F457965
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 516 | 302 | 516 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100774492|Ga0070713_1007744921 |
| Length | 257 |
| Sequence | MKQKPMSDKTIERLLYLVSPIGLLILWQLLLMAGFGDRRFIPAPSDIAVRFVQMIGSGELALHTAVTLWRIAAGYVIGAVPAVAVGLLMAMFRPVRLFFDPLIAALFPIPKVALMPLLLLAFGFGDASKIALVAIAVFFPVIVNTYVGAANIDKIYWDVARNYGASQTVLFTRIVFFGALPMIFAGLRIALAVSFIVLVAAEFVATKAGIGYLIWNSWELLQVDVMFVGIVTIGILGLISSALFQEIERKVIPWKGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 297 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 299 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.14 |
| Nodule | 0 |
| Rhizoplane | 12.98 |
| Rhizosphere | 76.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002172 | 3300001976 | Bacteria | 2621 |
| 2 | JGI24750J21931_1002705 | 3300002070 | Bacteria | 2127 |
| 3 | JGI24745J21846_1000482 | 3300002073 | Bacteria | 3543 |
| 4 | JGI24748J21848_1005378 | 3300002074 | Bacteria | 1485 |
| 5 | JGI24033J26618_1001870 | 3300002155 | Bacteria | 2107 |
| 6 | JGI24742J22300_10001734 | 3300002244 | Bacteria | 3472 |
| 7 | JGI25406J46586_10024782 | 3300003203 | Bacteria | 2344 |
| 8 | JGI25153J46596_10002988 | 3300003215 | Bacteria | 9569 |
| 9 | JGI25405J52794_10038742 | 3300003911 | Bacteria | 1004 |
| 10 | Ga0070658_10724690 | 3300005327 | Bacteria | 863 |
| 11 | Ga0070683_100595713 | 3300005329 | Bacteria | 1058 |
| 12 | Ga0070690_100101341 | 3300005330 | Bacteria | 1910 |
| 13 | Ga0070690_100403347 | 3300005330 | Bacteria | 1004 |
| 14 | Ga0070670_100070279 | 3300005331 | Bacteria | 3006 |
| 15 | Ga0070670_100158450 | 3300005331 | Bacteria | 1961 |
| 16 | Ga0068869_100047516 | 3300005334 | Bacteria | 3100 |
| 17 | Ga0068869_100151529 | 3300005334 | Bacteria | 1799 |
| 18 | Ga0070666_10089060 | 3300005335 | Bacteria | 2118 |
| 19 | Ga0070666_10180100 | 3300005335 | Bacteria | 1482 |
| 20 | Ga0070682_100246467 | 3300005337 | Bacteria | 1286 |
| 21 | Ga0068868_100010725 | 3300005338 | Bacteria | 6642 |
| 22 | Ga0070689_100005881 | 3300005340 | Bacteria | 8432 |
| 23 | Ga0070689_100012062 | 3300005340 | Bacteria | 6212 |
| 24 | Ga0070687_100009448 | 3300005343 | Bacteria | 4180 |
| 25 | Ga0070687_100191860 | 3300005343 | Bacteria | 1232 |
| 26 | Ga0070692_10170096 | 3300005345 | Bacteria | 1255 |
| 27 | Ga0070668_100081158 | 3300005347 | Bacteria | 2542 |
| 28 | Ga0070675_100036033 | 3300005354 | Bacteria | 4024 |
| 29 | Ga0070671_100012193 | 3300005355 | Bacteria | 6918 |
| 30 | Ga0070674_100019589 | 3300005356 | Bacteria | 4302 |
| 31 | Ga0070674_100107147 | 3300005356 | Bacteria | 2046 |
| 32 | Ga0070673_100341047 | 3300005364 | Bacteria | 1328 |
| 33 | Ga0070673_100376826 | 3300005364 | Bacteria | 1264 |
| 34 | Ga0070688_100009968 | 3300005365 | Bacteria | 5221 |
| 35 | Ga0070688_100037269 | 3300005365 | Bacteria | 2962 |
| 36 | Ga0070688_100287503 | 3300005365 | Bacteria | 1184 |
| 37 | Ga0070659_100089447 | 3300005366 | Bacteria | 2466 |
| 38 | Ga0070667_100032811 | 3300005367 | Bacteria | 4333 |
| 39 | Ga0070667_100209504 | 3300005367 | Bacteria | 1732 |
| 40 | Ga0070703_10098719 | 3300005406 | Bacteria | 1026 |
| 41 | Ga0070713_100109688 | 3300005436 | Bacteria | 2405 |
| 42 | Ga0070713_100774492 | 3300005436 | Bacteria | 919 |
| 43 | Ga0070710_10519587 | 3300005437 | Bacteria | 818 |
| 44 | Ga0070701_10007970 | 3300005438 | Bacteria | 4557 |
| 45 | Ga0070711_100090313 | 3300005439 | Bacteria | 2206 |
| 46 | Ga0070705_100204827 | 3300005440 | Bacteria | 1355 |
| 47 | Ga0070700_100002888 | 3300005441 | Bacteria | 8828 |
| 48 | Ga0070700_100236685 | 3300005441 | Bacteria | 1302 |
| 49 | Ga0070663_100734243 | 3300005455 | Bacteria | 842 |
| 50 | Ga0070678_100109757 | 3300005456 | Bacteria | 2156 |
| 51 | Ga0068867_100027139 | 3300005459 | Bacteria | 4114 |
| 52 | Ga0070685_10006217 | 3300005466 | Bacteria | 6081 |
| 53 | Ga0070685_10319252 | 3300005466 | Bacteria | 1052 |
| 54 | Ga0070698_100492348 | 3300005471 | Bacteria | 1163 |
| 55 | Ga0070679_100051306 | 3300005530 | Bacteria | 4108 |
| 56 | Ga0070672_100011894 | 3300005543 | Bacteria | 6083 |
| 57 | Ga0070672_100116840 | 3300005543 | Bacteria | 2180 |
| 58 | Ga0070686_100008164 | 3300005544 | Bacteria | 5858 |
| 59 | Ga0070695_100315837 | 3300005545 | Bacteria | 1160 |
| 60 | Ga0070693_100041984 | 3300005547 | Bacteria | 2576 |
| 61 | Ga0070693_100136449 | 3300005547 | Bacteria | 1540 |
| 62 | Ga0070665_100176923 | 3300005548 | Bacteria | 2135 |
| 63 | Ga0070664_100009753 | 3300005564 | Bacteria | 7783 |
| 64 | Ga0068857_100213829 | 3300005577 | Bacteria | 1760 |
| 65 | Ga0068854_100014771 | 3300005578 | Bacteria | 5155 |
| 66 | Ga0068854_100612495 | 3300005578 | Bacteria | 931 |
| 67 | Ga0068856_100046810 | 3300005614 | Bacteria | 4260 |
| 68 | Ga0070702_100274246 | 3300005615 | Bacteria | 1155 |
| 69 | Ga0068852_100746878 | 3300005616 | Unclassified | 990 |
| 70 | Ga0068859_100076334 | 3300005617 | Bacteria | 3391 |
| 71 | Ga0068859_100440603 | 3300005617 | Bacteria | 1399 |
| 72 | Ga0068859_100477936 | 3300005617 | Bacteria | 1341 |
| 73 | Ga0068859_100512544 | 3300005617 | Bacteria | 1294 |
| 74 | Ga0068864_100015532 | 3300005618 | Bacteria | 6331 |
| 75 | Ga0068866_10015228 | 3300005718 | Bacteria | 3413 |
| 76 | Ga0068851_10019357 | 3300005834 | Bacteria | 3288 |
| 77 | Ga0068870_10008699 | 3300005840 | Bacteria | 4577 |
| 78 | Ga0068870_10162445 | 3300005840 | Bacteria | 1326 |
| 79 | Ga0068863_100073949 | 3300005841 | Bacteria | 3224 |
| 80 | Ga0068863_100514457 | 3300005841 | Bacteria | 1180 |
| 81 | Ga0068858_100012156 | 3300005842 | Bacteria | 8117 |
| 82 | Ga0068860_100077696 | 3300005843 | Bacteria | 3157 |
| 83 | Ga0068862_100027550 | 3300005844 | Bacteria | 4783 |
| 84 | Ga0068862_100240800 | 3300005844 | Bacteria | 1645 |
| 85 | Ga0068862_100366592 | 3300005844 | Bacteria | 1340 |
| 86 | Ga0068862_100475630 | 3300005844 | Bacteria | 1182 |
| 87 | Ga0081455_10006523 | 3300005937 | Bacteria | 12495 |
| 88 | Ga0081455_10012142 | 3300005937 | Bacteria | 8607 |
| 89 | Ga0081455_10041860 | 3300005937 | Bacteria | 4024 |
| 90 | Ga0081455_10117503 | 3300005937 | Bacteria | 2102 |
| 91 | Ga0081538_10052543 | 3300005981 | Bacteria | 2433 |
| 92 | Ga0081538_10074182 | 3300005981 | Bacteria | 1853 |
| 93 | Ga0081540_1000002 | 3300005983 | Bacteria | 251149 |
| 94 | Ga0081540_1013123 | 3300005983 | Bacteria | 5409 |
| 95 | Ga0081540_1065235 | 3300005983 | Bacteria | 1713 |
| 96 | Ga0081539_10000785 | 3300005985 | Bacteria | 61844 |
| 97 | Ga0081539_10041457 | 3300005985 | Bacteria | 2690 |
| 98 | Ga0070717_10245942 | 3300006028 | Bacteria | 1579 |
| 99 | Ga0075365_10012280 | 3300006038 | Bacteria | 5078 |
| 100 | Ga0075365_10038149 | 3300006038 | Bacteria | 3121 |
| 101 | Ga0075365_10150366 | 3300006038 | Bacteria | 1620 |
| 102 | Ga0075365_10180645 | 3300006038 | Bacteria | 1475 |
| 103 | Ga0075365_10201998 | 3300006038 | Bacteria | 1392 |
| 104 | Ga0075365_10264076 | 3300006038 | Bacteria | 1210 |
| 105 | Ga0075365_10346451 | 3300006038 | Bacteria | 1047 |
| 106 | Ga0075368_10057050 | 3300006042 | Bacteria | 1558 |
| 107 | Ga0075364_10131578 | 3300006051 | Bacteria | 1679 |
| 108 | Ga0075364_10162118 | 3300006051 | Bacteria | 1509 |
| 109 | Ga0070715_10099074 | 3300006163 | Bacteria | 1356 |
| 110 | Ga0070715_10175463 | 3300006163 | Bacteria | 1071 |
| 111 | Ga0070716_100076413 | 3300006173 | Bacteria | 1985 |
| 112 | Ga0070716_100472680 | 3300006173 | Bacteria | 919 |
| 113 | Ga0070712_100043732 | 3300006175 | Bacteria | 3085 |
| 114 | Ga0070712_100147369 | 3300006175 | Bacteria | 1803 |
| 115 | Ga0070712_100602865 | 3300006175 | Bacteria | 930 |
| 116 | Ga0075362_10088795 | 3300006177 | Bacteria | 1432 |
| 117 | Ga0075362_10098134 | 3300006177 | Bacteria | 1367 |
| 118 | Ga0075362_10130640 | 3300006177 | Bacteria | 1194 |
| 119 | Ga0075367_10053359 | 3300006178 | Bacteria | 2395 |
| 120 | Ga0075367_10126105 | 3300006178 | Bacteria | 1580 |
| 121 | Ga0075367_10258647 | 3300006178 | Bacteria | 1092 |
| 122 | Ga0075367_10308572 | 3300006178 | Bacteria | 996 |
| 123 | Ga0075366_10000736 | 3300006195 | Bacteria | 15582 |
| 124 | Ga0075366_10048049 | 3300006195 | Bacteria | 2530 |
| 125 | Ga0097621_100086658 | 3300006237 | Bacteria | 2614 |
| 126 | Ga0097621_100191249 | 3300006237 | Bacteria | 1772 |
| 127 | Ga0097621_100525847 | 3300006237 | Bacteria | 1074 |
| 128 | Ga0075370_10152274 | 3300006353 | Bacteria | 1355 |
| 129 | Ga0068871_100095019 | 3300006358 | Bacteria | 2489 |
| 130 | Ga0068871_100385224 | 3300006358 | Bacteria | 1246 |
| 131 | Ga0068871_100404115 | 3300006358 | Bacteria | 1217 |
| 132 | Ga0075428_100104592 | 3300006844 | Bacteria | 3087 |
| 133 | Ga0075428_100137078 | 3300006844 | Bacteria | 2661 |
| 134 | Ga0075428_100287038 | 3300006844 | Bacteria | 1770 |
| 135 | Ga0075430_100207164 | 3300006846 | Bacteria | 1627 |
| 136 | Ga0075431_100191821 | 3300006847 | Bacteria | 2093 |
| 137 | Ga0075431_100401633 | 3300006847 | Bacteria | 1371 |
| 138 | Ga0075433_10027293 | 3300006852 | Bacteria | 4840 |
| 139 | Ga0075434_100266037 | 3300006871 | Bacteria | 1734 |
| 140 | Ga0075429_100291566 | 3300006880 | Bacteria | 1428 |
| 141 | Ga0068865_100020686 | 3300006881 | Bacteria | 4270 |
| 142 | Ga0068865_100676363 | 3300006881 | Bacteria | 880 |
| 143 | Ga0097620_100076336 | 3300006931 | Bacteria | 3391 |
| 144 | Ga0097620_100440512 | 3300006931 | Bacteria | 1399 |
| 145 | Ga0097620_100477942 | 3300006931 | Bacteria | 1341 |
| 146 | Ga0097620_100512562 | 3300006931 | Bacteria | 1294 |
| 147 | Ga0099794_10041496 | 3300007265 | Bacteria | 2191 |
| 148 | Ga0099795_10000869 | 3300007788 | Bacteria | 6050 |
| 149 | Ga0099795_10002805 | 3300007788 | Bacteria | 4195 |
| 150 | Ga0099795_10012379 | 3300007788 | Bacteria | 2585 |
| 151 | Ga0099795_10185380 | 3300007788 | Bacteria | 871 |
| 152 | Ga0105250_10120802 | 3300009092 | Bacteria | 1077 |
| 153 | Ga0111539_10223206 | 3300009094 | Bacteria | 2194 |
| 154 | Ga0105245_10001109 | 3300009098 | Bacteria | 24346 |
| 155 | Ga0105245_10202149 | 3300009098 | Bacteria | 1908 |
| 156 | Ga0105247_10149586 | 3300009101 | Bacteria | 1537 |
| 157 | Ga0105247_10348649 | 3300009101 | Bacteria | 1041 |
| 158 | Ga0105247_10362320 | 3300009101 | Bacteria | 1023 |
| 159 | Ga0114129_10081766 | 3300009147 | Bacteria | 4490 |
| 160 | Ga0114129_10108303 | 3300009147 | Bacteria | 3836 |
| 161 | Ga0114129_10221714 | 3300009147 | Bacteria | 2550 |
| 162 | Ga0114129_10383522 | 3300009147 | Bacteria | 1855 |
| 163 | Ga0105243_10229254 | 3300009148 | Bacteria | 1647 |
| 164 | Ga0105243_10793805 | 3300009148 | Bacteria | 932 |
| 165 | Ga0105241_10289423 | 3300009174 | Bacteria | 1402 |
| 166 | Ga0105242_10035307 | 3300009176 | Bacteria | 4009 |
| 167 | Ga0105242_10055767 | 3300009176 | Bacteria | 3233 |
| 168 | Ga0105242_10862992 | 3300009176 | Bacteria | 902 |
| 169 | Ga0105248_10024108 | 3300009177 | Bacteria | 6762 |
| 170 | Ga0105248_10090827 | 3300009177 | Bacteria | 3439 |
| 171 | Ga0105237_10323295 | 3300009545 | Bacteria | 1546 |
| 172 | Ga0105238_10185061 | 3300009551 | Bacteria | 2059 |
| 173 | Ga0105238_10510100 | 3300009551 | Bacteria | 1204 |
| 174 | Ga0105249_10111981 | 3300009553 | Bacteria | 2581 |
| 175 | Ga0105249_10449039 | 3300009553 | Bacteria | 1328 |
| 176 | Ga0105249_10838463 | 3300009553 | Bacteria | 984 |
| 177 | Ga0105239_10918939 | 3300010375 | Bacteria | 1005 |
| 178 | Ga0157374_10032645 | 3300013296 | Bacteria | 4742 |
| 179 | Ga0157378_10109432 | 3300013297 | Bacteria | 2531 |
| 180 | Ga0157378_10534137 | 3300013297 | Bacteria | 1176 |
| 181 | Ga0157378_10695375 | 3300013297 | Bacteria | 1036 |
| 182 | Ga0163162_10057629 | 3300013306 | Bacteria | 3913 |
| 183 | Ga0163162_10513206 | 3300013306 | Bacteria | 1328 |
| 184 | Ga0157372_10178951 | 3300013307 | Bacteria | 2455 |
| 185 | Ga0157375_10034942 | 3300013308 | Bacteria | 4793 |
| 186 | Ga0157375_10770099 | 3300013308 | Bacteria | 1113 |
| 187 | Ga0163163_10077687 | 3300014325 | Bacteria | 3315 |
| 188 | Ga0163163_10149460 | 3300014325 | Bacteria | 2380 |
| 189 | Ga0163163_10407057 | 3300014325 | Bacteria | 1419 |
| 190 | Ga0163163_10797550 | 3300014325 | Bacteria | 1008 |
| 191 | Ga0163163_11244006 | 3300014325 | Bacteria | 807 |
| 192 | Ga0157380_10308184 | 3300014326 | Bacteria | 1462 |
| 193 | Ga0157379_10070381 | 3300014968 | Bacteria | 3130 |
| 194 | Ga0157376_10077266 | 3300014969 | Bacteria | 2847 |
| 195 | Ga0157376_10664102 | 3300014969 | Bacteria | 1044 |
| 196 | Ga0163161_10031787 | 3300017792 | Bacteria | 3763 |
| 197 | Ga0213872_10135504 | 3300021361 | Bacteria | 1083 |
| 198 | Ga0213876_10232964 | 3300021384 | Bacteria | 979 |
| 199 | Ga0213876_10262658 | 3300021384 | Unclassified | 917 |
| 200 | Ga0224572_1003138 | 3300024225 | Bacteria | 2764 |
| 201 | Ga0209758_1000669 | 3300025297 | Bacteria | 51286 |
| 202 | Ga0207697_10084983 | 3300025315 | Bacteria | 1336 |
| 203 | Ga0207656_10011934 | 3300025321 | Bacteria | 3294 |
| 204 | Ga0207682_10051692 | 3300025893 | Bacteria | 1702 |
| 205 | Ga0207692_10037952 | 3300025898 | Bacteria | 2359 |
| 206 | Ga0207642_10028785 | 3300025899 | Bacteria | 2292 |
| 207 | Ga0207710_10256065 | 3300025900 | Bacteria | 876 |
| 208 | Ga0207688_10001397 | 3300025901 | Bacteria | 12574 |
| 209 | Ga0207688_10087273 | 3300025901 | Bacteria | 1788 |
| 210 | Ga0207680_10291286 | 3300025903 | Bacteria | 1136 |
| 211 | Ga0207680_10424909 | 3300025903 | Bacteria | 941 |
| 212 | Ga0207645_10008224 | 3300025907 | Bacteria | 7296 |
| 213 | Ga0207643_10002323 | 3300025908 | Bacteria | 10345 |
| 214 | Ga0207643_10083299 | 3300025908 | Bacteria | 1855 |
| 215 | Ga0207705_10072088 | 3300025909 | Bacteria | 2505 |
| 216 | Ga0207654_10035548 | 3300025911 | Bacteria | 2777 |
| 217 | Ga0207693_10025550 | 3300025915 | Bacteria | 4682 |
| 218 | Ga0207693_10267506 | 3300025915 | Bacteria | 1340 |
| 219 | Ga0207663_10075467 | 3300025916 | Bacteria | 2188 |
| 220 | Ga0207663_10283684 | 3300025916 | Bacteria | 1231 |
| 221 | Ga0207662_10001015 | 3300025918 | Bacteria | 13138 |
| 222 | Ga0207662_10069116 | 3300025918 | Bacteria | 2134 |
| 223 | Ga0207657_10009994 | 3300025919 | Bacteria | 9497 |
| 224 | Ga0207652_10080944 | 3300025921 | Bacteria | 2840 |
| 225 | Ga0207694_10028341 | 3300025924 | Bacteria | 4269 |
| 226 | Ga0207694_10426427 | 3300025924 | Bacteria | 1105 |
| 227 | Ga0207650_10045304 | 3300025925 | Bacteria | 3236 |
| 228 | Ga0207650_10494372 | 3300025925 | Bacteria | 1022 |
| 229 | Ga0207659_10015880 | 3300025926 | Bacteria | 4892 |
| 230 | Ga0207659_10052138 | 3300025926 | Bacteria | 2913 |
| 231 | Ga0207687_10039544 | 3300025927 | Bacteria | 3230 |
| 232 | Ga0207687_10293700 | 3300025927 | Bacteria | 1307 |
| 233 | Ga0207687_10441343 | 3300025927 | Bacteria | 1078 |
| 234 | Ga0207700_10349843 | 3300025928 | Bacteria | 1287 |
| 235 | Ga0207644_10174608 | 3300025931 | Bacteria | 1680 |
| 236 | Ga0207644_10213698 | 3300025931 | Bacteria | 1526 |
| 237 | Ga0207644_10270916 | 3300025931 | Bacteria | 1360 |
| 238 | Ga0207706_10018825 | 3300025933 | Bacteria | 6210 |
| 239 | Ga0207686_10035638 | 3300025934 | Bacteria | 2988 |
| 240 | Ga0207709_10011693 | 3300025935 | Bacteria | 4840 |
| 241 | Ga0207709_10100357 | 3300025935 | Bacteria | 1912 |
| 242 | Ga0207670_10005305 | 3300025936 | Bacteria | 7060 |
| 243 | Ga0207670_10013634 | 3300025936 | Bacteria | 4799 |
| 244 | Ga0207704_10006351 | 3300025938 | Bacteria | 5507 |
| 245 | Ga0207704_10636328 | 3300025938 | Bacteria | 877 |
| 246 | Ga0207691_10007276 | 3300025940 | Bacteria | 10676 |
| 247 | Ga0207711_10015614 | 3300025941 | Bacteria | 6300 |
| 248 | Ga0207689_10002382 | 3300025942 | Bacteria | 17544 |
| 249 | Ga0207689_10025175 | 3300025942 | Bacteria | 4988 |
| 250 | Ga0207661_10241731 | 3300025944 | Bacteria | 1602 |
| 251 | Ga0207679_10048595 | 3300025945 | Bacteria | 3090 |
| 252 | Ga0207679_10835009 | 3300025945 | Bacteria | 841 |
| 253 | Ga0207651_10244315 | 3300025960 | Bacteria | 1465 |
| 254 | Ga0207668_10069387 | 3300025972 | Bacteria | 2509 |
| 255 | Ga0207640_10049873 | 3300025981 | Bacteria | 2712 |
| 256 | Ga0207658_10023867 | 3300025986 | Bacteria | 4273 |
| 257 | Ga0207658_10263156 | 3300025986 | Bacteria | 1471 |
| 258 | Ga0207677_10006221 | 3300026023 | Bacteria | 6527 |
| 259 | Ga0207703_10003777 | 3300026035 | Bacteria | 12589 |
| 260 | Ga0207639_10521650 | 3300026041 | Bacteria | 1088 |
| 261 | Ga0207678_10047857 | 3300026067 | Bacteria | 3697 |
| 262 | Ga0207678_10123031 | 3300026067 | Bacteria | 2214 |
| 263 | Ga0207708_10000538 | 3300026075 | Bacteria | 29294 |
| 264 | Ga0207702_10023134 | 3300026078 | Bacteria | 5154 |
| 265 | Ga0207641_10800622 | 3300026088 | Bacteria | 932 |
| 266 | Ga0207648_10010145 | 3300026089 | Bacteria | 8957 |
| 267 | Ga0207676_10016680 | 3300026095 | Bacteria | 5319 |
| 268 | Ga0207676_10120772 | 3300026095 | Bacteria | 2209 |
| 269 | Ga0207674_10022628 | 3300026116 | Bacteria | 6746 |
| 270 | Ga0207674_10161272 | 3300026116 | Bacteria | 2196 |
| 271 | Ga0207675_100007644 | 3300026118 | Bacteria | 10207 |
| 272 | Ga0207683_10023729 | 3300026121 | Bacteria | 5277 |
| 273 | Ga0207683_10115505 | 3300026121 | Bacteria | 2406 |
| 274 | Ga0207698_10002575 | 3300026142 | Bacteria | 10769 |
| 275 | Ga0209179_1004188 | 3300027512 | Bacteria | 2157 |
| 276 | Ga0209179_1030899 | 3300027512 | Bacteria | 1096 |
| 277 | Ga0209588_1030863 | 3300027671 | Bacteria | 1713 |
| 278 | Ga0268266_10172028 | 3300028379 | Bacteria | 1966 |
| 279 | Ga0268265_10014615 | 3300028380 | Bacteria | 5352 |
| 280 | Ga0268265_10082599 | 3300028380 | Bacteria | 2541 |
| 281 | Ga0268264_10022390 | 3300028381 | Bacteria | 5161 |
| 282 | Ga0265763_1001871 | 3300030763 | Bacteria | 1557 |
| 283 | Ga0265332_10015872 | 3300031238 | Bacteria | 3323 |
| 284 | Ga0265328_10021066 | 3300031239 | Bacteria | 2492 |
| 285 | Ga0265320_10062116 | 3300031240 | Bacteria | 1779 |
| 286 | Ga0265325_10000776 | 3300031241 | Bacteria | 23122 |
| 287 | Ga0265325_10028504 | 3300031241 | Bacteria | 3009 |
| 288 | Ga0265329_10037489 | 3300031242 | Bacteria | 1561 |
| 289 | Ga0265340_10030931 | 3300031247 | Bacteria | 2680 |
| 290 | Ga0265340_10038322 | 3300031247 | Bacteria | 2371 |
| 291 | Ga0265316_10044739 | 3300031344 | Bacteria | 3518 |
| 292 | Ga0265313_10007706 | 3300031595 | Bacteria | 7293 |
| 293 | Ga0265314_10035312 | 3300031711 | Bacteria | 3645 |
| 294 | Ga0265342_10007941 | 3300031712 | Bacteria | 7697 |
| 295 | Ga0373938_0020976 | 3300034957 | Bacteria | 1321 |
| 296 | Ga0373944_0069944 | 3300035089 | Bacteria | 1141 |
| 297 | Ga0373923_0075482 | 3300035111 | Unclassified | 1455 |
| 298 | Ga0373936_0085473 | 3300035113 | Bacteria | 1317 |
| 299 | Ga0373936_0115476 | 3300035113 | Unclassified | 1143 |
| 300 | Ga0373945_0158167 | 3300035116 | Bacteria | 922 |
| 301 | Ga0373953_0030490 | 3300035117 | Bacteria | 2092 |
| 302 | Ga0373956_0227278 | 3300035119 | Bacteria | 886 |
| 303 | Ga0373957_0168577 | 3300035120 | Bacteria | 904 |
| 304 | Ga0373946_0101145 | 3300035171 | Bacteria | 1293 |
| 305 | Ga0373955_0236855 | 3300035172 | Bacteria | 1093 |
| 306 | Ga0373942_0013344 | 3300035207 | Bacteria | 1975 |
| 307 | Ga0373961_0049151 | 3300035241 | Bacteria | 1245 |
| 308 | Ga0373961_0083706 | 3300035241 | Bacteria | 1007 |
| 309 | Ga0373931_0011255 | 3300035691 | Bacteria | 4321 |
| 310 | Ga0373931_0035135 | 3300035691 | Bacteria | 2604 |
| 311 | Ga0373931_0246287 | 3300035691 | Bacteria | 1085 |
| 312 | Ga0373927_0019105 | 3300035695 | Bacteria | 4495 |
| 313 | Ga0373927_0044071 | 3300035695 | Bacteria | 2887 |
| 314 | Ga0373927_0044172 | 3300035695 | Bacteria | 2883 |
| 315 | Ga0373927_0080091 | 3300035695 | Bacteria | 2116 |
| 316 | Ga0373927_0183505 | 3300035695 | Bacteria | 1373 |
| 317 | Ga0373947_0384606 | 3300035725 | Bacteria | 945 |
| 318 | Ga0373937_0018953 | 3300036401 | Bacteria | 6153 |
| 319 | Ga0373937_0691604 | 3300036401 | Bacteria | 966 |
| 320 | Ga0373925_0039718 | 3300037068 | Bacteria | 3482 |
| 321 | Ga0373925_0308986 | 3300037068 | Bacteria | 1278 |
| 322 | Ga0395900_0778255 | 3300037418 | Bacteria | 886 |
| 323 | Ga0395898_0293242 | 3300037466 | Bacteria | 1552 |
| 324 | Ga0395905_0249010 | 3300037471 | Bacteria | 1660 |
| 325 | Ga0436364_1382860 | 3300037853 | Bacteria | 2246 |
| 326 | Ga0436365_0461050 | 3300039437 | Bacteria | 1426 |
| 327 | Ga0436365_0809061 | 3300039437 | Bacteria | 2321 |
| 328 | Ga0436365_1429287 | 3300039437 | Bacteria | 3207 |
| 329 | Ga0436360_0036314 | 3300039438 | Bacteria | 1023 |
| 330 | Ga0436360_0052375 | 3300039438 | Bacteria | 954 |
| 331 | Ga0436360_1357001 | 3300039438 | Bacteria | 1297 |
| 332 | Ga0436361_0700316 | 3300039447 | Bacteria | 10826 |
| 333 | Ga0436363_0741798 | 3300039450 | Bacteria | 723 |
| 334 | Ga0436362_1049789 | 3300039453 | Bacteria | 819 |
| 335 | Ga0451853_0917328 | 3300041512 | Bacteria | 1933 |
| 336 | Ga0466968_0264768 | 3300044735 | Bacteria | 819 |
| 337 | Ga0495603_0250402 | 3300046455 | Bacteria | 1020 |
| 338 | Ga0495638_0100144 | 3300046460 | Bacteria | 1734 |
| 339 | Ga0495580_0078541 | 3300046472 | Bacteria | 2302 |
| 340 | Ga0495605_0033665 | 3300046474 | Bacteria | 2599 |
| 341 | Ga0495605_0117647 | 3300046474 | Unclassified | 1207 |
| 342 | Ga0495639_0043506 | 3300046475 | Bacteria | 2029 |
| 343 | Ga0495639_0087732 | 3300046475 | Bacteria | 1456 |
| 344 | Ga0495662_0024432 | 3300046476 | Bacteria | 2916 |
| 345 | Ga0495584_0028229 | 3300046491 | Bacteria | 2843 |
| 346 | Ga0495584_0101499 | 3300046491 | Bacteria | 1454 |
| 347 | Ga0495594_0132280 | 3300046499 | Bacteria | 1413 |
| 348 | Ga0495628_0148107 | 3300046516 | Bacteria | 1789 |
| 349 | Ga0495630_0056017 | 3300046517 | Bacteria | 2954 |
| 350 | Ga0495630_0113169 | 3300046517 | Unclassified | 2056 |
| 351 | Ga0495630_0365994 | 3300046517 | Bacteria | 1104 |
| 352 | Ga0495652_0268997 | 3300046529 | Bacteria | 1254 |
| 353 | Ga0495665_0068455 | 3300046531 | Bacteria | 1872 |
| 354 | Ga0495665_0089320 | 3300046531 | Bacteria | 1619 |
| 355 | Ga0495665_0303002 | 3300046531 | Bacteria | 818 |
| 356 | Ga0495640_0004790 | 3300046533 | Bacteria | 10769 |
| 357 | Ga0495609_0124346 | 3300046538 | Unclassified | 1108 |
| 358 | Ga0495622_0218845 | 3300046557 | Unclassified | 844 |
| 359 | Ga0495633_0090047 | 3300046558 | Bacteria | 1426 |
| 360 | Ga0495667_0089941 | 3300046559 | Bacteria | 1990 |
| 361 | Ga0495656_0044203 | 3300046615 | Bacteria | 1874 |
| 362 | Ga0495668_0122496 | 3300046616 | Unclassified | 1423 |
| 363 | Ga0495634_0013278 | 3300046642 | Bacteria | 5953 |
| 364 | Ga0495659_0028434 | 3300046664 | Bacteria | 1935 |
| 365 | Ga0495659_0088638 | 3300046664 | Unclassified | 1185 |
| 366 | Ga0495661_0032055 | 3300046665 | Bacteria | 3326 |
| 367 | Ga0495588_0110414 | 3300046674 | Bacteria | 1448 |
| 368 | Ga0495669_0105685 | 3300046684 | Bacteria | 1311 |
| 369 | Ga0495613_0189415 | 3300046689 | Bacteria | 1454 |
| 370 | Ga0495613_0247882 | 3300046689 | Bacteria | 1244 |
| 371 | Ga0495624_0092665 | 3300046690 | Bacteria | 1863 |
| 372 | Ga0495624_0313991 | 3300046690 | Bacteria | 944 |
| 373 | Ga0495660_0168364 | 3300046810 | Unclassified | 1069 |
| 374 | Ga0495581_0103889 | 3300047315 | Bacteria | 1651 |
| 375 | Ga0495581_0137346 | 3300047315 | Bacteria | 1425 |
| 376 | Ga0495636_0053556 | 3300047318 | Bacteria | 1694 |
| 377 | Ga0495674_0520943 | 3300047319 | Bacteria | 949 |
| 378 | Ga0495686_0237648 | 3300047472 | Bacteria | 1029 |
| 379 | Ga0495593_0070311 | 3300047673 | Bacteria | 1819 |
| 380 | Ga0495602_0143651 | 3300048088 | Bacteria | 1886 |
| 381 | Ga0495602_0399003 | 3300048088 | Bacteria | 981 |
| 382 | Ga0496100_0013721 | 3300048903 | Bacteria | 4684 |
| 383 | Ga0496100_0015505 | 3300048903 | Bacteria | 4452 |
| 384 | Ga0496100_0028316 | 3300048903 | Bacteria | 3455 |
| 385 | Ga0496100_0037822 | 3300048903 | Bacteria | 3054 |
| 386 | Ga0496100_0288813 | 3300048903 | Bacteria | 1225 |
| 387 | Ga0496101_0004425 | 3300048904 | Bacteria | 8841 |
| 388 | Ga0496101_0041464 | 3300048904 | Bacteria | 3282 |
| 389 | Ga0496101_0335197 | 3300048904 | Bacteria | 1187 |
| 390 | Ga0496101_0361485 | 3300048904 | Bacteria | 1141 |
| 391 | Ga0496102_0047703 | 3300048905 | Bacteria | 3893 |
| 392 | Ga0496102_0058891 | 3300048905 | Bacteria | 3511 |
| 393 | Ga0496102_0081426 | 3300048905 | Bacteria | 2985 |
| 394 | Ga0496102_0121862 | 3300048905 | Bacteria | 2436 |
| 395 | Ga0496102_0654408 | 3300048905 | Bacteria | 974 |
| 396 | Ga0496103_0000608 | 3300048906 | Bacteria | 27999 |
| 397 | Ga0496103_0124869 | 3300048906 | Bacteria | 1641 |
| 398 | Ga0496104_0001288 | 3300048907 | Bacteria | 21610 |
| 399 | Ga0496104_0002212 | 3300048907 | Bacteria | 16814 |
| 400 | Ga0496104_0053967 | 3300048907 | Bacteria | 3798 |
| 401 | Ga0496104_0067132 | 3300048907 | Bacteria | 3406 |
| 402 | Ga0496104_0085442 | 3300048907 | Bacteria | 3011 |
| 403 | Ga0496104_0097338 | 3300048907 | Bacteria | 2816 |
| 404 | Ga0496104_0439558 | 3300048907 | Bacteria | 1216 |
| 405 | Ga0496105_0019993 | 3300048908 | Bacteria | 5404 |
| 406 | Ga0496105_0049092 | 3300048908 | Bacteria | 3483 |
| 407 | Ga0496105_0059956 | 3300048908 | Bacteria | 3139 |
| 408 | Ga0496105_0087103 | 3300048908 | Bacteria | 2581 |
| 409 | Ga0496105_0138353 | 3300048908 | Bacteria | 2005 |
| 410 | Ga0496105_0142723 | 3300048908 | Bacteria | 1970 |
| 411 | Ga0496105_0540346 | 3300048908 | Bacteria | 911 |
| 412 | Ga0496106_0052825 | 3300048909 | Bacteria | 3067 |
| 413 | Ga0496106_0285505 | 3300048909 | Bacteria | 1322 |
| 414 | Ga0496106_0583840 | 3300048909 | Bacteria | 896 |
| 415 | Ga0496107_0007970 | 3300048910 | Bacteria | 7311 |
| 416 | Ga0496107_0230896 | 3300048910 | Bacteria | 1377 |
| 417 | Ga0496108_0016990 | 3300048911 | Bacteria | 5948 |
| 418 | Ga0496108_0023856 | 3300048911 | Bacteria | 5035 |
| 419 | Ga0496108_0047082 | 3300048911 | Bacteria | 3604 |
| 420 | Ga0496108_0085865 | 3300048911 | Bacteria | 2671 |
| 421 | Ga0496109_0010314 | 3300048912 | Bacteria | 7979 |
| 422 | Ga0496109_0145855 | 3300048912 | Bacteria | 2214 |
| 423 | Ga0496109_0337372 | 3300048912 | Bacteria | 1423 |
| 424 | Ga0496109_0347424 | 3300048912 | Bacteria | 1401 |
| 425 | Ga0496110_0029781 | 3300048913 | Bacteria | 4702 |
| 426 | Ga0496110_0061628 | 3300048913 | Bacteria | 3311 |
| 427 | Ga0496110_0189447 | 3300048913 | Bacteria | 1868 |
| 428 | Ga0496110_0296235 | 3300048913 | Bacteria | 1473 |
| 429 | Ga0496111_0000865 | 3300048914 | Bacteria | 16411 |
| 430 | Ga0496111_0065384 | 3300048914 | Bacteria | 2639 |
| 431 | Ga0496111_0474103 | 3300048914 | Bacteria | 922 |
| 432 | Ga0496112_0000113 | 3300048915 | Bacteria | 50217 |
| 433 | Ga0496112_0060235 | 3300048915 | Bacteria | 3740 |
| 434 | Ga0496112_0068680 | 3300048915 | Bacteria | 3500 |
| 435 | Ga0496112_0160796 | 3300048915 | Bacteria | 2212 |
| 436 | Ga0496112_0514420 | 3300048915 | Bacteria | 1132 |
| 437 | Ga0496113_0016061 | 3300048916 | Bacteria | 5166 |
| 438 | Ga0496113_0020728 | 3300048916 | Bacteria | 4627 |
| 439 | Ga0496113_0038776 | 3300048916 | Bacteria | 3504 |
| 440 | Ga0496113_0081680 | 3300048916 | Bacteria | 2478 |
| 441 | Ga0496114_0005029 | 3300048917 | Bacteria | 10315 |
| 442 | Ga0496114_0011378 | 3300048917 | Bacteria | 7108 |
| 443 | Ga0496114_0033499 | 3300048917 | Bacteria | 4233 |
| 444 | Ga0496115_0007156 | 3300048918 | Bacteria | 8195 |
| 445 | Ga0496115_0012056 | 3300048918 | Bacteria | 6499 |
| 446 | Ga0496115_0014555 | 3300048918 | Bacteria | 5954 |
| 447 | Ga0496115_0057727 | 3300048918 | Bacteria | 3122 |
| 448 | Ga0496115_0181346 | 3300048918 | Bacteria | 1740 |
| 449 | Ga0496124_0000080 | 3300048927 | Bacteria | 210439 |
| 450 | Ga0496126_0324111 | 3300048929 | Bacteria | 1266 |
| 451 | Ga0501033_0022694 | 3300049570 | Bacteria | 4733 |
| 452 | Ga0501034_0439921 | 3300049571 | Bacteria | 1223 |
| 453 | Ga0501034_0533743 | 3300049571 | Bacteria | 1084 |
| 454 | Ga0501039_0243190 | 3300049575 | Bacteria | 1415 |
| 455 | Ga0501042_0222086 | 3300049578 | Bacteria | 1363 |
| 456 | Ga0501047_0011841 | 3300049581 | Bacteria | 8249 |
| 457 | Ga0501048_0053621 | 3300049582 | Bacteria | 2867 |
| 458 | Ga0501070_0009469 | 3300049586 | Bacteria | 8235 |
| 459 | Ga0501071_0109358 | 3300049587 | Bacteria | 2042 |
| 460 | Ga0501072_0018748 | 3300049588 | Bacteria | 5336 |
| 461 | Ga0501072_0136155 | 3300049588 | Bacteria | 1958 |
| 462 | Ga0501074_0418253 | 3300049590 | Bacteria | 951 |
| 463 | Ga0501076_0352532 | 3300049592 | Bacteria | 1208 |
| 464 | Ga0501077_0099108 | 3300049593 | Bacteria | 1847 |
| 465 | Ga0501077_0259295 | 3300049593 | Bacteria | 1106 |
| 466 | Ga0501079_0269073 | 3300049741 | Bacteria | 1332 |
| 467 | Ga0501081_0332657 | 3300049743 | Bacteria | 1118 |
| 468 | Ga0501083_0184386 | 3300049744 | Bacteria | 1362 |
| 469 | Ga0501044_0005732 | 3300049823 | Bacteria | 13757 |
| 470 | Ga0501045_0045422 | 3300049824 | Bacteria | 3198 |
| 471 | nmdc:mga03683_30746_c1 | 3300050489 | Bacteria | 2150 |
| 472 | nmdc:mga03683_87718_c1 | 3300050489 | Bacteria | 1352 |
| 473 | nmdc:mga03n38_135030_c1 | 3300050490 | Bacteria | 1227 |
| 474 | nmdc:mga03n38_187152_c1 | 3300050490 | Bacteria | 1064 |
| 475 | nmdc:mga0yw44_111041_c1 | 3300050492 | Bacteria | 1757 |
| 476 | nmdc:mga0yw44_17733_c1 | 3300050492 | Bacteria | 3882 |
| 477 | nmdc:mga0yw44_447125_c1 | 3300050492 | Bacteria | 876 |
| 478 | nmdc:mga0yw44_552194_c1 | 3300050492 | Unclassified | 782 |
| 479 | nmdc:mga0k408_10377_c1 | 3300050493 | Bacteria | 5039 |
| 480 | nmdc:mga0k408_132455_c1 | 3300050493 | Bacteria | 1480 |
| 481 | nmdc:mga0k408_137122_c1 | 3300050493 | Bacteria | 1454 |
| 482 | nmdc:mga0k408_167193_c1 | 3300050493 | Bacteria | 1311 |
| 483 | nmdc:mga0k408_97952_c1 | 3300050493 | Bacteria | 1728 |
| 484 | nmdc:mga06z11_19229_c1 | 3300050494 | Bacteria | 3135 |
| 485 | nmdc:mga07m45_356990_c1 | 3300050496 | Bacteria | 849 |
| 486 | nmdc:mga05p37_11140_c1 | 3300050507 | Bacteria | 10205 |
| 487 | nmdc:mga05p37_253468_c1 | 3300050507 | Bacteria | 2110 |
| 488 | nmdc:mga05p37_324898_c1 | 3300050507 | Bacteria | 1820 |
| 489 | nmdc:mga05p37_645454_c1 | 3300050507 | Bacteria | 1186 |
| 490 | nmdc:mga09592_126622_c1 | 3300050508 | Bacteria | 2196 |
| 491 | nmdc:mga0qj67_157469_c1 | 3300050509 | Bacteria | 1844 |
| 492 | nmdc:mga0qj67_210845_c1 | 3300050509 | Bacteria | 1578 |
| 493 | nmdc:mga06r32_158679_c1 | 3300050510 | Bacteria | 2244 |
| 494 | nmdc:mga06r32_579172_c1 | 3300050510 | Bacteria | 1095 |
| 495 | nmdc:mga08y16_419351_c1 | 3300050511 | Bacteria | 1368 |
| 496 | nmdc:mga0n895_134863_c1 | 3300050512 | Bacteria | 2495 |
| 497 | nmdc:mga0n895_229928_c1 | 3300050512 | Bacteria | 1882 |
| 498 | nmdc:mga0n895_353093_c1 | 3300050512 | Bacteria | 1489 |
| 499 | nmdc:mga0rr50_10141_c1 | 3300050513 | Bacteria | 5963 |
| 500 | nmdc:mga0sz30_58700_c1 | 3300050516 | Bacteria | 1641 |
| 501 | Ga0495601_0158395 | 3300053077 | Bacteria | 1479 |
| 502 | Ga0495601_0245678 | 3300053077 | Bacteria | 1169 |
| 503 | Ga0495601_0336533 | 3300053077 | Bacteria | 982 |
| 504 | Ga0495612_0048971 | 3300053078 | Bacteria | 1733 |
| 505 | Ga0495595_0128448 | 3300053084 | Bacteria | 1237 |
| 506 | Ga0495619_0011795 | 3300053085 | Bacteria | 5505 |
| 507 | Ga0495619_0050737 | 3300053085 | Bacteria | 2740 |
| 508 | Ga0495619_0093229 | 3300053085 | Bacteria | 2041 |
| 509 | Ga0500595_012826 | 3300053119 | Bacteria | 3226 |
| 510 | Ga0500642_0133490 | 3300053130 | Bacteria | 1164 |
| 511 | Ga0500652_000086 | 3300053131 | Bacteria | 38984 |
| 512 | Ga0500636_0000262 | 3300053177 | Bacteria | 29181 |
| 513 | Ga0501084_0099380 | 3300054114 | Bacteria | 2443 |
| 514 | Ga0501082_0063940 | 3300060353 | Bacteria | 3168 |
| 515 | Ga0501082_0181355 | 3300060353 | Bacteria | 1831 |
| 516 | Ga0530510_0185625 | 3300061734 | Bacteria | 1543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050492 | nmdc:mga0yw44_552194_c1 | nmdc:mga0yw44_552194_c1_22_672 | 216 |
| 2 | 3300013297 | Ga0157378_10695375 | Ga0157378_106953751 | 217 |
| 3 | 3300006051 | Ga0075364_10162118 | Ga0075364_101621181 | 221 |
| 4 | 3300014969 | Ga0157376_10664102 | Ga0157376_106641022 | 226 |
| 5 | 3300039450 | Ga0436363_0741798 | Ga0436363_0741798_24_704 | 226 |
| 6 | 3300044735 | Ga0466968_0264768 | Ga0466968_0264768_114_794 | 226 |
| 7 | 3300048915 | Ga0496112_0160796 | Ga0496112_0160796_1513_2193 | 226 |
| 8 | 3300048913 | Ga0496110_0189447 | Ga0496110_0189447_335_1102 | 237 |
| 9 | 3300006195 | Ga0075366_10048049 | Ga0075366_100480493 | 238 |
| 10 | 3300050490 | nmdc:mga03n38_135030_c1 | nmdc:mga03n38_135030_c1_75_833 | 238 |
| 11 | 3300050493 | nmdc:mga0k408_97952_c1 | nmdc:mga0k408_97952_c1_26_784 | 238 |
| 12 | 3300006177 | Ga0075362_10088795 | Ga0075362_100887952 | 241 |
| 13 | 3300006178 | Ga0075367_10126105 | Ga0075367_101261051 | 241 |
| 14 | 3300037466 | Ga0395898_0293242 | Ga0395898_0293242_61_819 | 241 |
| 15 | 3300046664 | Ga0495659_0088638 | Ga0495659_0088638_450_1175 | 241 |
| 16 | 3300049570 | Ga0501033_0022694 | Ga0501033_0022694_586_1356 | 241 |
| 17 | 3300049581 | Ga0501047_0011841 | Ga0501047_0011841_2098_2868 | 241 |
| 18 | 3300049586 | Ga0501070_0009469 | Ga0501070_0009469_4908_5678 | 241 |
| 19 | 3300049823 | Ga0501044_0005732 | Ga0501044_0005732_2099_2869 | 241 |
| 20 | 3300050489 | nmdc:mga03683_30746_c1 | nmdc:mga03683_30746_c1_1270_2070 | 241 |
| 21 | 3300050494 | nmdc:mga06z11_19229_c1 | nmdc:mga06z11_19229_c1_1692_2492 | 241 |
| 22 | 3300005406 | Ga0070703_10098719 | Ga0070703_100987191 | 243 |
| 23 | 3300005844 | Ga0068862_100366592 | Ga0068862_1003665922 | 244 |
| 24 | 3300009553 | Ga0105249_10838463 | Ga0105249_108384631 | 244 |
| 25 | 3300014325 | Ga0163163_10797550 | Ga0163163_107975502 | 244 |
| 26 | 3300037418 | Ga0395900_0778255 | Ga0395900_0778255_59_829 | 244 |
| 27 | 3300037471 | Ga0395905_0249010 | Ga0395905_0249010_317_1087 | 244 |
| 28 | 3300005983 | Ga0081540_1000002 | Ga0081540_1000002147 | 246 |
| 29 | 3300050496 | nmdc:mga07m45_356990_c1 | nmdc:mga07m45_356990_c1_12_782 | 246 |
| 30 | 3300050511 | nmdc:mga08y16_419351_c1 | nmdc:mga08y16_419351_c1_491_1258 | 246 |
| 31 | 3300050512 | nmdc:mga0n895_229928_c1 | nmdc:mga0n895_229928_c1_280_1047 | 246 |
| 32 | 3300050513 | nmdc:mga0rr50_10141_c1 | nmdc:mga0rr50_10141_c1_765_1532 | 246 |
| 33 | 3300003203 | JGI25406J46586_10024782 | JGI25406J46586_100247823 | 251 |
| 34 | 3300005331 | Ga0070670_100070279 | Ga0070670_1000702793 | 251 |
| 35 | 3300005334 | Ga0068869_100151529 | Ga0068869_1001515291 | 251 |
| 36 | 3300005437 | Ga0070710_10519587 | Ga0070710_105195871 | 251 |
| 37 | 3300005466 | Ga0070685_10319252 | Ga0070685_103192522 | 251 |
| 38 | 3300005617 | Ga0068859_100512544 | Ga0068859_1005125442 | 251 |
| 39 | 3300005844 | Ga0068862_100475630 | Ga0068862_1004756302 | 251 |
| 40 | 3300005985 | Ga0081539_10000785 | Ga0081539_1000078514 | 251 |
| 41 | 3300005985 | Ga0081539_10041457 | Ga0081539_100414573 | 251 |
| 42 | 3300006931 | Ga0097620_100512562 | Ga0097620_1005125622 | 251 |
| 43 | 3300009101 | Ga0105247_10362320 | Ga0105247_103623201 | 251 |
| 44 | 3300009176 | Ga0105242_10862992 | Ga0105242_108629922 | 251 |
| 45 | 3300009551 | Ga0105238_10185061 | Ga0105238_101850612 | 251 |
| 46 | 3300009553 | Ga0105249_10449039 | Ga0105249_104490392 | 251 |
| 47 | 3300013308 | Ga0157375_10770099 | Ga0157375_107700992 | 251 |
| 48 | 3300014325 | Ga0163163_10149460 | Ga0163163_101494603 | 251 |
| 49 | 3300014325 | Ga0163163_11244006 | Ga0163163_112440061 | 251 |
| 50 | 3300014326 | Ga0157380_10308184 | Ga0157380_103081842 | 251 |
| 51 | 3300021384 | Ga0213876_10232964 | Ga0213876_102329642 | 251 |
| 52 | 3300025918 | Ga0207662_10069116 | Ga0207662_100691162 | 251 |
| 53 | 3300025924 | Ga0207694_10028341 | Ga0207694_100283412 | 251 |
| 54 | 3300025925 | Ga0207650_10494372 | Ga0207650_104943722 | 251 |
| 55 | 3300025942 | Ga0207689_10025175 | Ga0207689_100251754 | 251 |
| 56 | 3300025945 | Ga0207679_10835009 | Ga0207679_108350091 | 251 |
| 57 | 3300025986 | Ga0207658_10263156 | Ga0207658_102631562 | 251 |
| 58 | 3300026041 | Ga0207639_10521650 | Ga0207639_105216502 | 251 |
| 59 | 3300026095 | Ga0207676_10120772 | Ga0207676_101207723 | 251 |
| 60 | 3300026116 | Ga0207674_10022628 | Ga0207674_100226281 | 251 |
| 61 | 3300031238 | Ga0265332_10015872 | Ga0265332_100158722 | 251 |
| 62 | 3300031239 | Ga0265328_10021066 | Ga0265328_100210663 | 251 |
| 63 | 3300031240 | Ga0265320_10062116 | Ga0265320_100621162 | 251 |
| 64 | 3300031241 | Ga0265325_10028504 | Ga0265325_100285042 | 251 |
| 65 | 3300031242 | Ga0265329_10037489 | Ga0265329_100374893 | 251 |
| 66 | 3300031247 | Ga0265340_10030931 | Ga0265340_100309312 | 251 |
| 67 | 3300031344 | Ga0265316_10044739 | Ga0265316_100447393 | 251 |
| 68 | 3300031595 | Ga0265313_10007706 | Ga0265313_100077064 | 251 |
| 69 | 3300031711 | Ga0265314_10035312 | Ga0265314_100353124 | 251 |
| 70 | 3300031712 | Ga0265342_10007941 | Ga0265342_100079416 | 251 |
| 71 | 3300039437 | Ga0436365_1429287 | Ga0436365_1429287_2211_2966 | 251 |
| 72 | 3300046474 | Ga0495605_0033665 | Ga0495605_0033665_1784_2539 | 251 |
| 73 | 3300049744 | Ga0501083_0184386 | Ga0501083_0184386_532_1287 | 251 |
| 74 | 3300005340 | Ga0070689_100012062 | Ga0070689_1000120622 | 252 |
| 75 | 3300005343 | Ga0070687_100191860 | Ga0070687_1001918602 | 252 |
| 76 | 3300005356 | Ga0070674_100107147 | Ga0070674_1001071472 | 252 |
| 77 | 3300005364 | Ga0070673_100341047 | Ga0070673_1003410472 | 252 |
| 78 | 3300005365 | Ga0070688_100009968 | Ga0070688_1000099684 | 252 |
| 79 | 3300005439 | Ga0070711_100090313 | Ga0070711_1000903132 | 252 |
| 80 | 3300005441 | Ga0070700_100236685 | Ga0070700_1002366851 | 252 |
| 81 | 3300005455 | Ga0070663_100734243 | Ga0070663_1007342431 | 252 |
| 82 | 3300005547 | Ga0070693_100136449 | Ga0070693_1001364492 | 252 |
| 83 | 3300005578 | Ga0068854_100612495 | Ga0068854_1006124951 | 252 |
| 84 | 3300005617 | Ga0068859_100477936 | Ga0068859_1004779362 | 252 |
| 85 | 3300005840 | Ga0068870_10162445 | Ga0068870_101624452 | 252 |
| 86 | 3300005841 | Ga0068863_100514457 | Ga0068863_1005144571 | 252 |
| 87 | 3300005844 | Ga0068862_100240800 | Ga0068862_1002408002 | 252 |
| 88 | 3300006163 | Ga0070715_10175463 | Ga0070715_101754632 | 252 |
| 89 | 3300006173 | Ga0070716_100076413 | Ga0070716_1000764132 | 252 |
| 90 | 3300006173 | Ga0070716_100472680 | Ga0070716_1004726802 | 252 |
| 91 | 3300006175 | Ga0070712_100043732 | Ga0070712_1000437321 | 252 |
| 92 | 3300006177 | Ga0075362_10098134 | Ga0075362_100981341 | 252 |
| 93 | 3300006931 | Ga0097620_100477942 | Ga0097620_1004779422 | 252 |
| 94 | 3300009101 | Ga0105247_10149586 | Ga0105247_101495862 | 252 |
| 95 | 3300009148 | Ga0105243_10793805 | Ga0105243_107938051 | 252 |
| 96 | 3300009177 | Ga0105248_10024108 | Ga0105248_100241082 | 252 |
| 97 | 3300013297 | Ga0157378_10534137 | Ga0157378_105341372 | 252 |
| 98 | 3300013306 | Ga0163162_10513206 | Ga0163162_105132062 | 252 |
| 99 | 3300014325 | Ga0163163_10077687 | Ga0163163_100776874 | 252 |
| 100 | 3300021384 | Ga0213876_10262658 | Ga0213876_102626581 | 252 |
| 101 | 3300025900 | Ga0207710_10256065 | Ga0207710_102560652 | 252 |
| 102 | 3300025901 | Ga0207688_10087273 | Ga0207688_100872732 | 252 |
| 103 | 3300025908 | Ga0207643_10083299 | Ga0207643_100832992 | 252 |
| 104 | 3300025915 | Ga0207693_10267506 | Ga0207693_102675061 | 252 |
| 105 | 3300025916 | Ga0207663_10075467 | Ga0207663_100754671 | 252 |
| 106 | 3300025926 | Ga0207659_10052138 | Ga0207659_100521382 | 252 |
| 107 | 3300025927 | Ga0207687_10441343 | Ga0207687_104413432 | 252 |
| 108 | 3300025931 | Ga0207644_10174608 | Ga0207644_101746082 | 252 |
| 109 | 3300025936 | Ga0207670_10013634 | Ga0207670_100136342 | 252 |
| 110 | 3300025941 | Ga0207711_10015614 | Ga0207711_100156142 | 252 |
| 111 | 3300025960 | Ga0207651_10244315 | Ga0207651_102443152 | 252 |
| 112 | 3300026067 | Ga0207678_10123031 | Ga0207678_101230313 | 252 |
| 113 | 3300026088 | Ga0207641_10800622 | Ga0207641_108006222 | 252 |
| 114 | 3300028380 | Ga0268265_10082599 | Ga0268265_100825992 | 252 |
| 115 | 3300034957 | Ga0373938_0020976 | Ga0373938_0020976_325_1083 | 252 |
| 116 | 3300035113 | Ga0373936_0085473 | Ga0373936_0085473_524_1282 | 252 |
| 117 | 3300035116 | Ga0373945_0158167 | Ga0373945_0158167_38_796 | 252 |
| 118 | 3300035119 | Ga0373956_0227278 | Ga0373956_0227278_11_769 | 252 |
| 119 | 3300035120 | Ga0373957_0168577 | Ga0373957_0168577_120_878 | 252 |
| 120 | 3300035171 | Ga0373946_0101145 | Ga0373946_0101145_340_1098 | 252 |
| 121 | 3300035207 | Ga0373942_0013344 | Ga0373942_0013344_605_1363 | 252 |
| 122 | 3300035241 | Ga0373961_0049151 | Ga0373961_0049151_145_903 | 252 |
| 123 | 3300035241 | Ga0373961_0083706 | Ga0373961_0083706_31_789 | 252 |
| 124 | 3300035691 | Ga0373931_0035135 | Ga0373931_0035135_1797_2555 | 252 |
| 125 | 3300035691 | Ga0373931_0246287 | Ga0373931_0246287_20_778 | 252 |
| 126 | 3300035695 | Ga0373927_0019105 | Ga0373927_0019105_2522_3286 | 252 |
| 127 | 3300035695 | Ga0373927_0183505 | Ga0373927_0183505_445_1203 | 252 |
| 128 | 3300035725 | Ga0373947_0384606 | Ga0373947_0384606_76_840 | 252 |
| 129 | 3300036401 | Ga0373937_0018953 | Ga0373937_0018953_5203_5961 | 252 |
| 130 | 3300037068 | Ga0373925_0308986 | Ga0373925_0308986_218_976 | 252 |
| 131 | 3300037853 | Ga0436364_1382860 | Ga0436364_1382860_827_1585 | 252 |
| 132 | 3300039437 | Ga0436365_0809061 | Ga0436365_0809061_1381_2139 | 252 |
| 133 | 3300039438 | Ga0436360_0036314 | Ga0436360_0036314_176_934 | 252 |
| 134 | 3300046455 | Ga0495603_0250402 | Ga0495603_0250402_94_852 | 252 |
| 135 | 3300046516 | Ga0495628_0148107 | Ga0495628_0148107_327_1085 | 252 |
| 136 | 3300046517 | Ga0495630_0113169 | Ga0495630_0113169_175_933 | 252 |
| 137 | 3300046533 | Ga0495640_0004790 | Ga0495640_0004790_3693_4457 | 252 |
| 138 | 3300046642 | Ga0495634_0013278 | Ga0495634_0013278_2079_2843 | 252 |
| 139 | 3300046689 | Ga0495613_0247882 | Ga0495613_0247882_189_953 | 252 |
| 140 | 3300047318 | Ga0495636_0053556 | Ga0495636_0053556_149_907 | 252 |
| 141 | 3300047319 | Ga0495674_0520943 | Ga0495674_0520943_29_793 | 252 |
| 142 | 3300048088 | Ga0495602_0143651 | Ga0495602_0143651_361_1119 | 252 |
| 143 | 3300048903 | Ga0496100_0013721 | Ga0496100_0013721_1740_2498 | 252 |
| 144 | 3300048903 | Ga0496100_0028316 | Ga0496100_0028316_205_966 | 252 |
| 145 | 3300048904 | Ga0496101_0004425 | Ga0496101_0004425_3657_4415 | 252 |
| 146 | 3300048905 | Ga0496102_0058891 | Ga0496102_0058891_2157_2915 | 252 |
| 147 | 3300048905 | Ga0496102_0121862 | Ga0496102_0121862_28_786 | 252 |
| 148 | 3300048906 | Ga0496103_0124869 | Ga0496103_0124869_385_1143 | 252 |
| 149 | 3300048907 | Ga0496104_0053967 | Ga0496104_0053967_2784_3542 | 252 |
| 150 | 3300048907 | Ga0496104_0439558 | Ga0496104_0439558_317_1075 | 252 |
| 151 | 3300048908 | Ga0496105_0049092 | Ga0496105_0049092_2015_2773 | 252 |
| 152 | 3300048908 | Ga0496105_0087103 | Ga0496105_0087103_356_1114 | 252 |
| 153 | 3300048908 | Ga0496105_0138353 | Ga0496105_0138353_1135_1896 | 252 |
| 154 | 3300048909 | Ga0496106_0052825 | Ga0496106_0052825_614_1372 | 252 |
| 155 | 3300048911 | Ga0496108_0016990 | Ga0496108_0016990_3762_4520 | 252 |
| 156 | 3300048911 | Ga0496108_0047082 | Ga0496108_0047082_683_1441 | 252 |
| 157 | 3300048912 | Ga0496109_0337372 | Ga0496109_0337372_406_1164 | 252 |
| 158 | 3300048912 | Ga0496109_0347424 | Ga0496109_0347424_344_1102 | 252 |
| 159 | 3300048913 | Ga0496110_0029781 | Ga0496110_0029781_1353_2111 | 252 |
| 160 | 3300048915 | Ga0496112_0068680 | Ga0496112_0068680_1212_1970 | 252 |
| 161 | 3300048916 | Ga0496113_0081680 | Ga0496113_0081680_634_1392 | 252 |
| 162 | 3300048917 | Ga0496114_0033499 | Ga0496114_0033499_408_1166 | 252 |
| 163 | 3300048918 | Ga0496115_0014555 | Ga0496115_0014555_2030_2788 | 252 |
| 164 | 3300048918 | Ga0496115_0057727 | Ga0496115_0057727_1285_2046 | 252 |
| 165 | 3300048918 | Ga0496115_0181346 | Ga0496115_0181346_963_1721 | 252 |
| 166 | 3300048929 | Ga0496126_0324111 | Ga0496126_0324111_420_1178 | 252 |
| 167 | 3300050490 | nmdc:mga03n38_187152_c1 | nmdc:mga03n38_187152_c1_117_875 | 252 |
| 168 | 3300053077 | Ga0495601_0245678 | Ga0495601_0245678_266_1030 | 252 |
| 169 | 3300053077 | Ga0495601_0336533 | Ga0495601_0336533_180_938 | 252 |
| 170 | 3300053084 | Ga0495595_0128448 | Ga0495595_0128448_282_1040 | 252 |
| 171 | 3300053085 | Ga0495619_0011795 | Ga0495619_0011795_49_807 | 252 |
| 172 | 3300005471 | Ga0070698_100492348 | Ga0070698_1004923482 | 254 |
| 173 | 3300005530 | Ga0070679_100051306 | Ga0070679_1000513064 | 254 |
| 174 | 3300025921 | Ga0207652_10080944 | Ga0207652_100809441 | 254 |
| 175 | 3300049575 | Ga0501039_0243190 | Ga0501039_0243190_390_1160 | 254 |
| 176 | 3300049578 | Ga0501042_0222086 | Ga0501042_0222086_545_1309 | 254 |
| 177 | 3300049587 | Ga0501071_0109358 | Ga0501071_0109358_394_1164 | 254 |
| 178 | 3300049588 | Ga0501072_0018748 | Ga0501072_0018748_782_1552 | 254 |
| 179 | 3300049592 | Ga0501076_0352532 | Ga0501076_0352532_211_981 | 254 |
| 180 | 3300049593 | Ga0501077_0259295 | Ga0501077_0259295_34_798 | 254 |
| 181 | 3300049824 | Ga0501045_0045422 | Ga0501045_0045422_1788_2552 | 254 |
| 182 | 3300054114 | Ga0501084_0099380 | Ga0501084_0099380_1657_2427 | 254 |
| 183 | 3300060353 | Ga0501082_0063940 | Ga0501082_0063940_2374_3144 | 254 |
| 184 | 3300001976 | JGI24752J21851_1002172 | JGI24752J21851_10021722 | 255 |
| 185 | 3300002070 | JGI24750J21931_1002705 | JGI24750J21931_10027052 | 255 |
| 186 | 3300002073 | JGI24745J21846_1000482 | JGI24745J21846_10004822 | 255 |
| 187 | 3300002074 | JGI24748J21848_1005378 | JGI24748J21848_10053782 | 255 |
| 188 | 3300002155 | JGI24033J26618_1001870 | JGI24033J26618_10018702 | 255 |
| 189 | 3300002244 | JGI24742J22300_10001734 | JGI24742J22300_100017342 | 255 |
| 190 | 3300003215 | JGI25153J46596_10002988 | JGI25153J46596_1000298810 | 255 |
| 191 | 3300003911 | JGI25405J52794_10038742 | JGI25405J52794_100387422 | 255 |
| 192 | 3300005327 | Ga0070658_10724690 | Ga0070658_107246901 | 255 |
| 193 | 3300005329 | Ga0070683_100595713 | Ga0070683_1005957131 | 255 |
| 194 | 3300005330 | Ga0070690_100101341 | Ga0070690_1001013411 | 255 |
| 195 | 3300005330 | Ga0070690_100403347 | Ga0070690_1004033471 | 255 |
| 196 | 3300005331 | Ga0070670_100158450 | Ga0070670_1001584501 | 255 |
| 197 | 3300005334 | Ga0068869_100047516 | Ga0068869_1000475161 | 255 |
| 198 | 3300005335 | Ga0070666_10089060 | Ga0070666_100890602 | 255 |
| 199 | 3300005335 | Ga0070666_10180100 | Ga0070666_101801001 | 255 |
| 200 | 3300005337 | Ga0070682_100246467 | Ga0070682_1002464672 | 255 |
| 201 | 3300005338 | Ga0068868_100010725 | Ga0068868_1000107254 | 255 |
| 202 | 3300005340 | Ga0070689_100005881 | Ga0070689_1000058812 | 255 |
| 203 | 3300005343 | Ga0070687_100009448 | Ga0070687_1000094482 | 255 |
| 204 | 3300005345 | Ga0070692_10170096 | Ga0070692_101700962 | 255 |
| 205 | 3300005347 | Ga0070668_100081158 | Ga0070668_1000811581 | 255 |
| 206 | 3300005354 | Ga0070675_100036033 | Ga0070675_1000360332 | 255 |
| 207 | 3300005355 | Ga0070671_100012193 | Ga0070671_1000121934 | 255 |
| 208 | 3300005356 | Ga0070674_100019589 | Ga0070674_1000195892 | 255 |
| 209 | 3300005364 | Ga0070673_100376826 | Ga0070673_1003768262 | 255 |
| 210 | 3300005365 | Ga0070688_100037269 | Ga0070688_1000372692 | 255 |
| 211 | 3300005365 | Ga0070688_100287503 | Ga0070688_1002875031 | 255 |
| 212 | 3300005366 | Ga0070659_100089447 | Ga0070659_1000894472 | 255 |
| 213 | 3300005367 | Ga0070667_100032811 | Ga0070667_1000328112 | 255 |
| 214 | 3300005367 | Ga0070667_100209504 | Ga0070667_1002095042 | 255 |
| 215 | 3300005436 | Ga0070713_100109688 | Ga0070713_1001096883 | 255 |
| 216 | 3300005436 | Ga0070713_100774492 | Ga0070713_1007744921 | 255 |
| 217 | 3300005438 | Ga0070701_10007970 | Ga0070701_100079704 | 255 |
| 218 | 3300005440 | Ga0070705_100204827 | Ga0070705_1002048272 | 255 |
| 219 | 3300005441 | Ga0070700_100002888 | Ga0070700_1000028884 | 255 |
| 220 | 3300005456 | Ga0070678_100109757 | Ga0070678_1001097572 | 255 |
| 221 | 3300005459 | Ga0068867_100027139 | Ga0068867_1000271393 | 255 |
| 222 | 3300005466 | Ga0070685_10006217 | Ga0070685_100062174 | 255 |
| 223 | 3300005543 | Ga0070672_100011894 | Ga0070672_1000118943 | 255 |
| 224 | 3300005543 | Ga0070672_100116840 | Ga0070672_1001168402 | 255 |
| 225 | 3300005544 | Ga0070686_100008164 | Ga0070686_1000081642 | 255 |
| 226 | 3300005545 | Ga0070695_100315837 | Ga0070695_1003158372 | 255 |
| 227 | 3300005547 | Ga0070693_100041984 | Ga0070693_1000419842 | 255 |
| 228 | 3300005548 | Ga0070665_100176923 | Ga0070665_1001769232 | 255 |
| 229 | 3300005564 | Ga0070664_100009753 | Ga0070664_1000097535 | 255 |
| 230 | 3300005577 | Ga0068857_100213829 | Ga0068857_1002138292 | 255 |
| 231 | 3300005578 | Ga0068854_100014771 | Ga0068854_1000147714 | 255 |
| 232 | 3300005614 | Ga0068856_100046810 | Ga0068856_1000468102 | 255 |
| 233 | 3300005615 | Ga0070702_100274246 | Ga0070702_1002742462 | 255 |
| 234 | 3300005616 | Ga0068852_100746878 | Ga0068852_1007468782 | 255 |
| 235 | 3300005617 | Ga0068859_100076334 | Ga0068859_1000763343 | 255 |
| 236 | 3300005617 | Ga0068859_100440603 | Ga0068859_1004406032 | 255 |
| 237 | 3300005618 | Ga0068864_100015532 | Ga0068864_1000155325 | 255 |
| 238 | 3300005718 | Ga0068866_10015228 | Ga0068866_100152283 | 255 |
| 239 | 3300005834 | Ga0068851_10019357 | Ga0068851_100193574 | 255 |
| 240 | 3300005840 | Ga0068870_10008699 | Ga0068870_100086994 | 255 |
| 241 | 3300005841 | Ga0068863_100073949 | Ga0068863_1000739492 | 255 |
| 242 | 3300005842 | Ga0068858_100012156 | Ga0068858_1000121565 | 255 |
| 243 | 3300005843 | Ga0068860_100077696 | Ga0068860_1000776963 | 255 |
| 244 | 3300005844 | Ga0068862_100027550 | Ga0068862_1000275503 | 255 |
| 245 | 3300005937 | Ga0081455_10006523 | Ga0081455_100065238 | 255 |
| 246 | 3300005937 | Ga0081455_10012142 | Ga0081455_100121423 | 255 |
| 247 | 3300005937 | Ga0081455_10041860 | Ga0081455_100418602 | 255 |
| 248 | 3300005937 | Ga0081455_10117503 | Ga0081455_101175032 | 255 |
| 249 | 3300005981 | Ga0081538_10052543 | Ga0081538_100525433 | 255 |
| 250 | 3300005981 | Ga0081538_10074182 | Ga0081538_100741821 | 255 |
| 251 | 3300005983 | Ga0081540_1013123 | Ga0081540_10131236 | 255 |
| 252 | 3300005983 | Ga0081540_1065235 | Ga0081540_10652352 | 255 |
| 253 | 3300006028 | Ga0070717_10245942 | Ga0070717_102459422 | 255 |
| 254 | 3300006038 | Ga0075365_10012280 | Ga0075365_100122804 | 255 |
| 255 | 3300006038 | Ga0075365_10038149 | Ga0075365_100381492 | 255 |
| 256 | 3300006038 | Ga0075365_10150366 | Ga0075365_101503662 | 255 |
| 257 | 3300006038 | Ga0075365_10180645 | Ga0075365_101806452 | 255 |
| 258 | 3300006038 | Ga0075365_10201998 | Ga0075365_102019982 | 255 |
| 259 | 3300006038 | Ga0075365_10264076 | Ga0075365_102640762 | 255 |
| 260 | 3300006038 | Ga0075365_10346451 | Ga0075365_103464511 | 255 |
| 261 | 3300006042 | Ga0075368_10057050 | Ga0075368_100570501 | 255 |
| 262 | 3300006051 | Ga0075364_10131578 | Ga0075364_101315782 | 255 |
| 263 | 3300006163 | Ga0070715_10099074 | Ga0070715_100990742 | 255 |
| 264 | 3300006175 | Ga0070712_100147369 | Ga0070712_1001473691 | 255 |
| 265 | 3300006175 | Ga0070712_100602865 | Ga0070712_1006028651 | 255 |
| 266 | 3300006177 | Ga0075362_10130640 | Ga0075362_101306402 | 255 |
| 267 | 3300006178 | Ga0075367_10053359 | Ga0075367_100533594 | 255 |
| 268 | 3300006178 | Ga0075367_10258647 | Ga0075367_102586472 | 255 |
| 269 | 3300006178 | Ga0075367_10308572 | Ga0075367_103085721 | 255 |
| 270 | 3300006195 | Ga0075366_10000736 | Ga0075366_100007365 | 255 |
| 271 | 3300006237 | Ga0097621_100086658 | Ga0097621_1000866582 | 255 |
| 272 | 3300006237 | Ga0097621_100191249 | Ga0097621_1001912492 | 255 |
| 273 | 3300006237 | Ga0097621_100525847 | Ga0097621_1005258472 | 255 |
| 274 | 3300006353 | Ga0075370_10152274 | Ga0075370_101522741 | 255 |
| 275 | 3300006358 | Ga0068871_100095019 | Ga0068871_1000950192 | 255 |
| 276 | 3300006358 | Ga0068871_100385224 | Ga0068871_1003852242 | 255 |
| 277 | 3300006358 | Ga0068871_100404115 | Ga0068871_1004041152 | 255 |
| 278 | 3300006844 | Ga0075428_100104592 | Ga0075428_1001045921 | 255 |
| 279 | 3300006844 | Ga0075428_100137078 | Ga0075428_1001370783 | 255 |
| 280 | 3300006844 | Ga0075428_100287038 | Ga0075428_1002870382 | 255 |
| 281 | 3300006846 | Ga0075430_100207164 | Ga0075430_1002071642 | 255 |
| 282 | 3300006847 | Ga0075431_100191821 | Ga0075431_1001918212 | 255 |
| 283 | 3300006847 | Ga0075431_100401633 | Ga0075431_1004016332 | 255 |
| 284 | 3300006852 | Ga0075433_10027293 | Ga0075433_100272934 | 255 |
| 285 | 3300006871 | Ga0075434_100266037 | Ga0075434_1002660372 | 255 |
| 286 | 3300006880 | Ga0075429_100291566 | Ga0075429_1002915662 | 255 |
| 287 | 3300006881 | Ga0068865_100020686 | Ga0068865_1000206865 | 255 |
| 288 | 3300006881 | Ga0068865_100676363 | Ga0068865_1006763631 | 255 |
| 289 | 3300006931 | Ga0097620_100076336 | Ga0097620_1000763363 | 255 |
| 290 | 3300006931 | Ga0097620_100440512 | Ga0097620_1004405122 | 255 |
| 291 | 3300007265 | Ga0099794_10041496 | Ga0099794_100414962 | 255 |
| 292 | 3300007788 | Ga0099795_10000869 | Ga0099795_100008693 | 255 |
| 293 | 3300007788 | Ga0099795_10002805 | Ga0099795_100028052 | 255 |
| 294 | 3300007788 | Ga0099795_10012379 | Ga0099795_100123793 | 255 |
| 295 | 3300007788 | Ga0099795_10185380 | Ga0099795_101853801 | 255 |
| 296 | 3300009092 | Ga0105250_10120802 | Ga0105250_101208022 | 255 |
| 297 | 3300009094 | Ga0111539_10223206 | Ga0111539_102232062 | 255 |
| 298 | 3300009098 | Ga0105245_10001109 | Ga0105245_1000110927 | 255 |
| 299 | 3300009098 | Ga0105245_10202149 | Ga0105245_102021492 | 255 |
| 300 | 3300009101 | Ga0105247_10348649 | Ga0105247_103486492 | 255 |
| 301 | 3300009147 | Ga0114129_10081766 | Ga0114129_100817662 | 255 |
| 302 | 3300009147 | Ga0114129_10108303 | Ga0114129_101083034 | 255 |
| 303 | 3300009147 | Ga0114129_10221714 | Ga0114129_102217143 | 255 |
| 304 | 3300009147 | Ga0114129_10383522 | Ga0114129_103835222 | 255 |
| 305 | 3300009148 | Ga0105243_10229254 | Ga0105243_102292542 | 255 |
| 306 | 3300009174 | Ga0105241_10289423 | Ga0105241_102894231 | 255 |
| 307 | 3300009176 | Ga0105242_10035307 | Ga0105242_100353074 | 255 |
| 308 | 3300009176 | Ga0105242_10055767 | Ga0105242_100557672 | 255 |
| 309 | 3300009177 | Ga0105248_10090827 | Ga0105248_100908272 | 255 |
| 310 | 3300009545 | Ga0105237_10323295 | Ga0105237_103232952 | 255 |
| 311 | 3300009551 | Ga0105238_10510100 | Ga0105238_105101001 | 255 |
| 312 | 3300009553 | Ga0105249_10111981 | Ga0105249_101119812 | 255 |
| 313 | 3300010375 | Ga0105239_10918939 | Ga0105239_109189391 | 255 |
| 314 | 3300013296 | Ga0157374_10032645 | Ga0157374_100326453 | 255 |
| 315 | 3300013297 | Ga0157378_10109432 | Ga0157378_101094322 | 255 |
| 316 | 3300013306 | Ga0163162_10057629 | Ga0163162_100576292 | 255 |
| 317 | 3300013307 | Ga0157372_10178951 | Ga0157372_101789512 | 255 |
| 318 | 3300013308 | Ga0157375_10034942 | Ga0157375_100349424 | 255 |
| 319 | 3300014325 | Ga0163163_10407057 | Ga0163163_104070572 | 255 |
| 320 | 3300014968 | Ga0157379_10070381 | Ga0157379_100703812 | 255 |
| 321 | 3300014969 | Ga0157376_10077266 | Ga0157376_100772663 | 255 |
| 322 | 3300017792 | Ga0163161_10031787 | Ga0163161_100317874 | 255 |
| 323 | 3300021361 | Ga0213872_10135504 | Ga0213872_101355041 | 255 |
| 324 | 3300024225 | Ga0224572_1003138 | Ga0224572_10031383 | 255 |
| 325 | 3300025297 | Ga0209758_1000669 | Ga0209758_100066932 | 255 |
| 326 | 3300025315 | Ga0207697_10084983 | Ga0207697_100849832 | 255 |
| 327 | 3300025321 | Ga0207656_10011934 | Ga0207656_100119343 | 255 |
| 328 | 3300025893 | Ga0207682_10051692 | Ga0207682_100516922 | 255 |
| 329 | 3300025898 | Ga0207692_10037952 | Ga0207692_100379522 | 255 |
| 330 | 3300025899 | Ga0207642_10028785 | Ga0207642_100287852 | 255 |
| 331 | 3300025901 | Ga0207688_10001397 | Ga0207688_100013975 | 255 |
| 332 | 3300025903 | Ga0207680_10291286 | Ga0207680_102912862 | 255 |
| 333 | 3300025903 | Ga0207680_10424909 | Ga0207680_104249091 | 255 |
| 334 | 3300025907 | Ga0207645_10008224 | Ga0207645_100082245 | 255 |
| 335 | 3300025908 | Ga0207643_10002323 | Ga0207643_100023236 | 255 |
| 336 | 3300025909 | Ga0207705_10072088 | Ga0207705_100720882 | 255 |
| 337 | 3300025911 | Ga0207654_10035548 | Ga0207654_100355483 | 255 |
| 338 | 3300025915 | Ga0207693_10025550 | Ga0207693_100255504 | 255 |
| 339 | 3300025916 | Ga0207663_10283684 | Ga0207663_102836842 | 255 |
| 340 | 3300025918 | Ga0207662_10001015 | Ga0207662_100010153 | 255 |
| 341 | 3300025919 | Ga0207657_10009994 | Ga0207657_100099947 | 255 |
| 342 | 3300025924 | Ga0207694_10426427 | Ga0207694_104264272 | 255 |
| 343 | 3300025925 | Ga0207650_10045304 | Ga0207650_100453043 | 255 |
| 344 | 3300025926 | Ga0207659_10015880 | Ga0207659_100158804 | 255 |
| 345 | 3300025927 | Ga0207687_10039544 | Ga0207687_100395443 | 255 |
| 346 | 3300025927 | Ga0207687_10293700 | Ga0207687_102937001 | 255 |
| 347 | 3300025928 | Ga0207700_10349843 | Ga0207700_103498432 | 255 |
| 348 | 3300025931 | Ga0207644_10213698 | Ga0207644_102136982 | 255 |
| 349 | 3300025931 | Ga0207644_10270916 | Ga0207644_102709162 | 255 |
| 350 | 3300025933 | Ga0207706_10018825 | Ga0207706_100188254 | 255 |
| 351 | 3300025934 | Ga0207686_10035638 | Ga0207686_100356383 | 255 |
| 352 | 3300025935 | Ga0207709_10011693 | Ga0207709_100116934 | 255 |
| 353 | 3300025935 | Ga0207709_10100357 | Ga0207709_101003572 | 255 |
| 354 | 3300025936 | Ga0207670_10005305 | Ga0207670_100053053 | 255 |
| 355 | 3300025938 | Ga0207704_10006351 | Ga0207704_100063513 | 255 |
| 356 | 3300025938 | Ga0207704_10636328 | Ga0207704_106363281 | 255 |
| 357 | 3300025940 | Ga0207691_10007276 | Ga0207691_100072765 | 255 |
| 358 | 3300025942 | Ga0207689_10002382 | Ga0207689_100023827 | 255 |
| 359 | 3300025944 | Ga0207661_10241731 | Ga0207661_102417312 | 255 |
| 360 | 3300025945 | Ga0207679_10048595 | Ga0207679_100485953 | 255 |
| 361 | 3300025972 | Ga0207668_10069387 | Ga0207668_100693872 | 255 |
| 362 | 3300025981 | Ga0207640_10049873 | Ga0207640_100498733 | 255 |
| 363 | 3300025986 | Ga0207658_10023867 | Ga0207658_100238673 | 255 |
| 364 | 3300026023 | Ga0207677_10006221 | Ga0207677_100062214 | 255 |
| 365 | 3300026035 | Ga0207703_10003777 | Ga0207703_1000377710 | 255 |
| 366 | 3300026067 | Ga0207678_10047857 | Ga0207678_100478574 | 255 |
| 367 | 3300026075 | Ga0207708_10000538 | Ga0207708_100005386 | 255 |
| 368 | 3300026078 | Ga0207702_10023134 | Ga0207702_100231345 | 255 |
| 369 | 3300026089 | Ga0207648_10010145 | Ga0207648_100101453 | 255 |
| 370 | 3300026095 | Ga0207676_10016680 | Ga0207676_100166804 | 255 |
| 371 | 3300026116 | Ga0207674_10161272 | Ga0207674_101612722 | 255 |
| 372 | 3300026118 | Ga0207675_100007644 | Ga0207675_1000076443 | 255 |
| 373 | 3300026121 | Ga0207683_10023729 | Ga0207683_100237293 | 255 |
| 374 | 3300026121 | Ga0207683_10115505 | Ga0207683_101155052 | 255 |
| 375 | 3300026142 | Ga0207698_10002575 | Ga0207698_100025755 | 255 |
| 376 | 3300027512 | Ga0209179_1004188 | Ga0209179_10041881 | 255 |
| 377 | 3300027512 | Ga0209179_1030899 | Ga0209179_10308991 | 255 |
| 378 | 3300027671 | Ga0209588_1030863 | Ga0209588_10308632 | 255 |
| 379 | 3300028379 | Ga0268266_10172028 | Ga0268266_101720282 | 255 |
| 380 | 3300028380 | Ga0268265_10014615 | Ga0268265_100146153 | 255 |
| 381 | 3300028381 | Ga0268264_10022390 | Ga0268264_100223903 | 255 |
| 382 | 3300030763 | Ga0265763_1001871 | Ga0265763_10018712 | 255 |
| 383 | 3300031241 | Ga0265325_10000776 | Ga0265325_100007763 | 255 |
| 384 | 3300031247 | Ga0265340_10038322 | Ga0265340_100383223 | 255 |
| 385 | 3300035089 | Ga0373944_0069944 | Ga0373944_0069944_275_1042 | 255 |
| 386 | 3300035111 | Ga0373923_0075482 | Ga0373923_0075482_590_1357 | 255 |
| 387 | 3300035113 | Ga0373936_0115476 | Ga0373936_0115476_335_1102 | 255 |
| 388 | 3300035117 | Ga0373953_0030490 | Ga0373953_0030490_160_927 | 255 |
| 389 | 3300035172 | Ga0373955_0236855 | Ga0373955_0236855_32_799 | 255 |
| 390 | 3300035691 | Ga0373931_0011255 | Ga0373931_0011255_2810_3577 | 255 |
| 391 | 3300035695 | Ga0373927_0044071 | Ga0373927_0044071_1512_2279 | 255 |
| 392 | 3300035695 | Ga0373927_0044172 | Ga0373927_0044172_793_1560 | 255 |
| 393 | 3300035695 | Ga0373927_0080091 | Ga0373927_0080091_887_1654 | 255 |
| 394 | 3300036401 | Ga0373937_0691604 | Ga0373937_0691604_135_902 | 255 |
| 395 | 3300037068 | Ga0373925_0039718 | Ga0373925_0039718_1436_2203 | 255 |
| 396 | 3300039437 | Ga0436365_0461050 | Ga0436365_0461050_461_1228 | 255 |
| 397 | 3300039438 | Ga0436360_0052375 | Ga0436360_0052375_114_881 | 255 |
| 398 | 3300039438 | Ga0436360_1357001 | Ga0436360_1357001_479_1249 | 255 |
| 399 | 3300039447 | Ga0436361_0700316 | Ga0436361_0700316_7748_8518 | 255 |
| 400 | 3300039453 | Ga0436362_1049789 | Ga0436362_1049789_18_788 | 255 |
| 401 | 3300041512 | Ga0451853_0917328 | Ga0451853_0917328_880_1647 | 255 |
| 402 | 3300046460 | Ga0495638_0100144 | Ga0495638_0100144_95_862 | 255 |
| 403 | 3300046472 | Ga0495580_0078541 | Ga0495580_0078541_294_1061 | 255 |
| 404 | 3300046474 | Ga0495605_0117647 | Ga0495605_0117647_259_1026 | 255 |
| 405 | 3300046475 | Ga0495639_0043506 | Ga0495639_0043506_945_1712 | 255 |
| 406 | 3300046475 | Ga0495639_0087732 | Ga0495639_0087732_437_1204 | 255 |
| 407 | 3300046476 | Ga0495662_0024432 | Ga0495662_0024432_1319_2086 | 255 |
| 408 | 3300046491 | Ga0495584_0028229 | Ga0495584_0028229_675_1442 | 255 |
| 409 | 3300046491 | Ga0495584_0101499 | Ga0495584_0101499_303_1070 | 255 |
| 410 | 3300046499 | Ga0495594_0132280 | Ga0495594_0132280_292_1059 | 255 |
| 411 | 3300046517 | Ga0495630_0056017 | Ga0495630_0056017_1115_1882 | 255 |
| 412 | 3300046517 | Ga0495630_0365994 | Ga0495630_0365994_198_965 | 255 |
| 413 | 3300046529 | Ga0495652_0268997 | Ga0495652_0268997_192_959 | 255 |
| 414 | 3300046531 | Ga0495665_0068455 | Ga0495665_0068455_658_1425 | 255 |
| 415 | 3300046531 | Ga0495665_0089320 | Ga0495665_0089320_800_1567 | 255 |
| 416 | 3300046531 | Ga0495665_0303002 | Ga0495665_0303002_12_779 | 255 |
| 417 | 3300046538 | Ga0495609_0124346 | Ga0495609_0124346_289_1056 | 255 |
| 418 | 3300046557 | Ga0495622_0218845 | Ga0495622_0218845_14_781 | 255 |
| 419 | 3300046558 | Ga0495633_0090047 | Ga0495633_0090047_400_1167 | 255 |
| 420 | 3300046559 | Ga0495667_0089941 | Ga0495667_0089941_412_1179 | 255 |
| 421 | 3300046615 | Ga0495656_0044203 | Ga0495656_0044203_538_1305 | 255 |
| 422 | 3300046616 | Ga0495668_0122496 | Ga0495668_0122496_79_846 | 255 |
| 423 | 3300046664 | Ga0495659_0028434 | Ga0495659_0028434_1101_1868 | 255 |
| 424 | 3300046665 | Ga0495661_0032055 | Ga0495661_0032055_42_809 | 255 |
| 425 | 3300046674 | Ga0495588_0110414 | Ga0495588_0110414_322_1089 | 255 |
| 426 | 3300046684 | Ga0495669_0105685 | Ga0495669_0105685_403_1170 | 255 |
| 427 | 3300046689 | Ga0495613_0189415 | Ga0495613_0189415_428_1195 | 255 |
| 428 | 3300046690 | Ga0495624_0092665 | Ga0495624_0092665_200_967 | 255 |
| 429 | 3300046690 | Ga0495624_0313991 | Ga0495624_0313991_157_924 | 255 |
| 430 | 3300046810 | Ga0495660_0168364 | Ga0495660_0168364_56_823 | 255 |
| 431 | 3300047315 | Ga0495581_0103889 | Ga0495581_0103889_23_790 | 255 |
| 432 | 3300047315 | Ga0495581_0137346 | Ga0495581_0137346_566_1333 | 255 |
| 433 | 3300047472 | Ga0495686_0237648 | Ga0495686_0237648_231_998 | 255 |
| 434 | 3300047673 | Ga0495593_0070311 | Ga0495593_0070311_425_1192 | 255 |
| 435 | 3300048088 | Ga0495602_0399003 | Ga0495602_0399003_204_971 | 255 |
| 436 | 3300048903 | Ga0496100_0015505 | Ga0496100_0015505_1464_2231 | 255 |
| 437 | 3300048903 | Ga0496100_0037822 | Ga0496100_0037822_1232_1999 | 255 |
| 438 | 3300048903 | Ga0496100_0288813 | Ga0496100_0288813_145_912 | 255 |
| 439 | 3300048904 | Ga0496101_0041464 | Ga0496101_0041464_2002_2769 | 255 |
| 440 | 3300048904 | Ga0496101_0335197 | Ga0496101_0335197_202_969 | 255 |
| 441 | 3300048904 | Ga0496101_0361485 | Ga0496101_0361485_359_1126 | 255 |
| 442 | 3300048905 | Ga0496102_0047703 | Ga0496102_0047703_719_1486 | 255 |
| 443 | 3300048905 | Ga0496102_0081426 | Ga0496102_0081426_1291_2058 | 255 |
| 444 | 3300048905 | Ga0496102_0654408 | Ga0496102_0654408_193_960 | 255 |
| 445 | 3300048906 | Ga0496103_0000608 | Ga0496103_0000608_10971_11738 | 255 |
| 446 | 3300048907 | Ga0496104_0001288 | Ga0496104_0001288_19518_20285 | 255 |
| 447 | 3300048907 | Ga0496104_0002212 | Ga0496104_0002212_9210_9977 | 255 |
| 448 | 3300048907 | Ga0496104_0067132 | Ga0496104_0067132_887_1654 | 255 |
| 449 | 3300048907 | Ga0496104_0085442 | Ga0496104_0085442_1336_2103 | 255 |
| 450 | 3300048907 | Ga0496104_0097338 | Ga0496104_0097338_165_932 | 255 |
| 451 | 3300048908 | Ga0496105_0019993 | Ga0496105_0019993_2675_3442 | 255 |
| 452 | 3300048908 | Ga0496105_0059956 | Ga0496105_0059956_909_1676 | 255 |
| 453 | 3300048908 | Ga0496105_0142723 | Ga0496105_0142723_1187_1954 | 255 |
| 454 | 3300048908 | Ga0496105_0540346 | Ga0496105_0540346_118_885 | 255 |
| 455 | 3300048909 | Ga0496106_0285505 | Ga0496106_0285505_455_1222 | 255 |
| 456 | 3300048909 | Ga0496106_0583840 | Ga0496106_0583840_47_814 | 255 |
| 457 | 3300048910 | Ga0496107_0007970 | Ga0496107_0007970_5509_6276 | 255 |
| 458 | 3300048910 | Ga0496107_0230896 | Ga0496107_0230896_288_1055 | 255 |
| 459 | 3300048911 | Ga0496108_0023856 | Ga0496108_0023856_2805_3572 | 255 |
| 460 | 3300048911 | Ga0496108_0085865 | Ga0496108_0085865_69_836 | 255 |
| 461 | 3300048912 | Ga0496109_0010314 | Ga0496109_0010314_101_868 | 255 |
| 462 | 3300048912 | Ga0496109_0145855 | Ga0496109_0145855_45_812 | 255 |
| 463 | 3300048913 | Ga0496110_0061628 | Ga0496110_0061628_69_836 | 255 |
| 464 | 3300048913 | Ga0496110_0296235 | Ga0496110_0296235_69_836 | 255 |
| 465 | 3300048914 | Ga0496111_0000865 | Ga0496111_0000865_3249_4016 | 255 |
| 466 | 3300048914 | Ga0496111_0065384 | Ga0496111_0065384_766_1533 | 255 |
| 467 | 3300048914 | Ga0496111_0474103 | Ga0496111_0474103_117_884 | 255 |
| 468 | 3300048915 | Ga0496112_0000113 | Ga0496112_0000113_48813_49580 | 255 |
| 469 | 3300048915 | Ga0496112_0060235 | Ga0496112_0060235_909_1676 | 255 |
| 470 | 3300048915 | Ga0496112_0514420 | Ga0496112_0514420_96_866 | 255 |
| 471 | 3300048916 | Ga0496113_0016061 | Ga0496113_0016061_2502_3269 | 255 |
| 472 | 3300048916 | Ga0496113_0020728 | Ga0496113_0020728_1796_2563 | 255 |
| 473 | 3300048916 | Ga0496113_0038776 | Ga0496113_0038776_1594_2361 | 255 |
| 474 | 3300048917 | Ga0496114_0005029 | Ga0496114_0005029_5763_6530 | 255 |
| 475 | 3300048917 | Ga0496114_0011378 | Ga0496114_0011378_3996_4763 | 255 |
| 476 | 3300048918 | Ga0496115_0007156 | Ga0496115_0007156_1656_2423 | 255 |
| 477 | 3300048918 | Ga0496115_0012056 | Ga0496115_0012056_3383_4150 | 255 |
| 478 | 3300048927 | Ga0496124_0000080 | Ga0496124_0000080_143896_144732 | 255 |
| 479 | 3300049571 | Ga0501034_0439921 | Ga0501034_0439921_88_855 | 255 |
| 480 | 3300049571 | Ga0501034_0533743 | Ga0501034_0533743_22_789 | 255 |
| 481 | 3300049582 | Ga0501048_0053621 | Ga0501048_0053621_1848_2615 | 255 |
| 482 | 3300049588 | Ga0501072_0136155 | Ga0501072_0136155_464_1231 | 255 |
| 483 | 3300049590 | Ga0501074_0418253 | Ga0501074_0418253_129_896 | 255 |
| 484 | 3300049593 | Ga0501077_0099108 | Ga0501077_0099108_179_946 | 255 |
| 485 | 3300049741 | Ga0501079_0269073 | Ga0501079_0269073_518_1285 | 255 |
| 486 | 3300049743 | Ga0501081_0332657 | Ga0501081_0332657_325_1092 | 255 |
| 487 | 3300050489 | nmdc:mga03683_87718_c1 | nmdc:mga03683_87718_c1_547_1314 | 255 |
| 488 | 3300050492 | nmdc:mga0yw44_111041_c1 | nmdc:mga0yw44_111041_c1_474_1241 | 255 |
| 489 | 3300050492 | nmdc:mga0yw44_17733_c1 | nmdc:mga0yw44_17733_c1_230_997 | 255 |
| 490 | 3300050492 | nmdc:mga0yw44_447125_c1 | nmdc:mga0yw44_447125_c1_42_812 | 255 |
| 491 | 3300050493 | nmdc:mga0k408_10377_c1 | nmdc:mga0k408_10377_c1_2493_3260 | 255 |
| 492 | 3300050493 | nmdc:mga0k408_132455_c1 | nmdc:mga0k408_132455_c1_290_1057 | 255 |
| 493 | 3300050493 | nmdc:mga0k408_137122_c1 | nmdc:mga0k408_137122_c1_13_780 | 255 |
| 494 | 3300050493 | nmdc:mga0k408_167193_c1 | nmdc:mga0k408_167193_c1_352_1122 | 255 |
| 495 | 3300050507 | nmdc:mga05p37_11140_c1 | nmdc:mga05p37_11140_c1_1608_2375 | 255 |
| 496 | 3300050507 | nmdc:mga05p37_253468_c1 | nmdc:mga05p37_253468_c1_1113_1880 | 255 |
| 497 | 3300050507 | nmdc:mga05p37_324898_c1 | nmdc:mga05p37_324898_c1_165_932 | 255 |
| 498 | 3300050507 | nmdc:mga05p37_645454_c1 | nmdc:mga05p37_645454_c1_392_1162 | 255 |
| 499 | 3300050508 | nmdc:mga09592_126622_c1 | nmdc:mga09592_126622_c1_659_1426 | 255 |
| 500 | 3300050509 | nmdc:mga0qj67_157469_c1 | nmdc:mga0qj67_157469_c1_775_1542 | 255 |
| 501 | 3300050509 | nmdc:mga0qj67_210845_c1 | nmdc:mga0qj67_210845_c1_272_1039 | 255 |
| 502 | 3300050510 | nmdc:mga06r32_158679_c1 | nmdc:mga06r32_158679_c1_986_1753 | 255 |
| 503 | 3300050510 | nmdc:mga06r32_579172_c1 | nmdc:mga06r32_579172_c1_168_935 | 255 |
| 504 | 3300050512 | nmdc:mga0n895_134863_c1 | nmdc:mga0n895_134863_c1_1681_2448 | 255 |
| 505 | 3300050512 | nmdc:mga0n895_353093_c1 | nmdc:mga0n895_353093_c1_413_1183 | 255 |
| 506 | 3300050516 | nmdc:mga0sz30_58700_c1 | nmdc:mga0sz30_58700_c1_745_1515 | 255 |
| 507 | 3300053077 | Ga0495601_0158395 | Ga0495601_0158395_384_1151 | 255 |
| 508 | 3300053078 | Ga0495612_0048971 | Ga0495612_0048971_436_1203 | 255 |
| 509 | 3300053085 | Ga0495619_0050737 | Ga0495619_0050737_952_1719 | 255 |
| 510 | 3300053085 | Ga0495619_0093229 | Ga0495619_0093229_1174_1941 | 255 |
| 511 | 3300053119 | Ga0500595_012826 | Ga0500595_012826_2196_2966 | 255 |
| 512 | 3300053130 | Ga0500642_0133490 | Ga0500642_0133490_362_1129 | 255 |
| 513 | 3300053131 | Ga0500652_000086 | Ga0500652_000086_9239_10009 | 255 |
| 514 | 3300053177 | Ga0500636_0000262 | Ga0500636_0000262_11435_12271 | 255 |
| 515 | 3300060353 | Ga0501082_0181355 | Ga0501082_0181355_334_1101 | 255 |
| 516 | 3300061734 | Ga0530510_0185625 | Ga0530510_0185625_508_1275 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
82
253
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.8366 | 61 | 249 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7723 | 47 | 249 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7562 | 63 | 249 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7464 | 61 | 237 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.7409 | 20 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.925 | 54 | 247 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9167 | 58 | 249 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.916 | 54 | 247 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9093 | 61 | 246 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.896 | 56 | 251 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5S5CJ07-F1-model_v4 | Sulfonate transport system permease protein | 0.9502 | 9 | 255 |
GO:0005886
GO:0055085 |
| AF-K6Q0B9-F1-model_v4 | ABC-type nitrate/sulfonate/bicarbonate transport system, permease component | 0.9468 | 9 | 255 |
GO:0005886
GO:0010438 GO:0055085 |
| AF-A0A222VS71-F1-model_v4 | NitT/TauT family transport system permease protein | 0.9466 | 6 | 255 |
GO:0005886
GO:0010438 GO:0055085 |
| AF-A0A2W4K9D9-F1-model_v4 | deleted | 0.9454 | 6 | 255 |
|
| AF-A0A2W4KQ75-F1-model_v4 | ABC transporter permease | 0.9448 | 9 | 255 |
GO:0005886
GO:0010438 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar