_11120321 3300014968 Bacteria 754
184 Ga0157376_10152748 3300014969 Bacteria 2084
185 Ga0157376_10423483 3300014969 Bacteria 1293
186 Ga0157376_11697023 3300014969 Bacteria 667
187 Ga0163161_10367300 3300017792 Bacteria 1147
188 Ga0163161_10405181 3300017792 Bacteria 1094
189 Ga0207642_10095290 3300025899 Bacteria 1481
190 Ga0207710_10281686 3300025900 Bacteria 837
191 Ga0207688_10006583 3300025901 Bacteria 6319
192 Ga0207680_10234063 3300025903 Bacteria 1263
193 Ga0207645_10281367 3300025907 Bacteria 1105
194 Ga0207645_10358575 3300025907 Bacteria 976
195 Ga0207643_10005791 3300025908 Bacteria 6604
196 Ga0207643_10808425 3300025908 Bacteria 607
197 Ga0207705_11425897 3300025909 Bacteria 526
198 Ga0207684_10093095 3300025910 Bacteria 2569
199 Ga0207660_11253962 3300025917 Bacteria 603
200 Ga0207662_10002007 3300025918 Bacteria 10061
201 Ga0207657_10130696 3300025919 Bacteria 2058
202 Ga0207649_10033835 3300025920 Bacteria 3057
203 Ga0207652_11188664 3300025921 Bacteria 664
204 Ga0207646_10017880 3300025922 Bacteria 6622
205 Ga0207646_10441654 3300025922 Bacteria 1174
206 Ga0207646_10893190 3300025922 Bacteria 788
207 Ga0207694_10327186 3300025924 Bacteria 1266
208 Ga0207659_10011252 3300025926 Bacteria 5649
209 Ga0207687_10013365 3300025927 Bacteria 5360
210 Ga0207700_10843706 3300025928 Bacteria 820
211 Ga0207644_10640725 3300025931 Bacteria 884
212 Ga0207690_10159860 3300025932 Bacteria 1678
213 Ga0207690_10807064 3300025932 Bacteria 776
214 Ga0207706_10009261 3300025933 Bacteria 9048
215 Ga0207686_10027023 3300025934 Bacteria 3356
216 Ga0207709_11410295 3300025935 Bacteria 577
217 Ga0207670_10009148 3300025936 Bacteria 5634
218 Ga0207669_10007236 3300025937 Bacteria 5117
219 Ga0207669_10488855 3300025937 Bacteria 983
220 Ga0207704_10187856 3300025938 Bacteria 1500
221 Ga0207704_11106185 3300025938 Bacteria 673
222 Ga0207704_11666230 3300025938 Unclassified 548
223 Ga0207691_10074397 3300025940 Bacteria 3064
224 Ga0207691_10269921 3300025940 Bacteria 1465
225 Ga0207689_10971107 3300025942 Bacteria 717
226 Ga0207661_10076129 3300025944 Bacteria 2755
227 Ga0207679_10766630 3300025945 Bacteria 878
228 Ga0207679_11538115 3300025945 Bacteria 610
229 Ga0207667_10413031 3300025949 Bacteria 1373
230 Ga0207651_11037923 3300025960 Bacteria 733
231 Ga0207712_10315461 3300025961 Bacteria 1288
232 Ga0207712_10885047 3300025961 Bacteria 788
233 Ga0207668_10037695 3300025972 Bacteria 3238
234 Ga0207668_10429809 3300025972 Bacteria 1123
235 Ga0207640_10573815 3300025981 Bacteria 951
236 Ga0207677_10463252 3300026023 Bacteria 1088
237 Ga0207703_10023793 3300026035 Bacteria 4818
238 Ga0207703_11595813 3300026035 Bacteria 628
239 Ga0207703_11865973 3300026035 Bacteria 577
240 Ga0207639_10036829 3300026041 Bacteria 3629
241 Ga0207678_10040635 3300026067 Bacteria 4033
242 Ga0207678_10589502 3300026067 Bacteria 974
243 Ga0207708_10005128 3300026075 Bacteria 9664
244 Ga0207708_11229943 3300026075 Bacteria 655
245 Ga0207702_11814965 3300026078 Bacteria 602
246 Ga0207641_11006392 3300026088 Bacteria 830
247 Ga0207648_10003076 3300026089 Bacteria 17627
248 Ga0207648_10549832 3300026089 Bacteria 1060
249 Ga0207648_11686425 3300026089 Bacteria 595
250 Ga0207674_10118514 3300026116 Bacteria 2617
251 Ga0207674_10621098 3300026116 Bacteria 1044
252 Ga0207675_100271705 3300026118 Bacteria 1645
253 Ga0207675_100279821 3300026118 Bacteria 1621
254 Ga0207675_100326936 3300026118 Bacteria 1498
255 Ga0207683_10388350 3300026121 Bacteria 1283
256 Ga0207683_11564711 3300026121 Bacteria 608
257 Ga0207698_10475127 3300026142 Bacteria 1211
258 Ga0207698_11045215 3300026142 Bacteria 828
259 Ga0209996_1066190 3300027395 Bacteria 558
260 Ga0209982_1070386 3300027552 Bacteria 573
261 Ga0209983_1072462 3300027665 Bacteria 768
262 Ga0209971_1190579 3300027682 Bacteria 505
263 Ga0209998_10138912 3300027717 Bacteria 620
264 Ga0209974_10042357 3300027876 Bacteria 1516
265 Ga0209974_10071142 3300027876 Bacteria 1187
266 Ga0207428_10076747 3300027907 Bacteria 2616
267 Ga0207428_10889192 3300027907 Bacteria 630
268 Ga0268266_10380107 3300028379 Bacteria 1332
269 Ga0268266_11273094 3300028379 Bacteria 711
270 Ga0268265_11344960 3300028380 Bacteria 715
271 Ga0268264_10043072 3300028381 Bacteria 3739
272 Ga0316575_10011489 3300031665 Bacteria 3280
273 Ga0316575_10221490 3300031665 Bacteria 790
274 Ga0316579_10354117 3300031691 Bacteria 710
275 Ga0316576_10007382 3300031727 Bacteria 6920
276 Ga0316578_10460321 3300031728 Bacteria 751
277 Ga0307405_10051355 3300031731 Bacteria 2558
278 Ga0307413_10102376 3300031824 Bacteria 1896
279 Ga0307410_10412420 3300031852 Bacteria 1094
280 Ga0307406_10034847 3300031901 Bacteria 3091
281 Ga0307407_10497290 3300031903 Bacteria 893
282 Ga0307412_10065010 3300031911 Bacteria 2467
283 Ga0307409_100196146 3300031995 Bacteria 1802
284 Ga0307409_100835062 3300031995 Bacteria 931
285 Ga0307416_100001579 3300032002 Bacteria 12493
286 Ga0307416_101320629 3300032002 Bacteria 827
287 Ga0307416_101700417 3300032002 Bacteria 736
288 Ga0307416_103133210 3300032002 Bacteria 553
289 Ga0307414_10641145 3300032004 Bacteria 957
290 Ga0307411_10341119 3300032005 Bacteria 1218
291 Ga0307411_11805849 3300032005 Bacteria 568
292 Ga0307415_100019327 3300032126 Bacteria 4135
293 Ga0316580_10163962 3300032139 Bacteria 683
294 Ga0373940_0129800 3300035088 Bacteria 789
295 Ga0373949_0014272 3300035090 Bacteria 1768
296 Ga0373941_0023663 3300035115 Bacteria 1756
297 Ga0373960_0094273 3300035121 Bacteria 961
298 Ga0373943_0311396 3300035170 Bacteria 896
299 Ga0373961_0204054 3300035241 Bacteria 698
300 Ga0373962_0213556 3300035242 Bacteria 657
301 Ga0316574_0026760 3300035398 Bacteria 3470
302 Ga0316574_0362375 3300035398 Bacteria 916
303 Ga0373931_0023515 3300035691 Bacteria 3112
304 Ga0373947_0986234 3300035725 Bacteria 575
305 Ga0373937_1038672 3300036401 Bacteria 768
306 Ga0316582_1102507 3300036647 Bacteria 541
307 Ga0316584_0794516 3300036712 Bacteria 643
308 Ga0439466_0083662 3300041411 Bacteria 1005
309 Ga0451793_1332091 3300041452 Bacteria 742
310 Ga0451841_1287539 3300041498 Bacteria 590
311 Ga0451843_0579044 3300041509 Bacteria 717
312 Ga0451855_0373657 3300041511 Bacteria 793
313 Ga0451853_0655649 3300041512 Bacteria 587
314 Ga0451853_2404527 3300041512 Bacteria 587
315 Ga0439431_0037805 3300041997 Bacteria 1220
316 Ga0450920_101545 3300042122 Bacteria 597
317 Ga0439446_0180706 3300042156 Bacteria 705
318 Ga0453684_2015205 3300044712 Bacteria 581
319 Ga0451576_0348025 3300045051 Bacteria 1552
320 Ga0495596_0319320 3300046500 Bacteria 604
321 Ga0495630_0110142 3300046517 Bacteria 2086
322 Ga0495630_0773744 3300046517 Bacteria 733
323 Ga0495630_0890336 3300046517 Bacteria 678
324 Ga0495644_0145195 3300046523 Bacteria 907
325 Ga0495652_0361154 3300046529 Bacteria 1038
326 Ga0495587_0792606 3300046536 Bacteria 518
327 Ga0495633_0303552 3300046558 Bacteria 725
328 Ga0495656_0138165 3300046615 Bacteria 1166
329 Ga0495657_0461483 3300046675 Bacteria 743
330 Ga0495657_0556702 3300046675 Bacteria 666
331 Ga0495599_0342531 3300046678 Bacteria 897
332 Ga0495647_0076008 3300046681 Bacteria 1353
333 Ga0495581_0740938 3300047315 Bacteria 566
334 Ga0495604_0901174 3300047317 Bacteria 552
335 Ga0495674_0686323 3300047319 Bacteria 805
336 Ga0495680_0346872 3300047322 Bacteria 1034
337 Ga0495684_0728438 3300047471 Bacteria 655
338 Ga0495602_0339089 3300048088 Bacteria 1088
339 Ga0495602_0439083 3300048088 Bacteria 923
340 Ga0496100_1509947 3300048903 Bacteria 531
341 Ga0496101_0273733 3300048904 Bacteria 1318
342 Ga0496102_0007949 3300048905 Bacteria 9065
343 Ga0496102_0433857 3300048905 Bacteria 1233
344 Ga0496102_0644723 3300048905 Bacteria 982
345 Ga0496103_0045104 3300048906 Bacteria 2719
346 Ga0496103_0258174 3300048906 Bacteria 1121
347 Ga0496104_0913355 3300048907 Bacteria 783
348 Ga0496106_0132372 3300048909 Bacteria 1956
349 Ga0496106_1268846 3300048909 Bacteria 573
350 Ga0496107_0113233 3300048910 Bacteria 1995
351 Ga0496108_0018247 3300048911 Bacteria 5745
352 Ga0496108_1178385 3300048911 Bacteria 649
353 Ga0496109_0007211 3300048912 Bacteria 9396
354 Ga0496109_0100184 3300048912 Bacteria 2688
355 Ga0496110_0044652 3300048913 Bacteria 3870
356 Ga0496110_1327254 3300048913 Bacteria 629
357 Ga0496111_0018696 3300048914 Bacteria 4804
358 Ga0496112_0205039 3300048915 Bacteria 1930
359 Ga0496113_0390945 3300048916 Bacteria 1116
360 Ga0501031_0070347 3300049568 Bacteria 2279
361 Ga0501031_0070562 3300049568 Bacteria 2276
362 Ga0501031_0174569 3300049568 Bacteria 1404
363 Ga0501031_0194029 3300049568 Bacteria 1326
364 Ga0501031_0238818 3300049568 Bacteria 1181
365 Ga0501031_0373768 3300049568 Bacteria 922
366 Ga0501032_0151636 3300049569 Bacteria 1524
367 Ga0501032_0272368 3300049569 Bacteria 1097
368 Ga0501033_0719444 3300049570 Bacteria 678
369 Ga0501036_0015936 3300049572 Bacteria 6277
370 Ga0501036_0487885 3300049572 Bacteria 1025
371 Ga0501037_0081224 3300049573 Bacteria 2351
372 Ga0501037_0240405 3300049573 Bacteria 1269
373 Ga0501038_0077810 3300049574 Bacteria 2799
374 Ga0501039_0105678 3300049575 Bacteria 2198
375 Ga0501039_0110986 3300049575 Bacteria 2144
376 Ga0501039_0220512 3300049575 Bacteria 1491
377 Ga0501039_0343470 3300049575 Bacteria 1173
378 Ga0501039_0365055 3300049575 Bacteria 1134
379 Ga0501039_0687318 3300049575 Bacteria 800
380 Ga0501040_0027865 3300049576 Bacteria 3805
381 Ga0501040_0030658 3300049576 Bacteria 3633
382 Ga0501040_0227205 3300049576 Bacteria 1329
383 Ga0501040_1229175 3300049576 Bacteria 544
384 Ga0501041_0017737 3300049577 Bacteria 4237
385 Ga0501041_0031132 3300049577 Bacteria 3221
386 Ga0501041_0233188 3300049577 Bacteria 1156
387 Ga0501042_0127906 3300049578 Bacteria 1830
388 Ga0501042_0582311 3300049578 Bacteria 813
389 Ga0501043_0178973 3300049579 Bacteria 1653
390 Ga0501043_0473876 3300049579 Bacteria 938
391 Ga0501046_0362412 3300049580 Bacteria 1051
392 Ga0501046_0392369 3300049580 Bacteria 1003
393 Ga0501046_0396380 3300049580 Bacteria 997
394 Ga0501048_0071458 3300049582 Bacteria 2450
395 Ga0501048_0537472 3300049582 Bacteria 838
396 Ga0501048_0620320 3300049582 Bacteria 776
397 Ga0501048_0952467 3300049582 Bacteria 617
398 Ga0501048_1340460 3300049582 Bacteria 514
399 Ga0501067_0049719 3300049583 Bacteria 2323
400 Ga0501068_0185871 3300049584 Bacteria 1315
401 Ga0501068_0507220 3300049584 Bacteria 783
402 Ga0501069_0129794 3300049585 Bacteria 1443
403 Ga0501069_0399187 3300049585 Bacteria 813
404 Ga0501069_0743154 3300049585 Bacteria 593
405 Ga0501070_0154199 3300049586 Bacteria 1895
406 Ga0501070_0197344 3300049586 Bacteria 1653
407 Ga0501071_0010881 3300049587 Bacteria 6105
408 Ga0501071_0161569 3300049587 Bacteria 1674
409 Ga0501071_0186704 3300049587 Bacteria 1554
410 Ga0501071_0269980 3300049587 Bacteria 1286
411 Ga0501071_0301262 3300049587 Bacteria 1215
412 Ga0501071_0362694 3300049587 Bacteria 1103
413 Ga0501072_0018742 3300049588 Bacteria 5336
414 Ga0501072_0082696 3300049588 Bacteria 2545
415 Ga0501072_0156311 3300049588 Bacteria 1818
416 Ga0501072_0326305 3300049588 Bacteria 1220
417 Ga0501072_0356413 3300049588 Bacteria 1161
418 Ga0501073_0107539 3300049589 Bacteria 1935
419 Ga0501073_0915181 3300049589 Bacteria 604
420 Ga0501073_0928436 3300049589 Bacteria 599
421 Ga0501073_1273863 3300049589 Unclassified 504
422 Ga0501074_0020477 3300049590 Bacteria 4807
423 Ga0501074_0076267 3300049590 Bacteria 2406
424 Ga0501074_0489618 3300049590 Bacteria 871
425 Ga0501075_0013476 3300049591 Bacteria 5835
426 Ga0501075_0051787 3300049591 Bacteria 3087
427 Ga0501075_0056751 3300049591 Bacteria 2948
428 Ga0501075_0098094 3300049591 Bacteria 2224
429 Ga0501075_0098141 3300049591 Bacteria 2224
430 Ga0501075_1375917 3300049591 Bacteria 535
431 Ga0501076_0015705 3300049592 Bacteria 5727
432 Ga0501076_0036842 3300049592 Bacteria 3834
433 Ga0501076_0113837 3300049592 Bacteria 2189
434 Ga0501076_0147972 3300049592 Bacteria 1910
435 Ga0501076_0156199 3300049592 Bacteria 1857
436 Ga0501076_0379953 3300049592 Bacteria 1161
437 Ga0501076_0680489 3300049592 Bacteria 849
438 Ga0501076_1049215 3300049592 Bacteria 671
439 Ga0501077_0154663 3300049593 Bacteria 1455
440 Ga0501077_0178955 3300049593 Bacteria 1348
441 Ga0501077_0320945 3300049593 Bacteria 987
442 Ga0501079_0039886 3300049741 Bacteria 3623
443 Ga0501079_0080908 3300049741 Bacteria 2512
444 Ga0501079_0110021 3300049741 Bacteria 2140
445 Ga0501079_0432423 3300049741 Bacteria 1033
446 Ga0501079_0886622 3300049741 Bacteria 702
447 Ga0501080_0079471 3300049742 Bacteria 3049
448 Ga0501080_0183976 3300049742 Bacteria 1922
449 Ga0501080_0400947 3300049742 Bacteria 1234
450 Ga0501080_0921750 3300049742 Bacteria 761
451 Ga0501080_1042216 3300049742 Bacteria 708
452 Ga0501081_0057996 3300049743 Bacteria 2678
453 Ga0501081_0149055 3300049743 Bacteria 1680
454 Ga0501081_1540163 3300049743 Bacteria 505
455 Ga0501083_0114380 3300049744 Bacteria 1772
456 Ga0501083_0271745 3300049744 Bacteria 1103
457 Ga0501083_0384463 3300049744 Bacteria 913
458 Ga0501083_0977910 3300049744 Bacteria 551
459 Ga0501035_0502022 3300049822 Bacteria 998
460 Ga0501035_0637055 3300049822 Bacteria 865
461 Ga0501044_0508033 3300049823 Bacteria 1106
462 Ga0501044_0620587 3300049823 Bacteria 973
463 Ga0501045_0059527 3300049824 Bacteria 2798
464 Ga0501045_0077241 3300049824 Bacteria 2453
465 Ga0501045_0120473 3300049824 Bacteria 1948
466 Ga0501045_0150499 3300049824 Bacteria 1731
467 Ga0501045_0208339 3300049824 Bacteria 1456
468 Ga0501045_0727083 3300049824 Bacteria 732
469 nmdc:mga05p37_1045529_c1 3300050507 Bacteria 862
470 nmdc:mga05p37_1204194_c1 3300050507 Bacteria 782
471 nmdc:mga05p37_1379545_c1 3300050507 Bacteria 712
472 nmdc:mga05p37_1736_c1 3300050507 Bacteria 25436
473 nmdc:mga05p37_498604_c1 3300050507 Bacteria 1398
474 nmdc:mga05p37_558304_c1 3300050507 Bacteria 1302
475 nmdc:mga05p37_699293_c1 3300050507 Bacteria 1126
476 nmdc:mga06r32_497598_c1 3300050510 Bacteria 1196
477 nmdc:mga08y16_54535_c1 3300050511 Bacteria 4177
478 nmdc:mga08y16_558531_c1 3300050511 Bacteria 1158
479 nmdc:mga08y16_66343_c1 3300050511 Bacteria 3766
480 nmdc:mga0n895_167070_c1 3300050512 Bacteria 2232
481 nmdc:mga0n895_36114_c1 3300050512 Bacteria 4770
482 nmdc:mga0n895_473051_c1 3300050512 Bacteria 1264
483 nmdc:mga0n895_684442_c1 3300050512 Bacteria 1022
484 nmdc:mga0rr50_138251_c1 3300050513 Bacteria 1957
485 nmdc:mga0rr50_1847931_c1 3300050513 Bacteria 508
486 nmdc:mga0rr50_799924_c1 3300050513 Bacteria 804
487 nmdc:mga0rr50_87068_c1 3300050513 Bacteria 2424
488 nmdc:mga08x19_319388_c1 3300050514 Bacteria 1080
489 nmdc:mga0a205_121914_c1 3300050515 Bacteria 2506
490 nmdc:mga0a205_186896_c1 3300050515 Bacteria 1964
491 nmdc:mga0a205_220328_c1 3300050515 Bacteria 1783
492 nmdc:mga0a205_247947_c1 3300050515 Bacteria 1661
493 Ga0495601_0461547 3300053077 Bacteria 821
494 Ga0495595_0019461 3300053084 Bacteria 2945
495 Ga0495619_0497638 3300053085 Bacteria 838
496 Ga0495619_0650061 3300053085 Bacteria 719
497 Ga0495619_0713502 3300053085 Bacteria 681
498 Ga0501084_0019556 3300054114 Bacteria 5643
499 Ga0501084_0351886 3300054114 Bacteria 1244
500 Ga0501084_0374067 3300054114 Bacteria 1204
501 Ga0501084_0527580 3300054114 Bacteria 998
502 Ga0501084_0653656 3300054114 Bacteria 887
503 Ga0501084_0676505 3300054114 Bacteria 871
504 Ga0501084_1402962 3300054114 Bacteria 585
505 Ga0501082_0024356 3300060353 Bacteria 5218
506 Ga0501082_0307098 3300060353 Bacteria 1381
507 Ga0501082_0644496 3300060353 Bacteria 927
508 Ga0501082_0718973 3300060353 Bacteria 874
509 Ga0501082_1002229 3300060353 Bacteria 730
510 Ga0501082_1132853 3300060353 Bacteria 684
511 Ga0530510_0083052 3300061734 Bacteria 2333
512 Ga0530510_0105435 3300061734 Bacteria 2063
513 Ga0530510_0298268 3300061734 Bacteria 1206
514 Ga0530510_0317403 3300061734 Bacteria 1168
515 Ga0530510_0514669 3300061734 Bacteria 907
516 Ga0530510_1540782 3300061734 Bacteria 510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_103133210 Ga0307416_1031332102 74
2 3300005445 Ga0070708_100487835 Ga0070708_1004878352 75
3 3300005468 Ga0070707_100457523 Ga0070707_1004575232 75
4 3300025922 Ga0207646_10441654 Ga0207646_104416542 75
5 3300049568 Ga0501031_0174569 Ga0501031_0174569_1082_1378 77
6 3300005345 Ga0070692_11405426 Ga0070692_114054261 79
7 3300005445 Ga0070708_100312260 Ga0070708_1003122603 81
8 3300005468 Ga0070707_100005880 Ga0070707_1000058807 81
9 3300005546 Ga0070696_100007321 Ga0070696_1000073216 81
10 3300006852 Ga0075433_10040240 Ga0075433_100402402 81
11 3300025917 Ga0207660_11253962 Ga0207660_112539622 81
12 3300025921 Ga0207652_11188664 Ga0207652_111886642 81
13 3300025922 Ga0207646_10017880 Ga0207646_100178804 81
14 3300027876 Ga0209974_10042357 Ga0209974_100423571 81
15 3300032002 Ga0307416_101320629 Ga0307416_1013206292 81
16 3300032005 Ga0307411_10341119 Ga0307411_103411192 81
17 3300041511 Ga0451855_0373657 Ga0451855_0373657_251_532 81
18 3300042122 Ga0450920_101545 Ga0450920_101545_37_309 81
19 3300050512 nmdc:mga0n895_167070_c1 nmdc:mga0n895_167070_c1_962_1234 81
20 3300050515 nmdc:mga0a205_247947_c1 nmdc:mga0a205_247947_c1_729_1001 81
21 3300014326 Ga0157380_10877772 Ga0157380_108777722 82
22 3300009098 Ga0105245_12990895 Ga0105245_129908952 84
23 3300014968 Ga0157379_11120321 Ga0157379_111203211 84
24 3300031665 Ga0316575_10011489 Ga0316575_100114892 84
25 3300031691 Ga0316579_10354117 Ga0316579_103541172 84
26 3300036647 Ga0316582_1102507 Ga0316582_1102507_35_316 84
27 3300047317 Ga0495604_0901174 Ga0495604_0901174_48_362 84
28 3300047319 Ga0495674_0686323 Ga0495674_0686323_333_647 84
29 3300053077 Ga0495601_0461547 Ga0495601_0461547_258_572 84
30 3300005471 Ga0070698_100168925 Ga0070698_1001689252 85
31 3300005518 Ga0070699_100084891 Ga0070699_1000848913 85
32 3300005536 Ga0070697_100604996 Ga0070697_1006049961 85
33 3300005840 Ga0068870_11215909 Ga0068870_112159091 85
34 3300032002 Ga0307416_101700417 Ga0307416_1017004172 85
35 3300005518 Ga0070699_100370505 Ga0070699_1003705053 86
36 3300006871 Ga0075434_100259133 Ga0075434_1002591332 86
37 3300014968 Ga0157379_10542151 Ga0157379_105421512 86
38 3300031731 Ga0307405_10051355 Ga0307405_100513552 86
39 3300031824 Ga0307413_10102376 Ga0307413_101023762 86
40 3300031901 Ga0307406_10034847 Ga0307406_100348473 86
41 3300031911 Ga0307412_10065010 Ga0307412_100650103 86
42 3300031995 Ga0307409_100196146 Ga0307409_1001961463 86
43 3300032002 Ga0307416_100001579 Ga0307416_10000157912 86
44 3300032126 Ga0307415_100019327 Ga0307415_1000193274 86
45 3300041498 Ga0451841_1287539 Ga0451841_1287539_26_325 86
46 3300041509 Ga0451843_0579044 Ga0451843_0579044_17_328 86
47 3300044712 Ga0453684_2015205 Ga0453684_2015205_141_437 86
48 3300045051 Ga0451576_0348025 Ga0451576_0348025_143_439 86
49 3300049568 Ga0501031_0070562 Ga0501031_0070562_1517_1777 86
50 3300049568 Ga0501031_0373768 Ga0501031_0373768_97_357 86
51 3300049575 Ga0501039_0110986 Ga0501039_0110986_930_1190 86
52 3300049575 Ga0501039_0220512 Ga0501039_0220512_87_347 86
53 3300049575 Ga0501039_0687318 Ga0501039_0687318_55_315 86
54 3300049576 Ga0501040_0227205 Ga0501040_0227205_373_633 86
55 3300049576 Ga0501040_1229175 Ga0501040_1229175_202_462 86
56 3300049580 Ga0501046_0392369 Ga0501046_0392369_280_540 86
57 3300049582 Ga0501048_0620320 Ga0501048_0620320_217_477 86
58 3300049584 Ga0501068_0507220 Ga0501068_0507220_242_502 86
59 3300049585 Ga0501069_0743154 Ga0501069_0743154_55_315 86
60 3300049586 Ga0501070_0154199 Ga0501070_0154199_378_638 86
61 3300049587 Ga0501071_0010881 Ga0501071_0010881_1376_1636 86
62 3300049587 Ga0501071_0186704 Ga0501071_0186704_675_935 86
63 3300049587 Ga0501071_0301262 Ga0501071_0301262_897_1157 86
64 3300049588 Ga0501072_0156311 Ga0501072_0156311_346_606 86
65 3300049588 Ga0501072_0356413 Ga0501072_0356413_867_1127 86
66 3300049590 Ga0501074_0020477 Ga0501074_0020477_2881_3141 86
67 3300049591 Ga0501075_0013476 Ga0501075_0013476_2773_3033 86
68 3300049591 Ga0501075_0098094 Ga0501075_0098094_502_762 86
69 3300049591 Ga0501075_0098141 Ga0501075_0098141_1653_1913 86
70 3300049591 Ga0501075_1375917 Ga0501075_1375917_217_477 86
71 3300049592 Ga0501076_0147972 Ga0501076_0147972_918_1178 86
72 3300049592 Ga0501076_0379953 Ga0501076_0379953_867_1127 86
73 3300049592 Ga0501076_0680489 Ga0501076_0680489_200_460 86
74 3300049593 Ga0501077_0178955 Ga0501077_0178955_69_329 86
75 3300049741 Ga0501079_0110021 Ga0501079_0110021_12_272 86
76 3300049742 Ga0501080_0921750 Ga0501080_0921750_163_423 86
77 3300049743 Ga0501081_0149055 Ga0501081_0149055_388_648 86
78 3300049744 Ga0501083_0271745 Ga0501083_0271745_662_922 86
79 3300049744 Ga0501083_0977910 Ga0501083_0977910_174_434 86
80 3300049824 Ga0501045_0059527 Ga0501045_0059527_1572_1832 86
81 3300049824 Ga0501045_0120473 Ga0501045_0120473_937_1197 86
82 3300050507 nmdc:mga05p37_1045529_c1 nmdc:mga05p37_1045529_c1_351_611 86
83 3300050513 nmdc:mga0rr50_1847931_c1 nmdc:mga0rr50_1847931_c1_224_484 86
84 3300054114 Ga0501084_0019556 Ga0501084_0019556_1771_2031 86
85 3300054114 Ga0501084_0374067 Ga0501084_0374067_153_413 86
86 3300060353 Ga0501082_0024356 Ga0501082_0024356_3686_3946 86
87 3300061734 Ga0530510_0083052 Ga0530510_0083052_630_890 86
88 3300061734 Ga0530510_0298268 Ga0530510_0298268_295_555 86
89 3300061734 Ga0530510_0317403 Ga0530510_0317403_358_618 86
90 3300061734 Ga0530510_1540782 Ga0530510_1540782_233_493 86
91 3300005337 Ga0070682_100145400 Ga0070682_1001454002 87
92 3300005341 Ga0070691_10220427 Ga0070691_102204272 87
93 3300005344 Ga0070661_100923811 Ga0070661_1009238112 87
94 3300005345 Ga0070692_10941911 Ga0070692_109419112 87
95 3300005347 Ga0070668_101731110 Ga0070668_1017311102 87
96 3300005354 Ga0070675_101644095 Ga0070675_1016440952 87
97 3300005356 Ga0070674_100613595 Ga0070674_1006135951 87
98 3300005365 Ga0070688_100055476 Ga0070688_1000554762 87
99 3300005438 Ga0070701_10296755 Ga0070701_102967552 87
100 3300005441 Ga0070700_101144841 Ga0070700_1011448412 87
101 3300005535 Ga0070684_101050354 Ga0070684_1010503542 87
102 3300005539 Ga0068853_101703445 Ga0068853_1017034452 87
103 3300005543 Ga0070672_101016771 Ga0070672_1010167712 87
104 3300005545 Ga0070695_100869977 Ga0070695_1008699772 87
105 3300005564 Ga0070664_101973825 Ga0070664_1019738251 87
106 3300005719 Ga0068861_100412161 Ga0068861_1004121612 87
107 3300005719 Ga0068861_101143820 Ga0068861_1011438202 87
108 3300005840 Ga0068870_11021437 Ga0068870_110214371 87
109 3300005842 Ga0068858_101521953 Ga0068858_1015219532 87
110 3300006844 Ga0075428_100752646 Ga0075428_1007526462 87
111 3300006844 Ga0075428_101075886 Ga0075428_1010758861 87
112 3300009094 Ga0111539_10227587 Ga0111539_102275873 87
113 3300009094 Ga0111539_10232256 Ga0111539_102322563 87
114 3300009147 Ga0114129_10063351 Ga0114129_100633514 87
115 3300009553 Ga0105249_10690147 Ga0105249_106901472 87
116 3300011119 Ga0105246_10292960 Ga0105246_102929603 87
117 3300013296 Ga0157374_12655874 Ga0157374_126558742 87
118 3300013308 Ga0157375_10622710 Ga0157375_106227102 87
119 3300014325 Ga0163163_10533310 Ga0163163_105333102 87
120 3300014326 Ga0157380_10739036 Ga0157380_107390362 87
121 3300014326 Ga0157380_11191564 Ga0157380_111915642 87
122 3300014969 Ga0157376_10423483 Ga0157376_104234832 87
123 3300017792 Ga0163161_10405181 Ga0163161_104051812 87
124 3300025908 Ga0207643_10808425 Ga0207643_108084253 87
125 3300025932 Ga0207690_10807064 Ga0207690_108070642 87
126 3300025937 Ga0207669_10488855 Ga0207669_104888552 87
127 3300025938 Ga0207704_11106185 Ga0207704_111061852 87
128 3300025940 Ga0207691_10269921 Ga0207691_102699212 87
129 3300025945 Ga0207679_11538115 Ga0207679_115381152 87
130 3300025961 Ga0207712_10885047 Ga0207712_108850472 87
131 3300025972 Ga0207668_10429809 Ga0207668_104298092 87
132 3300026035 Ga0207703_11595813 Ga0207703_115958131 87
133 3300026035 Ga0207703_11865973 Ga0207703_118659731 87
134 3300026067 Ga0207678_10589502 Ga0207678_105895022 87
135 3300026089 Ga0207648_10549832 Ga0207648_105498322 87
136 3300026116 Ga0207674_10621098 Ga0207674_106210981 87
137 3300026118 Ga0207675_100271705 Ga0207675_1002717053 87
138 3300026121 Ga0207683_10388350 Ga0207683_103883502 87
139 3300026121 Ga0207683_11564711 Ga0207683_115647112 87
140 3300026142 Ga0207698_11045215 Ga0207698_110452152 87
141 3300027665 Ga0209983_1072462 Ga0209983_10724622 87
142 3300027682 Ga0209971_1190579 Ga0209971_11905791 87
143 3300027717 Ga0209998_10138912 Ga0209998_101389122 87
144 3300027876 Ga0209974_10071142 Ga0209974_100711422 87
145 3300031665 Ga0316575_10221490 Ga0316575_102214901 87
146 3300031727 Ga0316576_10007382 Ga0316576_100073826 87
147 3300031728 Ga0316578_10460321 Ga0316578_104603212 87
148 3300031852 Ga0307410_10412420 Ga0307410_104124202 87
149 3300031903 Ga0307407_10497290 Ga0307407_104972902 87
150 3300031995 Ga0307409_100835062 Ga0307409_1008350622 87
151 3300032004 Ga0307414_10641145 Ga0307414_106411452 87
152 3300032005 Ga0307411_11805849 Ga0307411_118058491 87
153 3300032139 Ga0316580_10163962 Ga0316580_101639622 87
154 3300035398 Ga0316574_0026760 Ga0316574_0026760_1346_1645 87
155 3300035398 Ga0316574_0362375 Ga0316574_0362375_29_328 87
156 3300036712 Ga0316584_0794516 Ga0316584_0794516_56_355 87
157 3300041452 Ga0451793_1332091 Ga0451793_1332091_239_538 87
158 3300041512 Ga0451853_2404527 Ga0451853_2404527_68_367 87
159 3300049568 Ga0501031_0238818 Ga0501031_0238818_39_302 87
160 3300049569 Ga0501032_0151636 Ga0501032_0151636_912_1175 87
161 3300049570 Ga0501033_0719444 Ga0501033_0719444_378_641 87
162 3300049572 Ga0501036_0487885 Ga0501036_0487885_144_407 87
163 3300049573 Ga0501037_0081224 Ga0501037_0081224_373_636 87
164 3300049574 Ga0501038_0077810 Ga0501038_0077810_229_492 87
165 3300049575 Ga0501039_0105678 Ga0501039_0105678_483_746 87
166 3300049576 Ga0501040_0027865 Ga0501040_0027865_920_1183 87
167 3300049577 Ga0501041_0031132 Ga0501041_0031132_2233_2496 87
168 3300049578 Ga0501042_0582311 Ga0501042_0582311_218_481 87
169 3300049579 Ga0501043_0178973 Ga0501043_0178973_455_718 87
170 3300049580 Ga0501046_0396380 Ga0501046_0396380_567_830 87
171 3300049582 Ga0501048_0537472 Ga0501048_0537472_231_494 87
172 3300049584 Ga0501068_0185871 Ga0501068_0185871_968_1231 87
173 3300049585 Ga0501069_0399187 Ga0501069_0399187_144_407 87
174 3300049586 Ga0501070_0197344 Ga0501070_0197344_468_731 87
175 3300049587 Ga0501071_0362694 Ga0501071_0362694_496_759 87
176 3300049588 Ga0501072_0018742 Ga0501072_0018742_3054_3317 87
177 3300049589 Ga0501073_0107539 Ga0501073_0107539_681_944 87
178 3300049590 Ga0501074_0489618 Ga0501074_0489618_126_389 87
179 3300049591 Ga0501075_0051787 Ga0501075_0051787_534_797 87
180 3300049592 Ga0501076_0036842 Ga0501076_0036842_3226_3489 87
181 3300049592 Ga0501076_0113837 Ga0501076_0113837_953_1237 87
182 3300049593 Ga0501077_0154663 Ga0501077_0154663_756_1019 87
183 3300049741 Ga0501079_0886622 Ga0501079_0886622_402_665 87
184 3300049742 Ga0501080_0079471 Ga0501080_0079471_966_1229 87
185 3300049743 Ga0501081_0057996 Ga0501081_0057996_1690_1953 87
186 3300049744 Ga0501083_0114380 Ga0501083_0114380_838_1101 87
187 3300049822 Ga0501035_0637055 Ga0501035_0637055_82_345 87
188 3300049823 Ga0501044_0508033 Ga0501044_0508033_313_576 87
189 3300049824 Ga0501045_0077241 Ga0501045_0077241_1178_1441 87
190 3300049824 Ga0501045_0727083 Ga0501045_0727083_360_644 87
191 3300050507 nmdc:mga05p37_699293_c1 nmdc:mga05p37_699293_c1_519_782 87
192 3300050511 nmdc:mga08y16_558531_c1 nmdc:mga08y16_558531_c1_373_636 87
193 3300054114 Ga0501084_0653656 Ga0501084_0653656_204_467 87
194 3300061734 Ga0530510_0514669 Ga0530510_0514669_468_731 87
195 3300005471 Ga0070698_100607583 Ga0070698_1006075832 88
196 3300005518 Ga0070699_100866369 Ga0070699_1008663691 88
197 3300006852 Ga0075433_10461067 Ga0075433_104610672 88
198 3300006871 Ga0075434_101976775 Ga0075434_1019767752 88
199 3300007076 Ga0075435_100634647 Ga0075435_1006346472 88
200 3300014326 Ga0157380_10998434 Ga0157380_109984342 88
201 3300042156 Ga0439446_0180706 Ga0439446_0180706_256_534 88
202 3300049588 Ga0501072_0326305 Ga0501072_0326305_749_1030 88
203 3300049589 Ga0501073_1273863 Ga0501073_1273863_42_323 88
204 3300049743 Ga0501081_1540163 Ga0501081_1540163_200_481 88
205 3300050507 nmdc:mga05p37_1379545_c1 nmdc:mga05p37_1379545_c1_270_551 88
206 3300050507 nmdc:mga05p37_558304_c1 nmdc:mga05p37_558304_c1_81_362 88
207 3300050512 nmdc:mga0n895_36114_c1 nmdc:mga0n895_36114_c1_3373_3654 88
208 3300050513 nmdc:mga0rr50_87068_c1 nmdc:mga0rr50_87068_c1_1296_1577 88
209 3300050515 nmdc:mga0a205_121914_c1 nmdc:mga0a205_121914_c1_272_553 88
210 3300060353 Ga0501082_1132853 Ga0501082_1132853_213_494 88
211 3300001990 JGI24737J22298_10196667 JGI24737J22298_101966672 89
212 3300001991 JGI24743J22301_10054863 JGI24743J22301_100548632 89
213 3300002076 JGI24749J21850_1081646 JGI24749J21850_10816462 89
214 3300002077 JGI24744J21845_10045089 JGI24744J21845_100450892 89
215 3300002239 JGI24034J26672_10058564 JGI24034J26672_100585641 89
216 3300002244 JGI24742J22300_10106820 JGI24742J22300_101068202 89
217 3300005329 Ga0070683_100355674 Ga0070683_1003556741 89
218 3300005330 Ga0070690_100030603 Ga0070690_1000306033 89
219 3300005330 Ga0070690_101461922 Ga0070690_1014619221 89
220 3300005331 Ga0070670_100075377 Ga0070670_1000753773 89
221 3300005333 Ga0070677_10454376 Ga0070677_104543762 89
222 3300005334 Ga0068869_100800326 Ga0068869_1008003262 89
223 3300005335 Ga0070666_10374826 Ga0070666_103748262 89
224 3300005336 Ga0070680_101169298 Ga0070680_1011692982 89
225 3300005337 Ga0070682_100052344 Ga0070682_1000523442 89
226 3300005337 Ga0070682_100232671 Ga0070682_1002326711 89
227 3300005338 Ga0068868_100678282 Ga0068868_1006782822 89
228 3300005338 Ga0068868_100714146 Ga0068868_1007141462 89
229 3300005339 Ga0070660_100656171 Ga0070660_1006561712 89
230 3300005340 Ga0070689_100021019 Ga0070689_1000210192 89
231 3300005341 Ga0070691_10126244 Ga0070691_101262442 89
232 3300005343 Ga0070687_100004804 Ga0070687_1000048044 89
233 3300005344 Ga0070661_100073743 Ga0070661_1000737432 89
234 3300005345 Ga0070692_10014742 Ga0070692_100147423 89
235 3300005347 Ga0070668_100052938 Ga0070668_1000529382 89
236 3300005347 Ga0070668_101273500 Ga0070668_1012735002 89
237 3300005354 Ga0070675_100035406 Ga0070675_1000354062 89
238 3300005355 Ga0070671_100433274 Ga0070671_1004332742 89
239 3300005356 Ga0070674_100001116 Ga0070674_1000011166 89
240 3300005356 Ga0070674_100819059 Ga0070674_1008190592 89
241 3300005364 Ga0070673_100760703 Ga0070673_1007607032 89
242 3300005365 Ga0070688_100052109 Ga0070688_1000521093 89
243 3300005366 Ga0070659_100034131 Ga0070659_1000341314 89
244 3300005436 Ga0070713_100380576 Ga0070713_1003805762 89
245 3300005438 Ga0070701_10003243 Ga0070701_100032436 89
246 3300005440 Ga0070705_100044327 Ga0070705_1000443272 89
247 3300005441 Ga0070700_100008655 Ga0070700_1000086554 89
248 3300005441 Ga0070700_101149304 Ga0070700_1011493042 89
249 3300005444 Ga0070694_100543298 Ga0070694_1005432982 89
250 3300005445 Ga0070708_100003051 Ga0070708_1000030513 89
251 3300005455 Ga0070663_100682358 Ga0070663_1006823581 89
252 3300005456 Ga0070678_100103774 Ga0070678_1001037742 89
253 3300005457 Ga0070662_100086261 Ga0070662_1000862612 89
254 3300005459 Ga0068867_100006532 Ga0068867_1000065326 89
255 3300005466 Ga0070685_10037135 Ga0070685_100371353 89
256 3300005467 Ga0070706_100014757 Ga0070706_1000147574 89
257 3300005471 Ga0070698_100102317 Ga0070698_1001023173 89
258 3300005471 Ga0070698_100196533 Ga0070698_1001965333 89
259 3300005471 Ga0070698_101693931 Ga0070698_1016939312 89
260 3300005518 Ga0070699_100223527 Ga0070699_1002235272 89
261 3300005518 Ga0070699_100785580 Ga0070699_1007855802 89
262 3300005518 Ga0070699_102010454 Ga0070699_1020104542 89
263 3300005530 Ga0070679_100248020 Ga0070679_1002480203 89
264 3300005535 Ga0070684_100035818 Ga0070684_1000358183 89
265 3300005535 Ga0070684_101770486 Ga0070684_1017704862 89
266 3300005536 Ga0070697_100224337 Ga0070697_1002243372 89
267 3300005539 Ga0068853_100204624 Ga0068853_1002046242 89
268 3300005543 Ga0070672_100081408 Ga0070672_1000814082 89
269 3300005544 Ga0070686_100052794 Ga0070686_1000527943 89
270 3300005545 Ga0070695_100007429 Ga0070695_1000074291 89
271 3300005546 Ga0070696_100126796 Ga0070696_1001267962 89
272 3300005546 Ga0070696_100537746 Ga0070696_1005377462 89
273 3300005549 Ga0070704_100329566 Ga0070704_1003295662 89
274 3300005549 Ga0070704_102002253 Ga0070704_1020022531 89
275 3300005563 Ga0068855_100357044 Ga0068855_1003570442 89
276 3300005578 Ga0068854_100158487 Ga0068854_1001584872 89
277 3300005578 Ga0068854_100313470 Ga0068854_1003134702 89
278 3300005614 Ga0068856_101968524 Ga0068856_1019685242 89
279 3300005615 Ga0070702_100002279 Ga0070702_1000022795 89
280 3300005615 Ga0070702_101734757 Ga0070702_1017347571 89
281 3300005616 Ga0068852_100089976 Ga0068852_1000899763 89
282 3300005617 Ga0068859_100008240 Ga0068859_1000082402 89
283 3300005618 Ga0068864_100006074 Ga0068864_1000060746 89
284 3300005718 Ga0068866_10126138 Ga0068866_101261382 89
285 3300005718 Ga0068866_11169078 Ga0068866_111690782 89
286 3300005719 Ga0068861_100368126 Ga0068861_1003681262 89
287 3300005719 Ga0068861_100840612 Ga0068861_1008406122 89
288 3300005840 Ga0068870_10004617 Ga0068870_100046175 89
289 3300005841 Ga0068863_101056057 Ga0068863_1010560572 89
290 3300005842 Ga0068858_100034505 Ga0068858_1000345052 89
291 3300005843 Ga0068860_100133271 Ga0068860_1001332712 89
292 3300005844 Ga0068862_101150167 Ga0068862_1011501672 89
293 3300006038 Ga0075365_10179613 Ga0075365_101796132 89
294 3300006051 Ga0075364_10380327 Ga0075364_103803272 89
295 3300006058 Ga0075432_10206831 Ga0075432_102068312 89
296 3300006173 Ga0070716_101080209 Ga0070716_1010802092 89
297 3300006237 Ga0097621_101637303 Ga0097621_1016373032 89
298 3300006358 Ga0068871_100207136 Ga0068871_1002071362 89
299 3300006844 Ga0075428_100014023 Ga0075428_1000140238 89
300 3300006844 Ga0075428_100068180 Ga0075428_1000681803 89
301 3300006847 Ga0075431_100558472 Ga0075431_1005584722 89
302 3300006852 Ga0075433_10444372 Ga0075433_104443722 89
303 3300006881 Ga0068865_100026965 Ga0068865_1000269652 89
304 3300006881 Ga0068865_101627590 Ga0068865_1016275902 89
305 3300006914 Ga0075436_100294019 Ga0075436_1002940192 89
306 3300006931 Ga0097620_100008241 Ga0097620_1000082412 89
307 3300007076 Ga0075435_100149478 Ga0075435_1001494783 89
308 3300007076 Ga0075435_100335239 Ga0075435_1003352392 89
309 3300009036 Ga0105244_10237623 Ga0105244_102376232 89
310 3300009094 Ga0111539_10015164 Ga0111539_100151643 89
311 3300009094 Ga0111539_10480164 Ga0111539_104801642 89
312 3300009098 Ga0105245_10280686 Ga0105245_102806863 89
313 3300009098 Ga0105245_11616373 Ga0105245_116163732 89
314 3300009101 Ga0105247_10172237 Ga0105247_101722372 89
315 3300009147 Ga0114129_10085876 Ga0114129_100858763 89
316 3300009147 Ga0114129_10096952 Ga0114129_100969522 89
317 3300009147 Ga0114129_13273352 Ga0114129_132733521 89
318 3300009148 Ga0105243_10004531 Ga0105243_100045313 89
319 3300009148 Ga0105243_11713333 Ga0105243_117133331 89
320 3300009174 Ga0105241_10206978 Ga0105241_102069782 89
321 3300009174 Ga0105241_10808239 Ga0105241_108082392 89
322 3300009176 Ga0105242_10043927 Ga0105242_100439273 89
323 3300009176 Ga0105242_11042296 Ga0105242_110422962 89
324 3300009545 Ga0105237_10512843 Ga0105237_105128432 89
325 3300009551 Ga0105238_10042511 Ga0105238_100425112 89
326 3300009553 Ga0105249_10034163 Ga0105249_100341632 89
327 3300010375 Ga0105239_10007925 Ga0105239_100079256 89
328 3300010375 Ga0105239_10356053 Ga0105239_103560532 89
329 3300013296 Ga0157374_10494394 Ga0157374_104943942 89
330 3300013297 Ga0157378_10044955 Ga0157378_100449552 89
331 3300013297 Ga0157378_10786702 Ga0157378_107867022 89
332 3300013306 Ga0163162_11317937 Ga0163162_113179372 89
333 3300013306 Ga0163162_12439180 Ga0163162_124391802 89
334 3300013308 Ga0157375_10005306 Ga0157375_100053066 89
335 3300014325 Ga0163163_10256102 Ga0163163_102561022 89
336 3300014326 Ga0157380_10010874 Ga0157380_100108745 89
337 3300014326 Ga0157380_13063648 Ga0157380_130636481 89
338 3300014745 Ga0157377_10001395 Ga0157377_100013952 89
339 3300014968 Ga0157379_10199802 Ga0157379_101998022 89
340 3300014969 Ga0157376_10152748 Ga0157376_101527482 89
341 3300014969 Ga0157376_11697023 Ga0157376_116970232 89
342 3300017792 Ga0163161_10367300 Ga0163161_103673001 89
343 3300025899 Ga0207642_10095290 Ga0207642_100952902 89
344 3300025900 Ga0207710_10281686 Ga0207710_102816862 89
345 3300025901 Ga0207688_10006583 Ga0207688_100065834 89
346 3300025903 Ga0207680_10234063 Ga0207680_102340632 89
347 3300025907 Ga0207645_10281367 Ga0207645_102813672 89
348 3300025907 Ga0207645_10358575 Ga0207645_103585752 89
349 3300025908 Ga0207643_10005791 Ga0207643_100057913 89
350 3300025909 Ga0207705_11425897 Ga0207705_114258972 89
351 3300025910 Ga0207684_10093095 Ga0207684_100930953 89
352 3300025918 Ga0207662_10002007 Ga0207662_100020076 89
353 3300025919 Ga0207657_10130696 Ga0207657_101306963 89
354 3300025920 Ga0207649_10033835 Ga0207649_100338352 89
355 3300025922 Ga0207646_10893190 Ga0207646_108931902 89
356 3300025924 Ga0207694_10327186 Ga0207694_103271862 89
357 3300025926 Ga0207659_10011252 Ga0207659_100112524 89
358 3300025927 Ga0207687_10013365 Ga0207687_100133654 89
359 3300025928 Ga0207700_10843706 Ga0207700_108437062 89
360 3300025931 Ga0207644_10640725 Ga0207644_106407252 89
361 3300025932 Ga0207690_10159860 Ga0207690_101598602 89
362 3300025933 Ga0207706_10009261 Ga0207706_100092612 89
363 3300025934 Ga0207686_10027023 Ga0207686_100270233 89
364 3300025935 Ga0207709_11410295 Ga0207709_114102952 89
365 3300025936 Ga0207670_10009148 Ga0207670_100091483 89
366 3300025937 Ga0207669_10007236 Ga0207669_100072364 89
367 3300025938 Ga0207704_10187856 Ga0207704_101878562 89
368 3300025938 Ga0207704_11666230 Ga0207704_116662301 89
369 3300025940 Ga0207691_10074397 Ga0207691_100743973 89
370 3300025942 Ga0207689_10971107 Ga0207689_109711072 89
371 3300025944 Ga0207661_10076129 Ga0207661_100761293 89
372 3300025945 Ga0207679_10766630 Ga0207679_107666302 89
373 3300025949 Ga0207667_10413031 Ga0207667_104130312 89
374 3300025960 Ga0207651_11037923 Ga0207651_110379232 89
375 3300025961 Ga0207712_10315461 Ga0207712_103154612 89
376 3300025972 Ga0207668_10037695 Ga0207668_100376952 89
377 3300025981 Ga0207640_10573815 Ga0207640_105738151 89
378 3300026023 Ga0207677_10463252 Ga0207677_104632521 89
379 3300026035 Ga0207703_10023793 Ga0207703_100237935 89
380 3300026041 Ga0207639_10036829 Ga0207639_100368292 89
381 3300026067 Ga0207678_10040635 Ga0207678_100406352 89
382 3300026075 Ga0207708_10005128 Ga0207708_100051287 89
383 3300026075 Ga0207708_11229943 Ga0207708_112299432 89
384 3300026078 Ga0207702_11814965 Ga0207702_118149652 89
385 3300026088 Ga0207641_11006392 Ga0207641_110063922 89
386 3300026089 Ga0207648_10003076 Ga0207648_1000307616 89
387 3300026089 Ga0207648_11686425 Ga0207648_116864252 89
388 3300026116 Ga0207674_10118514 Ga0207674_101185142 89
389 3300026118 Ga0207675_100279821 Ga0207675_1002798212 89
390 3300026118 Ga0207675_100326936 Ga0207675_1003269362 89
391 3300026142 Ga0207698_10475127 Ga0207698_104751272 89
392 3300027395 Ga0209996_1066190 Ga0209996_10661902 89
393 3300027552 Ga0209982_1070386 Ga0209982_10703862 89
394 3300027907 Ga0207428_10076747 Ga0207428_100767473 89
395 3300027907 Ga0207428_10889192 Ga0207428_108891922 89
396 3300028379 Ga0268266_10380107 Ga0268266_103801072 89
397 3300028379 Ga0268266_11273094 Ga0268266_112730942 89
398 3300028380 Ga0268265_11344960 Ga0268265_113449602 89
399 3300028381 Ga0268264_10043072 Ga0268264_100430723 89
400 3300035088 Ga0373940_0129800 Ga0373940_0129800_135_443 89
401 3300035090 Ga0373949_0014272 Ga0373949_0014272_75_344 89
402 3300035115 Ga0373941_0023663 Ga0373941_0023663_769_1038 89
403 3300035121 Ga0373960_0094273 Ga0373960_0094273_467_736 89
404 3300035170 Ga0373943_0311396 Ga0373943_0311396_117_386 89
405 3300035241 Ga0373961_0204054 Ga0373961_0204054_274_543 89
406 3300035242 Ga0373962_0213556 Ga0373962_0213556_37_306 89
407 3300035691 Ga0373931_0023515 Ga0373931_0023515_2234_2503 89
408 3300035725 Ga0373947_0986234 Ga0373947_0986234_88_357 89
409 3300036401 Ga0373937_1038672 Ga0373937_1038672_67_357 89
410 3300041411 Ga0439466_0083662 Ga0439466_0083662_382_687 89
411 3300041512 Ga0451853_0655649 Ga0451853_0655649_223_495 89
412 3300041997 Ga0439431_0037805 Ga0439431_0037805_676_981 89
413 3300046500 Ga0495596_0319320 Ga0495596_0319320_89_379 89
414 3300046517 Ga0495630_0110142 Ga0495630_0110142_1521_1790 89
415 3300046517 Ga0495630_0773744 Ga0495630_0773744_153_458 89
416 3300046517 Ga0495630_0890336 Ga0495630_0890336_375_665 89
417 3300046523 Ga0495644_0145195 Ga0495644_0145195_72_362 89
418 3300046529 Ga0495652_0361154 Ga0495652_0361154_665_934 89
419 3300046536 Ga0495587_0792606 Ga0495587_0792606_208_498 89
420 3300046558 Ga0495633_0303552 Ga0495633_0303552_389_679 89
421 3300046615 Ga0495656_0138165 Ga0495656_0138165_383_673 89
422 3300046675 Ga0495657_0461483 Ga0495657_0461483_283_552 89
423 3300046675 Ga0495657_0556702 Ga0495657_0556702_337_627 89
424 3300046678 Ga0495599_0342531 Ga0495599_0342531_102_371 89
425 3300046681 Ga0495647_0076008 Ga0495647_0076008_652_957 89
426 3300047315 Ga0495581_0740938 Ga0495581_0740938_83_385 89
427 3300047322 Ga0495680_0346872 Ga0495680_0346872_367_657 89
428 3300047471 Ga0495684_0728438 Ga0495684_0728438_129_419 89
429 3300048088 Ga0495602_0339089 Ga0495602_0339089_129_419 89
430 3300048088 Ga0495602_0439083 Ga0495602_0439083_499_789 89
431 3300048903 Ga0496100_1509947 Ga0496100_1509947_143_451 89
432 3300048904 Ga0496101_0273733 Ga0496101_0273733_715_984 89
433 3300048905 Ga0496102_0007949 Ga0496102_0007949_73_360 89
434 3300048905 Ga0496102_0433857 Ga0496102_0433857_896_1204 89
435 3300048905 Ga0496102_0644723 Ga0496102_0644723_351_620 89
436 3300048906 Ga0496103_0045104 Ga0496103_0045104_308_595 89
437 3300048906 Ga0496103_0258174 Ga0496103_0258174_712_1020 89
438 3300048907 Ga0496104_0913355 Ga0496104_0913355_210_518 89
439 3300048909 Ga0496106_0132372 Ga0496106_0132372_1237_1506 89
440 3300048909 Ga0496106_1268846 Ga0496106_1268846_172_459 89
441 3300048910 Ga0496107_0113233 Ga0496107_0113233_1565_1834 89
442 3300048911 Ga0496108_0018247 Ga0496108_0018247_533_802 89
443 3300048911 Ga0496108_1178385 Ga0496108_1178385_26_334 89
444 3300048912 Ga0496109_0007211 Ga0496109_0007211_3933_4202 89
445 3300048912 Ga0496109_0100184 Ga0496109_0100184_1582_1866 89
446 3300048913 Ga0496110_0044652 Ga0496110_0044652_3538_3807 89
447 3300048913 Ga0496110_1327254 Ga0496110_1327254_139_420 89
448 3300048914 Ga0496111_0018696 Ga0496111_0018696_657_926 89
449 3300048915 Ga0496112_0205039 Ga0496112_0205039_106_375 89
450 3300048916 Ga0496113_0390945 Ga0496113_0390945_221_490 89
451 3300049568 Ga0501031_0070347 Ga0501031_0070347_435_725 89
452 3300049568 Ga0501031_0194029 Ga0501031_0194029_819_1115 89
453 3300049569 Ga0501032_0272368 Ga0501032_0272368_182_472 89
454 3300049572 Ga0501036_0015936 Ga0501036_0015936_94_384 89
455 3300049573 Ga0501037_0240405 Ga0501037_0240405_889_1179 89
456 3300049575 Ga0501039_0343470 Ga0501039_0343470_303_593 89
457 3300049575 Ga0501039_0365055 Ga0501039_0365055_478_774 89
458 3300049576 Ga0501040_0030658 Ga0501040_0030658_962_1252 89
459 3300049577 Ga0501041_0017737 Ga0501041_0017737_1277_1567 89
460 3300049577 Ga0501041_0233188 Ga0501041_0233188_675_971 89
461 3300049578 Ga0501042_0127906 Ga0501042_0127906_658_954 89
462 3300049579 Ga0501043_0473876 Ga0501043_0473876_574_870 89
463 3300049580 Ga0501046_0362412 Ga0501046_0362412_429_725 89
464 3300049582 Ga0501048_0071458 Ga0501048_0071458_570_860 89
465 3300049582 Ga0501048_0952467 Ga0501048_0952467_265_555 89
466 3300049582 Ga0501048_1340460 Ga0501048_1340460_19_315 89
467 3300049583 Ga0501067_0049719 Ga0501067_0049719_2005_2313 89
468 3300049585 Ga0501069_0129794 Ga0501069_0129794_506_796 89
469 3300049587 Ga0501071_0161569 Ga0501071_0161569_76_366 89
470 3300049587 Ga0501071_0269980 Ga0501071_0269980_45_341 89
471 3300049588 Ga0501072_0082696 Ga0501072_0082696_767_1057 89
472 3300049589 Ga0501073_0915181 Ga0501073_0915181_235_531 89
473 3300049589 Ga0501073_0928436 Ga0501073_0928436_72_362 89
474 3300049590 Ga0501074_0076267 Ga0501074_0076267_316_606 89
475 3300049591 Ga0501075_0056751 Ga0501075_0056751_1494_1784 89
476 3300049592 Ga0501076_0015705 Ga0501076_0015705_4159_4449 89
477 3300049592 Ga0501076_0156199 Ga0501076_0156199_574_870 89
478 3300049592 Ga0501076_1049215 Ga0501076_1049215_233_523 89
479 3300049593 Ga0501077_0320945 Ga0501077_0320945_334_630 89
480 3300049741 Ga0501079_0039886 Ga0501079_0039886_534_824 89
481 3300049741 Ga0501079_0080908 Ga0501079_0080908_382_678 89
482 3300049741 Ga0501079_0432423 Ga0501079_0432423_674_970 89
483 3300049742 Ga0501080_0183976 Ga0501080_0183976_316_612 89
484 3300049742 Ga0501080_0400947 Ga0501080_0400947_778_1074 89
485 3300049742 Ga0501080_1042216 Ga0501080_1042216_337_627 89
486 3300049744 Ga0501083_0384463 Ga0501083_0384463_457_747 89
487 3300049822 Ga0501035_0502022 Ga0501035_0502022_24_314 89
488 3300049823 Ga0501044_0620587 Ga0501044_0620587_362_652 89
489 3300049824 Ga0501045_0150499 Ga0501045_0150499_848_1138 89
490 3300049824 Ga0501045_0208339 Ga0501045_0208339_630_926 89
491 3300050507 nmdc:mga05p37_1204194_c1 nmdc:mga05p37_1204194_c1_363_653 89
492 3300050507 nmdc:mga05p37_1736_c1 nmdc:mga05p37_1736_c1_20828_21118 89
493 3300050507 nmdc:mga05p37_498604_c1 nmdc:mga05p37_498604_c1_738_1007 89
494 3300050510 nmdc:mga06r32_497598_c1 nmdc:mga06r32_497598_c1_361_651 89
495 3300050511 nmdc:mga08y16_54535_c1 nmdc:mga08y16_54535_c1_2941_3210 89
496 3300050511 nmdc:mga08y16_66343_c1 nmdc:mga08y16_66343_c1_288_557 89
497 3300050512 nmdc:mga0n895_473051_c1 nmdc:mga0n895_473051_c1_622_891 89
498 3300050512 nmdc:mga0n895_684442_c1 nmdc:mga0n895_684442_c1_476_784 89
499 3300050513 nmdc:mga0rr50_138251_c1 nmdc:mga0rr50_138251_c1_1104_1373 89
500 3300050513 nmdc:mga0rr50_799924_c1 nmdc:mga0rr50_799924_c1_328_630 89
501 3300050514 nmdc:mga08x19_319388_c1 nmdc:mga08x19_319388_c1_455_763 89
502 3300050515 nmdc:mga0a205_186896_c1 nmdc:mga0a205_186896_c1_145_414 89
503 3300050515 nmdc:mga0a205_220328_c1 nmdc:mga0a205_220328_c1_1081_1350 89
504 3300053084 Ga0495595_0019461 Ga0495595_0019461_702_992 89
505 3300053085 Ga0495619_0497638 Ga0495619_0497638_537_827 89
506 3300053085 Ga0495619_0650061 Ga0495619_0650061_334_624 89
507 3300053085 Ga0495619_0713502 Ga0495619_0713502_176_445 89
508 3300054114 Ga0501084_0351886 Ga0501084_0351886_797_1087 89
509 3300054114 Ga0501084_0527580 Ga0501084_0527580_522_818 89
510 3300054114 Ga0501084_0676505 Ga0501084_0676505_166_456 89
511 3300054114 Ga0501084_1402962 Ga0501084_1402962_77_367 89
512 3300060353 Ga0501082_0307098 Ga0501082_0307098_735_1031 89
513 3300060353 Ga0501082_0644496 Ga0501082_0644496_37_327 89
514 3300060353 Ga0501082_0718973 Ga0501082_0718973_394_684 89
515 3300060353 Ga0501082_1002229 Ga0501082_1002229_185_475 89
516 3300061734 Ga0530510_0105435 Ga0530510_0105435_419_709 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

5

73

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vq3-assembly1.cif.gz_C crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution 0.6008 2 82
3d54-assembly1.cif.gz_J structure of purlqs from thermotoga maritima 0.5959 1 82
3d54-assembly1.cif.gz_J structure of purlqs from thermotoga maritima 0.5895 1 82
1vq3-assembly1.cif.gz_C crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution 0.5585 2 82
2zw2-assembly1.cif.gz_B crystal structure of formylglycinamide ribonucleotide amidotransferase iii from sulfolobus tokodaii (stpurs) 0.5482 2 84
ID Description Score Start End Superfamily
af_D4A898_18_102_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.717 40 70 3.30.310.10
3d54J00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.5959 1 82 3.30.1280.10
3d54J00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.5895 1 82 3.30.1280.10
af_P32152_451_581_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.5595 38 72 3.40.930.10
2cyyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.5535 5 86 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A2E0J134-F1-model_v4 Uncharacterized protein 0.6715 2 84
AF-A0A2M6YX65-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.6206 1 83 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A318R0V5-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.6203 1 88 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A538AKK5-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.6183 2 87 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A2S5E9K4-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.6158 2 83 GO:0004642
GO:0005524
GO:0005737
GO:0006189

Feature Viewer

pLDDT pTM Quality
82.5 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map