F457965

General Info

Members Datasets Scaffolds Average Seq Length
516 302 516 253

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100774492|Ga0070713_1007744921
Length 257
Sequence MKQKPMSDKTIERLLYLVSPIGLLILWQLLLMAGFGDRRFIPAPSDIAVRFVQMIGSGELALHTAVTLWRIAAGYVIGAVPAVAVGLLMAMFRPVRLFFDPLIAALFPIPKVALMPLLLLAFGFGDASKIALVAIAVFFPVIVNTYVGAANIDKIYWDVARNYGASQTVLFTRIVFFGALPMIFAGLRIALAVSFIVLVAAEFVATKAGIGYLIWNSWELLQVDVMFVGIVTIGILGLISSALFQEIERKVIPWKGE

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.14
Nodule 0
Rhizoplane 12.98
Rhizosphere 76.94
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002172 3300001976 Bacteria 2621
2 JGI24750J21931_1002705 3300002070 Bacteria 2127
3 JGI24745J21846_1000482 3300002073 Bacteria 3543
4 JGI24748J21848_1005378 3300002074 Bacteria 1485
5 JGI24033J26618_1001870 3300002155 Bacteria 2107
6 JGI24742J22300_10001734 3300002244 Bacteria 3472
7 JGI25406J46586_10024782 3300003203 Bacteria 2344
8 JGI25153J46596_10002988 3300003215 Bacteria 9569
9 JGI25405J52794_10038742 3300003911 Bacteria 1004
10 Ga0070658_10724690 3300005327 Bacteria 863
11 Ga0070683_100595713 3300005329 Bacteria 1058
12 Ga0070690_100101341 3300005330 Bacteria 1910
13 Ga0070690_100403347 3300005330 Bacteria 1004
14 Ga0070670_100070279 3300005331 Bacteria 3006
15 Ga0070670_100158450 3300005331 Bacteria 1961
16 Ga0068869_100047516 3300005334 Bacteria 3100
17 Ga0068869_100151529 3300005334 Bacteria 1799
18 Ga0070666_10089060 3300005335 Bacteria 2118
19 Ga0070666_10180100 3300005335 Bacteria 1482
20 Ga0070682_100246467 3300005337 Bacteria 1286
21 Ga0068868_100010725 3300005338 Bacteria 6642
22 Ga0070689_100005881 3300005340 Bacteria 8432
23 Ga0070689_100012062 3300005340 Bacteria 6212
24 Ga0070687_100009448 3300005343 Bacteria 4180
25 Ga0070687_100191860 3300005343 Bacteria 1232
26 Ga0070692_10170096 3300005345 Bacteria 1255
27 Ga0070668_100081158 3300005347 Bacteria 2542
28 Ga0070675_100036033 3300005354 Bacteria 4024
29 Ga0070671_100012193 3300005355 Bacteria 6918
30 Ga0070674_100019589 3300005356 Bacteria 4302
31 Ga0070674_100107147 3300005356 Bacteria 2046
32 Ga0070673_100341047 3300005364 Bacteria 1328
33 Ga0070673_100376826 3300005364 Bacteria 1264
34 Ga0070688_100009968 3300005365 Bacteria 5221
35 Ga0070688_100037269 3300005365 Bacteria 2962
36 Ga0070688_100287503 3300005365 Bacteria 1184
37 Ga0070659_100089447 3300005366 Bacteria 2466
38 Ga0070667_100032811 3300005367 Bacteria 4333
39 Ga0070667_100209504 3300005367 Bacteria 1732
40 Ga0070703_10098719 3300005406 Bacteria 1026
41 Ga0070713_100109688 3300005436 Bacteria 2405
42 Ga0070713_100774492 3300005436 Bacteria 919
43 Ga0070710_10519587 3300005437 Bacteria 818
44 Ga0070701_10007970 3300005438 Bacteria 4557
45 Ga0070711_100090313 3300005439 Bacteria 2206
46 Ga0070705_100204827 3300005440 Bacteria 1355
47 Ga0070700_100002888 3300005441 Bacteria 8828
48 Ga0070700_100236685 3300005441 Bacteria 1302
49 Ga0070663_100734243 3300005455 Bacteria 842
50 Ga0070678_100109757 3300005456 Bacteria 2156
51 Ga0068867_100027139 3300005459 Bacteria 4114
52 Ga0070685_10006217 3300005466 Bacteria 6081
53 Ga0070685_10319252 3300005466 Bacteria 1052
54 Ga0070698_100492348 3300005471 Bacteria 1163
55 Ga0070679_100051306 3300005530 Bacteria 4108
56 Ga0070672_100011894 3300005543 Bacteria 6083
57 Ga0070672_100116840 3300005543 Bacteria 2180
58 Ga0070686_100008164 3300005544 Bacteria 5858
59 Ga0070695_100315837 3300005545 Bacteria 1160
60 Ga0070693_100041984 3300005547 Bacteria 2576
61 Ga0070693_100136449 3300005547 Bacteria 1540
62 Ga0070665_100176923 3300005548 Bacteria 2135
63 Ga0070664_100009753 3300005564 Bacteria 7783
64 Ga0068857_100213829 3300005577 Bacteria 1760
65 Ga0068854_100014771 3300005578 Bacteria 5155
66 Ga0068854_100612495 3300005578 Bacteria 931
67 Ga0068856_100046810 3300005614 Bacteria 4260
68 Ga0070702_100274246 3300005615 Bacteria 1155
69 Ga0068852_100746878 3300005616 Unclassified 990
70 Ga0068859_100076334 3300005617 Bacteria 3391
71 Ga0068859_100440603 3300005617 Bacteria 1399
72 Ga0068859_100477936 3300005617 Bacteria 1341
73 Ga0068859_100512544 3300005617 Bacteria 1294
74 Ga0068864_100015532 3300005618 Bacteria 6331
75 Ga0068866_10015228 3300005718 Bacteria 3413
76 Ga0068851_10019357 3300005834 Bacteria 3288
77 Ga0068870_10008699 3300005840 Bacteria 4577
78 Ga0068870_10162445 3300005840 Bacteria 1326
79 Ga0068863_100073949 3300005841 Bacteria 3224
80 Ga0068863_100514457 3300005841 Bacteria 1180
81 Ga0068858_100012156 3300005842 Bacteria 8117
82 Ga0068860_100077696 3300005843 Bacteria 3157
83 Ga0068862_100027550 3300005844 Bacteria 4783
84 Ga0068862_100240800 3300005844 Bacteria 1645
85 Ga0068862_100366592 3300005844 Bacteria 1340
86 Ga0068862_100475630 3300005844 Bacteria 1182
87 Ga0081455_10006523 3300005937 Bacteria 12495
88 Ga0081455_10012142 3300005937 Bacteria 8607
89 Ga0081455_10041860 3300005937 Bacteria 4024
90 Ga0081455_10117503 3300005937 Bacteria 2102
91 Ga0081538_10052543 3300005981 Bacteria 2433
92 Ga0081538_10074182 3300005981 Bacteria 1853
93 Ga0081540_1000002 3300005983 Bacteria 251149
94 Ga0081540_1013123 3300005983 Bacteria 5409
95 Ga0081540_1065235 3300005983 Bacteria 1713
96 Ga0081539_10000785 3300005985 Bacteria 61844
97 Ga0081539_10041457 3300005985 Bacteria 2690
98 Ga0070717_10245942 3300006028 Bacteria 1579
99 Ga0075365_10012280 3300006038 Bacteria 5078
100 Ga0075365_10038149 3300006038 Bacteria 3121
101 Ga0075365_10150366 3300006038 Bacteria 1620
102 Ga0075365_10180645 3300006038 Bacteria 1475
103 Ga0075365_10201998 3300006038 Bacteria 1392
104 Ga0075365_10264076 3300006038 Bacteria 1210
105 Ga0075365_10346451 3300006038 Bacteria 1047
106 Ga0075368_10057050 3300006042 Bacteria 1558
107 Ga0075364_10131578 3300006051 Bacteria 1679
108 Ga0075364_10162118 3300006051 Bacteria 1509
109 Ga0070715_10099074 3300006163 Bacteria 1356
110 Ga0070715_10175463 3300006163 Bacteria 1071
111 Ga0070716_100076413 3300006173 Bacteria 1985
112 Ga0070716_100472680 3300006173 Bacteria 919
113 Ga0070712_100043732 3300006175 Bacteria 3085
114 Ga0070712_100147369 3300006175 Bacteria 1803
115 Ga0070712_100602865 3300006175 Bacteria 930
116 Ga0075362_10088795 3300006177 Bacteria 1432
117 Ga0075362_10098134 3300006177 Bacteria 1367
118 Ga0075362_10130640 3300006177 Bacteria 1194
119 Ga0075367_10053359 3300006178 Bacteria 2395
120 Ga0075367_10126105 3300006178 Bacteria 1580
121 Ga0075367_10258647 3300006178 Bacteria 1092
122 Ga0075367_10308572 3300006178 Bacteria 996
123 Ga0075366_10000736 3300006195 Bacteria 15582
124 Ga0075366_10048049 3300006195 Bacteria 2530
125 Ga0097621_100086658 3300006237 Bacteria 2614
126 Ga0097621_100191249 3300006237 Bacteria 1772
127 Ga0097621_100525847 3300006237 Bacteria 1074
128 Ga0075370_10152274 3300006353 Bacteria 1355
129 Ga0068871_100095019 3300006358 Bacteria 2489
130 Ga0068871_100385224 3300006358 Bacteria 1246
131 Ga0068871_100404115 3300006358 Bacteria 1217
132 Ga0075428_100104592 3300006844 Bacteria 3087
133 Ga0075428_100137078 3300006844 Bacteria 2661
134 Ga0075428_100287038 3300006844 Bacteria 1770
135 Ga0075430_100207164 3300006846 Bacteria 1627
136 Ga0075431_100191821 3300006847 Bacteria 2093
137 Ga0075431_100401633 3300006847 Bacteria 1371
138 Ga0075433_10027293 3300006852 Bacteria 4840
139 Ga0075434_100266037 3300006871 Bacteria 1734
140 Ga0075429_100291566 3300006880 Bacteria 1428
141 Ga0068865_100020686 3300006881 Bacteria 4270
142 Ga0068865_100676363 3300006881 Bacteria 880
143 Ga0097620_100076336 3300006931 Bacteria 3391
144 Ga0097620_100440512 3300006931 Bacteria 1399
145 Ga0097620_100477942 3300006931 Bacteria 1341
146 Ga0097620_100512562 3300006931 Bacteria 1294
147 Ga0099794_10041496 3300007265 Bacteria 2191
148 Ga0099795_10000869 3300007788 Bacteria 6050
149 Ga0099795_10002805 3300007788 Bacteria 4195
150 Ga0099795_10012379 3300007788 Bacteria 2585
151 Ga0099795_10185380 3300007788 Bacteria 871
152 Ga0105250_10120802 3300009092 Bacteria 1077
153 Ga0111539_10223206 3300009094 Bacteria 2194
154 Ga0105245_10001109 3300009098 Bacteria 24346
155 Ga0105245_10202149 3300009098 Bacteria 1908
156 Ga0105247_10149586 3300009101 Bacteria 1537
157 Ga0105247_10348649 3300009101 Bacteria 1041
158 Ga0105247_10362320 3300009101 Bacteria 1023
159 Ga0114129_10081766 3300009147 Bacteria 4490
160 Ga0114129_10108303 3300009147 Bacteria 3836
161 Ga0114129_10221714 3300009147 Bacteria 2550
162 Ga0114129_10383522 3300009147 Bacteria 1855
163 Ga0105243_10229254 3300009148 Bacteria 1647
164 Ga0105243_10793805 3300009148 Bacteria 932
165 Ga0105241_10289423 3300009174 Bacteria 1402
166 Ga0105242_10035307 3300009176 Bacteria 4009
167 Ga0105242_10055767 3300009176 Bacteria 3233
168 Ga0105242_10862992 3300009176 Bacteria 902
169 Ga0105248_10024108 3300009177 Bacteria 6762
170 Ga0105248_10090827 3300009177 Bacteria 3439
171 Ga0105237_10323295 3300009545 Bacteria 1546
172 Ga0105238_10185061 3300009551 Bacteria 2059
173 Ga0105238_10510100 3300009551 Bacteria 1204
174 Ga0105249_10111981 3300009553 Bacteria 2581
175 Ga0105249_10449039 3300009553 Bacteria 1328
176 Ga0105249_10838463 3300009553 Bacteria 984
177 Ga0105239_10918939 3300010375 Bacteria 1005
178 Ga0157374_10032645 3300013296 Bacteria 4742
179 Ga0157378_10109432 3300013297 Bacteria 2531
180 Ga0157378_10534137 3300013297 Bacteria 1176
181 Ga0157378_10695375 3300013297 Bacteria 1036
182 Ga0163162_10057629 3300013306 Bacteria 3913
183 Ga0163162_10513206 3300013306 Bacteria 1328
184 Ga0157372_10178951 3300013307 Bacteria 2455
185 Ga0157375_10034942 3300013308 Bacteria 4793
186 Ga0157375_10770099 3300013308 Bacteria 1113
187 Ga0163163_10077687 3300014325 Bacteria 3315
188 Ga0163163_10149460 3300014325 Bacteria 2380
189 Ga0163163_10407057 3300014325 Bacteria 1419
190 Ga0163163_10797550 3300014325 Bacteria 1008
191 Ga0163163_11244006 3300014325 Bacteria 807
192 Ga0157380_10308184 3300014326 Bacteria 1462
193 Ga0157379_10070381 3300014968 Bacteria 3130
194 Ga0157376_10077266 3300014969 Bacteria 2847
195 Ga0157376_10664102 3300014969 Bacteria 1044
196 Ga0163161_10031787 3300017792 Bacteria 3763
197 Ga0213872_10135504 3300021361 Bacteria 1083
198 Ga0213876_10232964 3300021384 Bacteria 979
199 Ga0213876_10262658 3300021384 Unclassified 917
200 Ga0224572_1003138 3300024225 Bacteria 2764
201 Ga0209758_1000669 3300025297 Bacteria 51286
202 Ga0207697_10084983 3300025315 Bacteria 1336
203 Ga0207656_10011934 3300025321 Bacteria 3294
204 Ga0207682_10051692 3300025893 Bacteria 1702
205 Ga0207692_10037952 3300025898 Bacteria 2359
206 Ga0207642_10028785 3300025899 Bacteria 2292
207 Ga0207710_10256065 3300025900 Bacteria 876
208 Ga0207688_10001397 3300025901 Bacteria 12574
209 Ga0207688_10087273 3300025901 Bacteria 1788
210 Ga0207680_10291286 3300025903 Bacteria 1136
211 Ga0207680_10424909 3300025903 Bacteria 941
212 Ga0207645_10008224 3300025907 Bacteria 7296
213 Ga0207643_10002323 3300025908 Bacteria 10345
214 Ga0207643_10083299 3300025908 Bacteria 1855
215 Ga0207705_10072088 3300025909 Bacteria 2505
216 Ga0207654_10035548 3300025911 Bacteria 2777
217 Ga0207693_10025550 3300025915 Bacteria 4682
218 Ga0207693_10267506 3300025915 Bacteria 1340
219 Ga0207663_10075467 3300025916 Bacteria 2188
220 Ga0207663_10283684 3300025916 Bacteria 1231
221 Ga0207662_10001015 3300025918 Bacteria 13138
222 Ga0207662_10069116 3300025918 Bacteria 2134
223 Ga0207657_10009994 3300025919 Bacteria 9497
224 Ga0207652_10080944 3300025921 Bacteria 2840
225 Ga0207694_10028341 3300025924 Bacteria 4269
226 Ga0207694_10426427 3300025924 Bacteria 1105
227 Ga0207650_10045304 3300025925 Bacteria 3236
228 Ga0207650_10494372 3300025925 Bacteria 1022
229 Ga0207659_10015880 3300025926 Bacteria 4892
230 Ga0207659_10052138 3300025926 Bacteria 2913
231 Ga0207687_10039544 3300025927 Bacteria 3230
232 Ga0207687_10293700 3300025927 Bacteria 1307
233 Ga0207687_10441343 3300025927 Bacteria 1078
234 Ga0207700_10349843 3300025928 Bacteria 1287
235 Ga0207644_10174608 3300025931 Bacteria 1680
236 Ga0207644_10213698 3300025931 Bacteria 1526
237 Ga0207644_10270916 3300025931 Bacteria 1360
238 Ga0207706_10018825 3300025933 Bacteria 6210
239 Ga0207686_10035638 3300025934 Bacteria 2988
240 Ga0207709_10011693 3300025935 Bacteria 4840
241 Ga0207709_10100357 3300025935 Bacteria 1912
242 Ga0207670_10005305 3300025936 Bacteria 7060
243 Ga0207670_10013634 3300025936 Bacteria 4799
244 Ga0207704_10006351 3300025938 Bacteria 5507
245 Ga0207704_10636328 3300025938 Bacteria 877
246 Ga0207691_10007276 3300025940 Bacteria 10676
247 Ga0207711_10015614 3300025941 Bacteria 6300
248 Ga0207689_10002382 3300025942 Bacteria 17544
249 Ga0207689_10025175 3300025942 Bacteria 4988
250 Ga0207661_10241731 3300025944 Bacteria 1602
251 Ga0207679_10048595 3300025945 Bacteria 3090
252 Ga0207679_10835009 3300025945 Bacteria 841
253 Ga0207651_10244315 3300025960 Bacteria 1465
254 Ga0207668_10069387 3300025972 Bacteria 2509
255 Ga0207640_10049873 3300025981 Bacteria 2712
256 Ga0207658_10023867 3300025986 Bacteria 4273
257 Ga0207658_10263156 3300025986 Bacteria 1471
258 Ga0207677_10006221 3300026023 Bacteria 6527
259 Ga0207703_10003777 3300026035 Bacteria 12589
260 Ga0207639_10521650 3300026041 Bacteria 1088
261 Ga0207678_10047857 3300026067 Bacteria 3697
262 Ga0207678_10123031 3300026067 Bacteria 2214
263 Ga0207708_10000538 3300026075 Bacteria 29294
264 Ga0207702_10023134 3300026078 Bacteria 5154
265 Ga0207641_10800622 3300026088 Bacteria 932
266 Ga0207648_10010145 3300026089 Bacteria 8957
267 Ga0207676_10016680 3300026095 Bacteria 5319
268 Ga0207676_10120772 3300026095 Bacteria 2209
269 Ga0207674_10022628 3300026116 Bacteria 6746
270 Ga0207674_10161272 3300026116 Bacteria 2196
271 Ga0207675_100007644 3300026118 Bacteria 10207
272 Ga0207683_10023729 3300026121 Bacteria 5277
273 Ga0207683_10115505 3300026121 Bacteria 2406
274 Ga0207698_10002575 3300026142 Bacteria 10769
275 Ga0209179_1004188 3300027512 Bacteria 2157
276 Ga0209179_1030899 3300027512 Bacteria 1096
277 Ga0209588_1030863 3300027671 Bacteria 1713
278 Ga0268266_10172028 3300028379 Bacteria 1966
279 Ga0268265_10014615 3300028380 Bacteria 5352
280 Ga0268265_10082599 3300028380 Bacteria 2541
281 Ga0268264_10022390 3300028381 Bacteria 5161
282 Ga0265763_1001871 3300030763 Bacteria 1557
283 Ga0265332_10015872 3300031238 Bacteria 3323
284 Ga0265328_10021066 3300031239 Bacteria 2492
285 Ga0265320_10062116 3300031240 Bacteria 1779
286 Ga0265325_10000776 3300031241 Bacteria 23122
287 Ga0265325_10028504 3300031241 Bacteria 3009
288 Ga0265329_10037489 3300031242 Bacteria 1561
289 Ga0265340_10030931 3300031247 Bacteria 2680
290 Ga0265340_10038322 3300031247 Bacteria 2371
291 Ga0265316_10044739 3300031344 Bacteria 3518
292 Ga0265313_10007706 3300031595 Bacteria 7293
293 Ga0265314_10035312 3300031711 Bacteria 3645
294 Ga0265342_10007941 3300031712 Bacteria 7697
295 Ga0373938_0020976 3300034957 Bacteria 1321
296 Ga0373944_0069944 3300035089 Bacteria 1141
297 Ga0373923_0075482 3300035111 Unclassified 1455
298 Ga0373936_0085473 3300035113 Bacteria 1317
299 Ga0373936_0115476 3300035113 Unclassified 1143
300 Ga0373945_0158167 3300035116 Bacteria 922
301 Ga0373953_0030490 3300035117 Bacteria 2092
302 Ga0373956_0227278 3300035119 Bacteria 886
303 Ga0373957_0168577 3300035120 Bacteria 904
304 Ga0373946_0101145 3300035171 Bacteria 1293
305 Ga0373955_0236855 3300035172 Bacteria 1093
306 Ga0373942_0013344 3300035207 Bacteria 1975
307 Ga0373961_0049151 3300035241 Bacteria 1245
308 Ga0373961_0083706 3300035241 Bacteria 1007
309 Ga0373931_0011255 3300035691 Bacteria 4321
310 Ga0373931_0035135 3300035691 Bacteria 2604
311 Ga0373931_0246287 3300035691 Bacteria 1085
312 Ga0373927_0019105 3300035695 Bacteria 4495
313 Ga0373927_0044071 3300035695 Bacteria 2887
314 Ga0373927_0044172 3300035695 Bacteria 2883
315 Ga0373927_0080091 3300035695 Bacteria 2116
316 Ga0373927_0183505 3300035695 Bacteria 1373
317 Ga0373947_0384606 3300035725 Bacteria 945
318 Ga0373937_0018953 3300036401 Bacteria 6153
319 Ga0373937_0691604 3300036401 Bacteria 966
320 Ga0373925_0039718 3300037068 Bacteria 3482
321 Ga0373925_0308986 3300037068 Bacteria 1278
322 Ga0395900_0778255 3300037418 Bacteria 886
323 Ga0395898_0293242 3300037466 Bacteria 1552
324 Ga0395905_0249010 3300037471 Bacteria 1660
325 Ga0436364_1382860 3300037853 Bacteria 2246
326 Ga0436365_0461050 3300039437 Bacteria 1426
327 Ga0436365_0809061 3300039437 Bacteria 2321
328 Ga0436365_1429287 3300039437 Bacteria 3207
329 Ga0436360_0036314 3300039438 Bacteria 1023
330 Ga0436360_0052375 3300039438 Bacteria 954
331 Ga0436360_1357001 3300039438 Bacteria 1297
332 Ga0436361_0700316 3300039447 Bacteria 10826
333 Ga0436363_0741798 3300039450 Bacteria 723
334 Ga0436362_1049789 3300039453 Bacteria 819
335 Ga0451853_0917328 3300041512 Bacteria 1933
336 Ga0466968_0264768 3300044735 Bacteria 819
337 Ga0495603_0250402 3300046455 Bacteria 1020
338 Ga0495638_0100144 3300046460 Bacteria 1734
339 Ga0495580_0078541 3300046472 Bacteria 2302
340 Ga0495605_0033665 3300046474 Bacteria 2599
341 Ga0495605_0117647 3300046474 Unclassified 1207
342 Ga0495639_0043506 3300046475 Bacteria 2029
343 Ga0495639_0087732 3300046475 Bacteria 1456
344 Ga0495662_0024432 3300046476 Bacteria 2916
345 Ga0495584_0028229 3300046491 Bacteria 2843
346 Ga0495584_0101499 3300046491 Bacteria 1454
347 Ga0495594_0132280 3300046499 Bacteria 1413
348 Ga0495628_0148107 3300046516 Bacteria 1789
349 Ga0495630_0056017 3300046517 Bacteria 2954
350 Ga0495630_0113169 3300046517 Unclassified 2056
351 Ga0495630_0365994 3300046517 Bacteria 1104
352 Ga0495652_0268997 3300046529 Bacteria 1254
353 Ga0495665_0068455 3300046531 Bacteria 1872
354 Ga0495665_0089320 3300046531 Bacteria 1619
355 Ga0495665_0303002 3300046531 Bacteria 818
356 Ga0495640_0004790 3300046533 Bacteria 10769
357 Ga0495609_0124346 3300046538 Unclassified 1108
358 Ga0495622_0218845 3300046557 Unclassified 844
359 Ga0495633_0090047 3300046558 Bacteria 1426
360 Ga0495667_0089941 3300046559 Bacteria 1990
361 Ga0495656_0044203 3300046615 Bacteria 1874
362 Ga0495668_0122496 3300046616 Unclassified 1423
363 Ga0495634_0013278 3300046642 Bacteria 5953
364 Ga0495659_0028434 3300046664 Bacteria 1935
365 Ga0495659_0088638 3300046664 Unclassified 1185
366 Ga0495661_0032055 3300046665 Bacteria 3326
367 Ga0495588_0110414 3300046674 Bacteria 1448
368 Ga0495669_0105685 3300046684 Bacteria 1311
369 Ga0495613_0189415 3300046689 Bacteria 1454
370 Ga0495613_0247882 3300046689 Bacteria 1244
371 Ga0495624_0092665 3300046690 Bacteria 1863
372 Ga0495624_0313991 3300046690 Bacteria 944
373 Ga0495660_0168364 3300046810 Unclassified 1069
374 Ga0495581_0103889 3300047315 Bacteria 1651
375 Ga0495581_0137346 3300047315 Bacteria 1425
376 Ga0495636_0053556 3300047318 Bacteria 1694
377 Ga0495674_0520943 3300047319 Bacteria 949
378 Ga0495686_0237648 3300047472 Bacteria 1029
379 Ga0495593_0070311 3300047673 Bacteria 1819
380 Ga0495602_0143651 3300048088 Bacteria 1886
381 Ga0495602_0399003 3300048088 Bacteria 981
382 Ga0496100_0013721 3300048903 Bacteria 4684
383 Ga0496100_0015505 3300048903 Bacteria 4452
384 Ga0496100_0028316 3300048903 Bacteria 3455
385 Ga0496100_0037822 3300048903 Bacteria 3054
386 Ga0496100_0288813 3300048903 Bacteria 1225
387 Ga0496101_0004425 3300048904 Bacteria 8841
388 Ga0496101_0041464 3300048904 Bacteria 3282
389 Ga0496101_0335197 3300048904 Bacteria 1187
390 Ga0496101_0361485 3300048904 Bacteria 1141
391 Ga0496102_0047703 3300048905 Bacteria 3893
392 Ga0496102_0058891 3300048905 Bacteria 3511
393 Ga0496102_0081426 3300048905 Bacteria 2985
394 Ga0496102_0121862 3300048905 Bacteria 2436
395 Ga0496102_0654408 3300048905 Bacteria 974
396 Ga0496103_0000608 3300048906 Bacteria 27999
397 Ga0496103_0124869 3300048906 Bacteria 1641
398 Ga0496104_0001288 3300048907 Bacteria 21610
399 Ga0496104_0002212 3300048907 Bacteria 16814
400 Ga0496104_0053967 3300048907 Bacteria 3798
401 Ga0496104_0067132 3300048907 Bacteria 3406
402 Ga0496104_0085442 3300048907 Bacteria 3011
403 Ga0496104_0097338 3300048907 Bacteria 2816
404 Ga0496104_0439558 3300048907 Bacteria 1216
405 Ga0496105_0019993 3300048908 Bacteria 5404
406 Ga0496105_0049092 3300048908 Bacteria 3483
407 Ga0496105_0059956 3300048908 Bacteria 3139
408 Ga0496105_0087103 3300048908 Bacteria 2581
409 Ga0496105_0138353 3300048908 Bacteria 2005
410 Ga0496105_0142723 3300048908 Bacteria 1970
411 Ga0496105_0540346 3300048908 Bacteria 911
412 Ga0496106_0052825 3300048909 Bacteria 3067
413 Ga0496106_0285505 3300048909 Bacteria 1322
414 Ga0496106_0583840 3300048909 Bacteria 896
415 Ga0496107_0007970 3300048910 Bacteria 7311
416 Ga0496107_0230896 3300048910 Bacteria 1377
417 Ga0496108_0016990 3300048911 Bacteria 5948
418 Ga0496108_0023856 3300048911 Bacteria 5035
419 Ga0496108_0047082 3300048911 Bacteria 3604
420 Ga0496108_0085865 3300048911 Bacteria 2671
421 Ga0496109_0010314 3300048912 Bacteria 7979
422 Ga0496109_0145855 3300048912 Bacteria 2214
423 Ga0496109_0337372 3300048912 Bacteria 1423
424 Ga0496109_0347424 3300048912 Bacteria 1401
425 Ga0496110_0029781 3300048913 Bacteria 4702
426 Ga0496110_0061628 3300048913 Bacteria 3311
427 Ga0496110_0189447 3300048913 Bacteria 1868
428 Ga0496110_0296235 3300048913 Bacteria 1473
429 Ga0496111_0000865 3300048914 Bacteria 16411
430 Ga0496111_0065384 3300048914 Bacteria 2639
431 Ga0496111_0474103 3300048914 Bacteria 922
432 Ga0496112_0000113 3300048915 Bacteria 50217
433 Ga0496112_0060235 3300048915 Bacteria 3740
434 Ga0496112_0068680 3300048915 Bacteria 3500
435 Ga0496112_0160796 3300048915 Bacteria 2212
436 Ga0496112_0514420 3300048915 Bacteria 1132
437 Ga0496113_0016061 3300048916 Bacteria 5166
438 Ga0496113_0020728 3300048916 Bacteria 4627
439 Ga0496113_0038776 3300048916 Bacteria 3504
440 Ga0496113_0081680 3300048916 Bacteria 2478
441 Ga0496114_0005029 3300048917 Bacteria 10315
442 Ga0496114_0011378 3300048917 Bacteria 7108
443 Ga0496114_0033499 3300048917 Bacteria 4233
444 Ga0496115_0007156 3300048918 Bacteria 8195
445 Ga0496115_0012056 3300048918 Bacteria 6499
446 Ga0496115_0014555 3300048918 Bacteria 5954
447 Ga0496115_0057727 3300048918 Bacteria 3122
448 Ga0496115_0181346 3300048918 Bacteria 1740
449 Ga0496124_0000080 3300048927 Bacteria 210439
450 Ga0496126_0324111 3300048929 Bacteria 1266
451 Ga0501033_0022694 3300049570 Bacteria 4733
452 Ga0501034_0439921 3300049571 Bacteria 1223
453 Ga0501034_0533743 3300049571 Bacteria 1084
454 Ga0501039_0243190 3300049575 Bacteria 1415
455 Ga0501042_0222086 3300049578 Bacteria 1363
456 Ga0501047_0011841 3300049581 Bacteria 8249
457 Ga0501048_0053621 3300049582 Bacteria 2867
458 Ga0501070_0009469 3300049586 Bacteria 8235
459 Ga0501071_0109358 3300049587 Bacteria 2042
460 Ga0501072_0018748 3300049588 Bacteria 5336
461 Ga0501072_0136155 3300049588 Bacteria 1958
462 Ga0501074_0418253 3300049590 Bacteria 951
463 Ga0501076_0352532 3300049592 Bacteria 1208
464 Ga0501077_0099108 3300049593 Bacteria 1847
465 Ga0501077_0259295 3300049593 Bacteria 1106
466 Ga0501079_0269073 3300049741 Bacteria 1332
467 Ga0501081_0332657 3300049743 Bacteria 1118
468 Ga0501083_0184386 3300049744 Bacteria 1362
469 Ga0501044_0005732 3300049823 Bacteria 13757
470 Ga0501045_0045422 3300049824 Bacteria 3198
471 nmdc:mga03683_30746_c1 3300050489 Bacteria 2150
472 nmdc:mga03683_87718_c1 3300050489 Bacteria 1352
473 nmdc:mga03n38_135030_c1 3300050490 Bacteria 1227
474 nmdc:mga03n38_187152_c1 3300050490 Bacteria 1064
475 nmdc:mga0yw44_111041_c1 3300050492 Bacteria 1757
476 nmdc:mga0yw44_17733_c1 3300050492 Bacteria 3882
477 nmdc:mga0yw44_447125_c1 3300050492 Bacteria 876
478 nmdc:mga0yw44_552194_c1 3300050492 Unclassified 782
479 nmdc:mga0k408_10377_c1 3300050493 Bacteria 5039
480 nmdc:mga0k408_132455_c1 3300050493 Bacteria 1480
481 nmdc:mga0k408_137122_c1 3300050493 Bacteria 1454
482 nmdc:mga0k408_167193_c1 3300050493 Bacteria 1311
483 nmdc:mga0k408_97952_c1 3300050493 Bacteria 1728
484 nmdc:mga06z11_19229_c1 3300050494 Bacteria 3135
485 nmdc:mga07m45_356990_c1 3300050496 Bacteria 849
486 nmdc:mga05p37_11140_c1 3300050507 Bacteria 10205
487 nmdc:mga05p37_253468_c1 3300050507 Bacteria 2110
488 nmdc:mga05p37_324898_c1 3300050507 Bacteria 1820
489 nmdc:mga05p37_645454_c1 3300050507 Bacteria 1186
490 nmdc:mga09592_126622_c1 3300050508 Bacteria 2196
491 nmdc:mga0qj67_157469_c1 3300050509 Bacteria 1844
492 nmdc:mga0qj67_210845_c1 3300050509 Bacteria 1578
493 nmdc:mga06r32_158679_c1 3300050510 Bacteria 2244
494 nmdc:mga06r32_579172_c1 3300050510 Bacteria 1095
495 nmdc:mga08y16_419351_c1 3300050511 Bacteria 1368
496 nmdc:mga0n895_134863_c1 3300050512 Bacteria 2495
497 nmdc:mga0n895_229928_c1 3300050512 Bacteria 1882
498 nmdc:mga0n895_353093_c1 3300050512 Bacteria 1489
499 nmdc:mga0rr50_10141_c1 3300050513 Bacteria 5963
500 nmdc:mga0sz30_58700_c1 3300050516 Bacteria 1641
501 Ga0495601_0158395 3300053077 Bacteria 1479
502 Ga0495601_0245678 3300053077 Bacteria 1169
503 Ga0495601_0336533 3300053077 Bacteria 982
504 Ga0495612_0048971 3300053078 Bacteria 1733
505 Ga0495595_0128448 3300053084 Bacteria 1237
506 Ga0495619_0011795 3300053085 Bacteria 5505
507 Ga0495619_0050737 3300053085 Bacteria 2740
508 Ga0495619_0093229 3300053085 Bacteria 2041
509 Ga0500595_012826 3300053119 Bacteria 3226
510 Ga0500642_0133490 3300053130 Bacteria 1164
511 Ga0500652_000086 3300053131 Bacteria 38984
512 Ga0500636_0000262 3300053177 Bacteria 29181
513 Ga0501084_0099380 3300054114 Bacteria 2443
514 Ga0501082_0063940 3300060353 Bacteria 3168
515 Ga0501082_0181355 3300060353 Bacteria 1831
516 Ga0530510_0185625 3300061734 Bacteria 1543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_552194_c1 nmdc:mga0yw44_552194_c1_22_672 216
2 3300013297 Ga0157378_10695375 Ga0157378_106953751 217
3 3300006051 Ga0075364_10162118 Ga0075364_101621181 221
4 3300014969 Ga0157376_10664102 Ga0157376_106641022 226
5 3300039450 Ga0436363_0741798 Ga0436363_0741798_24_704 226
6 3300044735 Ga0466968_0264768 Ga0466968_0264768_114_794 226
7 3300048915 Ga0496112_0160796 Ga0496112_0160796_1513_2193 226
8 3300048913 Ga0496110_0189447 Ga0496110_0189447_335_1102 237
9 3300006195 Ga0075366_10048049 Ga0075366_100480493 238
10 3300050490 nmdc:mga03n38_135030_c1 nmdc:mga03n38_135030_c1_75_833 238
11 3300050493 nmdc:mga0k408_97952_c1 nmdc:mga0k408_97952_c1_26_784 238
12 3300006177 Ga0075362_10088795 Ga0075362_100887952 241
13 3300006178 Ga0075367_10126105 Ga0075367_101261051 241
14 3300037466 Ga0395898_0293242 Ga0395898_0293242_61_819 241
15 3300046664 Ga0495659_0088638 Ga0495659_0088638_450_1175 241
16 3300049570 Ga0501033_0022694 Ga0501033_0022694_586_1356 241
17 3300049581 Ga0501047_0011841 Ga0501047_0011841_2098_2868 241
18 3300049586 Ga0501070_0009469 Ga0501070_0009469_4908_5678 241
19 3300049823 Ga0501044_0005732 Ga0501044_0005732_2099_2869 241
20 3300050489 nmdc:mga03683_30746_c1 nmdc:mga03683_30746_c1_1270_2070 241
21 3300050494 nmdc:mga06z11_19229_c1 nmdc:mga06z11_19229_c1_1692_2492 241
22 3300005406 Ga0070703_10098719 Ga0070703_100987191 243
23 3300005844 Ga0068862_100366592 Ga0068862_1003665922 244
24 3300009553 Ga0105249_10838463 Ga0105249_108384631 244
25 3300014325 Ga0163163_10797550 Ga0163163_107975502 244
26 3300037418 Ga0395900_0778255 Ga0395900_0778255_59_829 244
27 3300037471 Ga0395905_0249010 Ga0395905_0249010_317_1087 244
28 3300005983 Ga0081540_1000002 Ga0081540_1000002147 246
29 3300050496 nmdc:mga07m45_356990_c1 nmdc:mga07m45_356990_c1_12_782 246
30 3300050511 nmdc:mga08y16_419351_c1 nmdc:mga08y16_419351_c1_491_1258 246
31 3300050512 nmdc:mga0n895_229928_c1 nmdc:mga0n895_229928_c1_280_1047 246
32 3300050513 nmdc:mga0rr50_10141_c1 nmdc:mga0rr50_10141_c1_765_1532 246
33 3300003203 JGI25406J46586_10024782 JGI25406J46586_100247823 251
34 3300005331 Ga0070670_100070279 Ga0070670_1000702793 251
35 3300005334 Ga0068869_100151529 Ga0068869_1001515291 251
36 3300005437 Ga0070710_10519587 Ga0070710_105195871 251
37 3300005466 Ga0070685_10319252 Ga0070685_103192522 251
38 3300005617 Ga0068859_100512544 Ga0068859_1005125442 251
39 3300005844 Ga0068862_100475630 Ga0068862_1004756302 251
40 3300005985 Ga0081539_10000785 Ga0081539_1000078514 251
41 3300005985 Ga0081539_10041457 Ga0081539_100414573 251
42 3300006931 Ga0097620_100512562 Ga0097620_1005125622 251
43 3300009101 Ga0105247_10362320 Ga0105247_103623201 251
44 3300009176 Ga0105242_10862992 Ga0105242_108629922 251
45 3300009551 Ga0105238_10185061 Ga0105238_101850612 251
46 3300009553 Ga0105249_10449039 Ga0105249_104490392 251
47 3300013308 Ga0157375_10770099 Ga0157375_107700992 251
48 3300014325 Ga0163163_10149460 Ga0163163_101494603 251
49 3300014325 Ga0163163_11244006 Ga0163163_112440061 251
50 3300014326 Ga0157380_10308184 Ga0157380_103081842 251
51 3300021384 Ga0213876_10232964 Ga0213876_102329642 251
52 3300025918 Ga0207662_10069116 Ga0207662_100691162 251
53 3300025924 Ga0207694_10028341 Ga0207694_100283412 251
54 3300025925 Ga0207650_10494372 Ga0207650_104943722 251
55 3300025942 Ga0207689_10025175 Ga0207689_100251754 251
56 3300025945 Ga0207679_10835009 Ga0207679_108350091 251
57 3300025986 Ga0207658_10263156 Ga0207658_102631562 251
58 3300026041 Ga0207639_10521650 Ga0207639_105216502 251
59 3300026095 Ga0207676_10120772 Ga0207676_101207723 251
60 3300026116 Ga0207674_10022628 Ga0207674_100226281 251
61 3300031238 Ga0265332_10015872 Ga0265332_100158722 251
62 3300031239 Ga0265328_10021066 Ga0265328_100210663 251
63 3300031240 Ga0265320_10062116 Ga0265320_100621162 251
64 3300031241 Ga0265325_10028504 Ga0265325_100285042 251
65 3300031242 Ga0265329_10037489 Ga0265329_100374893 251
66 3300031247 Ga0265340_10030931 Ga0265340_100309312 251
67 3300031344 Ga0265316_10044739 Ga0265316_100447393 251
68 3300031595 Ga0265313_10007706 Ga0265313_100077064 251
69 3300031711 Ga0265314_10035312 Ga0265314_100353124 251
70 3300031712 Ga0265342_10007941 Ga0265342_100079416 251
71 3300039437 Ga0436365_1429287 Ga0436365_1429287_2211_2966 251
72 3300046474 Ga0495605_0033665 Ga0495605_0033665_1784_2539 251
73 3300049744 Ga0501083_0184386 Ga0501083_0184386_532_1287 251
74 3300005340 Ga0070689_100012062 Ga0070689_1000120622 252
75 3300005343 Ga0070687_100191860 Ga0070687_1001918602 252
76 3300005356 Ga0070674_100107147 Ga0070674_1001071472 252
77 3300005364 Ga0070673_100341047 Ga0070673_1003410472 252
78 3300005365 Ga0070688_100009968 Ga0070688_1000099684 252
79 3300005439 Ga0070711_100090313 Ga0070711_1000903132 252
80 3300005441 Ga0070700_100236685 Ga0070700_1002366851 252
81 3300005455 Ga0070663_100734243 Ga0070663_1007342431 252
82 3300005547 Ga0070693_100136449 Ga0070693_1001364492 252
83 3300005578 Ga0068854_100612495 Ga0068854_1006124951 252
84 3300005617 Ga0068859_100477936 Ga0068859_1004779362 252
85 3300005840 Ga0068870_10162445 Ga0068870_101624452 252
86 3300005841 Ga0068863_100514457 Ga0068863_1005144571 252
87 3300005844 Ga0068862_100240800 Ga0068862_1002408002 252
88 3300006163 Ga0070715_10175463 Ga0070715_101754632 252
89 3300006173 Ga0070716_100076413 Ga0070716_1000764132 252
90 3300006173 Ga0070716_100472680 Ga0070716_1004726802 252
91 3300006175 Ga0070712_100043732 Ga0070712_1000437321 252
92 3300006177 Ga0075362_10098134 Ga0075362_100981341 252
93 3300006931 Ga0097620_100477942 Ga0097620_1004779422 252
94 3300009101 Ga0105247_10149586 Ga0105247_101495862 252
95 3300009148 Ga0105243_10793805 Ga0105243_107938051 252
96 3300009177 Ga0105248_10024108 Ga0105248_100241082 252
97 3300013297 Ga0157378_10534137 Ga0157378_105341372 252
98 3300013306 Ga0163162_10513206 Ga0163162_105132062 252
99 3300014325 Ga0163163_10077687 Ga0163163_100776874 252
100 3300021384 Ga0213876_10262658 Ga0213876_102626581 252
101 3300025900 Ga0207710_10256065 Ga0207710_102560652 252
102 3300025901 Ga0207688_10087273 Ga0207688_100872732 252
103 3300025908 Ga0207643_10083299 Ga0207643_100832992 252
104 3300025915 Ga0207693_10267506 Ga0207693_102675061 252
105 3300025916 Ga0207663_10075467 Ga0207663_100754671 252
106 3300025926 Ga0207659_10052138 Ga0207659_100521382 252
107 3300025927 Ga0207687_10441343 Ga0207687_104413432 252
108 3300025931 Ga0207644_10174608 Ga0207644_101746082 252
109 3300025936 Ga0207670_10013634 Ga0207670_100136342 252
110 3300025941 Ga0207711_10015614 Ga0207711_100156142 252
111 3300025960 Ga0207651_10244315 Ga0207651_102443152 252
112 3300026067 Ga0207678_10123031 Ga0207678_101230313 252
113 3300026088 Ga0207641_10800622 Ga0207641_108006222 252
114 3300028380 Ga0268265_10082599 Ga0268265_100825992 252
115 3300034957 Ga0373938_0020976 Ga0373938_0020976_325_1083 252
116 3300035113 Ga0373936_0085473 Ga0373936_0085473_524_1282 252
117 3300035116 Ga0373945_0158167 Ga0373945_0158167_38_796 252
118 3300035119 Ga0373956_0227278 Ga0373956_0227278_11_769 252
119 3300035120 Ga0373957_0168577 Ga0373957_0168577_120_878 252
120 3300035171 Ga0373946_0101145 Ga0373946_0101145_340_1098 252
121 3300035207 Ga0373942_0013344 Ga0373942_0013344_605_1363 252
122 3300035241 Ga0373961_0049151 Ga0373961_0049151_145_903 252
123 3300035241 Ga0373961_0083706 Ga0373961_0083706_31_789 252
124 3300035691 Ga0373931_0035135 Ga0373931_0035135_1797_2555 252
125 3300035691 Ga0373931_0246287 Ga0373931_0246287_20_778 252
126 3300035695 Ga0373927_0019105 Ga0373927_0019105_2522_3286 252
127 3300035695 Ga0373927_0183505 Ga0373927_0183505_445_1203 252
128 3300035725 Ga0373947_0384606 Ga0373947_0384606_76_840 252
129 3300036401 Ga0373937_0018953 Ga0373937_0018953_5203_5961 252
130 3300037068 Ga0373925_0308986 Ga0373925_0308986_218_976 252
131 3300037853 Ga0436364_1382860 Ga0436364_1382860_827_1585 252
132 3300039437 Ga0436365_0809061 Ga0436365_0809061_1381_2139 252
133 3300039438 Ga0436360_0036314 Ga0436360_0036314_176_934 252
134 3300046455 Ga0495603_0250402 Ga0495603_0250402_94_852 252
135 3300046516 Ga0495628_0148107 Ga0495628_0148107_327_1085 252
136 3300046517 Ga0495630_0113169 Ga0495630_0113169_175_933 252
137 3300046533 Ga0495640_0004790 Ga0495640_0004790_3693_4457 252
138 3300046642 Ga0495634_0013278 Ga0495634_0013278_2079_2843 252
139 3300046689 Ga0495613_0247882 Ga0495613_0247882_189_953 252
140 3300047318 Ga0495636_0053556 Ga0495636_0053556_149_907 252
141 3300047319 Ga0495674_0520943 Ga0495674_0520943_29_793 252
142 3300048088 Ga0495602_0143651 Ga0495602_0143651_361_1119 252
143 3300048903 Ga0496100_0013721 Ga0496100_0013721_1740_2498 252
144 3300048903 Ga0496100_0028316 Ga0496100_0028316_205_966 252
145 3300048904 Ga0496101_0004425 Ga0496101_0004425_3657_4415 252
146 3300048905 Ga0496102_0058891 Ga0496102_0058891_2157_2915 252
147 3300048905 Ga0496102_0121862 Ga0496102_0121862_28_786 252
148 3300048906 Ga0496103_0124869 Ga0496103_0124869_385_1143 252
149 3300048907 Ga0496104_0053967 Ga0496104_0053967_2784_3542 252
150 3300048907 Ga0496104_0439558 Ga0496104_0439558_317_1075 252
151 3300048908 Ga0496105_0049092 Ga0496105_0049092_2015_2773 252
152 3300048908 Ga0496105_0087103 Ga0496105_0087103_356_1114 252
153 3300048908 Ga0496105_0138353 Ga0496105_0138353_1135_1896 252
154 3300048909 Ga0496106_0052825 Ga0496106_0052825_614_1372 252
155 3300048911 Ga0496108_0016990 Ga0496108_0016990_3762_4520 252
156 3300048911 Ga0496108_0047082 Ga0496108_0047082_683_1441 252
157 3300048912 Ga0496109_0337372 Ga0496109_0337372_406_1164 252
158 3300048912 Ga0496109_0347424 Ga0496109_0347424_344_1102 252
159 3300048913 Ga0496110_0029781 Ga0496110_0029781_1353_2111 252
160 3300048915 Ga0496112_0068680 Ga0496112_0068680_1212_1970 252
161 3300048916 Ga0496113_0081680 Ga0496113_0081680_634_1392 252
162 3300048917 Ga0496114_0033499 Ga0496114_0033499_408_1166 252
163 3300048918 Ga0496115_0014555 Ga0496115_0014555_2030_2788 252
164 3300048918 Ga0496115_0057727 Ga0496115_0057727_1285_2046 252
165 3300048918 Ga0496115_0181346 Ga0496115_0181346_963_1721 252
166 3300048929 Ga0496126_0324111 Ga0496126_0324111_420_1178 252
167 3300050490 nmdc:mga03n38_187152_c1 nmdc:mga03n38_187152_c1_117_875 252
168 3300053077 Ga0495601_0245678 Ga0495601_0245678_266_1030 252
169 3300053077 Ga0495601_0336533 Ga0495601_0336533_180_938 252
170 3300053084 Ga0495595_0128448 Ga0495595_0128448_282_1040 252
171 3300053085 Ga0495619_0011795 Ga0495619_0011795_49_807 252
172 3300005471 Ga0070698_100492348 Ga0070698_1004923482 254
173 3300005530 Ga0070679_100051306 Ga0070679_1000513064 254
174 3300025921 Ga0207652_10080944 Ga0207652_100809441 254
175 3300049575 Ga0501039_0243190 Ga0501039_0243190_390_1160 254
176 3300049578 Ga0501042_0222086 Ga0501042_0222086_545_1309 254
177 3300049587 Ga0501071_0109358 Ga0501071_0109358_394_1164 254
178 3300049588 Ga0501072_0018748 Ga0501072_0018748_782_1552 254
179 3300049592 Ga0501076_0352532 Ga0501076_0352532_211_981 254
180 3300049593 Ga0501077_0259295 Ga0501077_0259295_34_798 254
181 3300049824 Ga0501045_0045422 Ga0501045_0045422_1788_2552 254
182 3300054114 Ga0501084_0099380 Ga0501084_0099380_1657_2427 254
183 3300060353 Ga0501082_0063940 Ga0501082_0063940_2374_3144 254
184 3300001976 JGI24752J21851_1002172 JGI24752J21851_10021722 255
185 3300002070 JGI24750J21931_1002705 JGI24750J21931_10027052 255
186 3300002073 JGI24745J21846_1000482 JGI24745J21846_10004822 255
187 3300002074 JGI24748J21848_1005378 JGI24748J21848_10053782 255
188 3300002155 JGI24033J26618_1001870 JGI24033J26618_10018702 255
189 3300002244 JGI24742J22300_10001734 JGI24742J22300_100017342 255
190 3300003215 JGI25153J46596_10002988 JGI25153J46596_1000298810 255
191 3300003911 JGI25405J52794_10038742 JGI25405J52794_100387422 255
192 3300005327 Ga0070658_10724690 Ga0070658_107246901 255
193 3300005329 Ga0070683_100595713 Ga0070683_1005957131 255
194 3300005330 Ga0070690_100101341 Ga0070690_1001013411 255
195 3300005330 Ga0070690_100403347 Ga0070690_1004033471 255
196 3300005331 Ga0070670_100158450 Ga0070670_1001584501 255
197 3300005334 Ga0068869_100047516 Ga0068869_1000475161 255
198 3300005335 Ga0070666_10089060 Ga0070666_100890602 255
199 3300005335 Ga0070666_10180100 Ga0070666_101801001 255
200 3300005337 Ga0070682_100246467 Ga0070682_1002464672 255
201 3300005338 Ga0068868_100010725 Ga0068868_1000107254 255
202 3300005340 Ga0070689_100005881 Ga0070689_1000058812 255
203 3300005343 Ga0070687_100009448 Ga0070687_1000094482 255
204 3300005345 Ga0070692_10170096 Ga0070692_101700962 255
205 3300005347 Ga0070668_100081158 Ga0070668_1000811581 255
206 3300005354 Ga0070675_100036033 Ga0070675_1000360332 255
207 3300005355 Ga0070671_100012193 Ga0070671_1000121934 255
208 3300005356 Ga0070674_100019589 Ga0070674_1000195892 255
209 3300005364 Ga0070673_100376826 Ga0070673_1003768262 255
210 3300005365 Ga0070688_100037269 Ga0070688_1000372692 255
211 3300005365 Ga0070688_100287503 Ga0070688_1002875031 255
212 3300005366 Ga0070659_100089447 Ga0070659_1000894472 255
213 3300005367 Ga0070667_100032811 Ga0070667_1000328112 255
214 3300005367 Ga0070667_100209504 Ga0070667_1002095042 255
215 3300005436 Ga0070713_100109688 Ga0070713_1001096883 255
216 3300005436 Ga0070713_100774492 Ga0070713_1007744921 255
217 3300005438 Ga0070701_10007970 Ga0070701_100079704 255
218 3300005440 Ga0070705_100204827 Ga0070705_1002048272 255
219 3300005441 Ga0070700_100002888 Ga0070700_1000028884 255
220 3300005456 Ga0070678_100109757 Ga0070678_1001097572 255
221 3300005459 Ga0068867_100027139 Ga0068867_1000271393 255
222 3300005466 Ga0070685_10006217 Ga0070685_100062174 255
223 3300005543 Ga0070672_100011894 Ga0070672_1000118943 255
224 3300005543 Ga0070672_100116840 Ga0070672_1001168402 255
225 3300005544 Ga0070686_100008164 Ga0070686_1000081642 255
226 3300005545 Ga0070695_100315837 Ga0070695_1003158372 255
227 3300005547 Ga0070693_100041984 Ga0070693_1000419842 255
228 3300005548 Ga0070665_100176923 Ga0070665_1001769232 255
229 3300005564 Ga0070664_100009753 Ga0070664_1000097535 255
230 3300005577 Ga0068857_100213829 Ga0068857_1002138292 255
231 3300005578 Ga0068854_100014771 Ga0068854_1000147714 255
232 3300005614 Ga0068856_100046810 Ga0068856_1000468102 255
233 3300005615 Ga0070702_100274246 Ga0070702_1002742462 255
234 3300005616 Ga0068852_100746878 Ga0068852_1007468782 255
235 3300005617 Ga0068859_100076334 Ga0068859_1000763343 255
236 3300005617 Ga0068859_100440603 Ga0068859_1004406032 255
237 3300005618 Ga0068864_100015532 Ga0068864_1000155325 255
238 3300005718 Ga0068866_10015228 Ga0068866_100152283 255
239 3300005834 Ga0068851_10019357 Ga0068851_100193574 255
240 3300005840 Ga0068870_10008699 Ga0068870_100086994 255
241 3300005841 Ga0068863_100073949 Ga0068863_1000739492 255
242 3300005842 Ga0068858_100012156 Ga0068858_1000121565 255
243 3300005843 Ga0068860_100077696 Ga0068860_1000776963 255
244 3300005844 Ga0068862_100027550 Ga0068862_1000275503 255
245 3300005937 Ga0081455_10006523 Ga0081455_100065238 255
246 3300005937 Ga0081455_10012142 Ga0081455_100121423 255
247 3300005937 Ga0081455_10041860 Ga0081455_100418602 255
248 3300005937 Ga0081455_10117503 Ga0081455_101175032 255
249 3300005981 Ga0081538_10052543 Ga0081538_100525433 255
250 3300005981 Ga0081538_10074182 Ga0081538_100741821 255
251 3300005983 Ga0081540_1013123 Ga0081540_10131236 255
252 3300005983 Ga0081540_1065235 Ga0081540_10652352 255
253 3300006028 Ga0070717_10245942 Ga0070717_102459422 255
254 3300006038 Ga0075365_10012280 Ga0075365_100122804 255
255 3300006038 Ga0075365_10038149 Ga0075365_100381492 255
256 3300006038 Ga0075365_10150366 Ga0075365_101503662 255
257 3300006038 Ga0075365_10180645 Ga0075365_101806452 255
258 3300006038 Ga0075365_10201998 Ga0075365_102019982 255
259 3300006038 Ga0075365_10264076 Ga0075365_102640762 255
260 3300006038 Ga0075365_10346451 Ga0075365_103464511 255
261 3300006042 Ga0075368_10057050 Ga0075368_100570501 255
262 3300006051 Ga0075364_10131578 Ga0075364_101315782 255
263 3300006163 Ga0070715_10099074 Ga0070715_100990742 255
264 3300006175 Ga0070712_100147369 Ga0070712_1001473691 255
265 3300006175 Ga0070712_100602865 Ga0070712_1006028651 255
266 3300006177 Ga0075362_10130640 Ga0075362_101306402 255
267 3300006178 Ga0075367_10053359 Ga0075367_100533594 255
268 3300006178 Ga0075367_10258647 Ga0075367_102586472 255
269 3300006178 Ga0075367_10308572 Ga0075367_103085721 255
270 3300006195 Ga0075366_10000736 Ga0075366_100007365 255
271 3300006237 Ga0097621_100086658 Ga0097621_1000866582 255
272 3300006237 Ga0097621_100191249 Ga0097621_1001912492 255
273 3300006237 Ga0097621_100525847 Ga0097621_1005258472 255
274 3300006353 Ga0075370_10152274 Ga0075370_101522741 255
275 3300006358 Ga0068871_100095019 Ga0068871_1000950192 255
276 3300006358 Ga0068871_100385224 Ga0068871_1003852242 255
277 3300006358 Ga0068871_100404115 Ga0068871_1004041152 255
278 3300006844 Ga0075428_100104592 Ga0075428_1001045921 255
279 3300006844 Ga0075428_100137078 Ga0075428_1001370783 255
280 3300006844 Ga0075428_100287038 Ga0075428_1002870382 255
281 3300006846 Ga0075430_100207164 Ga0075430_1002071642 255
282 3300006847 Ga0075431_100191821 Ga0075431_1001918212 255
283 3300006847 Ga0075431_100401633 Ga0075431_1004016332 255
284 3300006852 Ga0075433_10027293 Ga0075433_100272934 255
285 3300006871 Ga0075434_100266037 Ga0075434_1002660372 255
286 3300006880 Ga0075429_100291566 Ga0075429_1002915662 255
287 3300006881 Ga0068865_100020686 Ga0068865_1000206865 255
288 3300006881 Ga0068865_100676363 Ga0068865_1006763631 255
289 3300006931 Ga0097620_100076336 Ga0097620_1000763363 255
290 3300006931 Ga0097620_100440512 Ga0097620_1004405122 255
291 3300007265 Ga0099794_10041496 Ga0099794_100414962 255
292 3300007788 Ga0099795_10000869 Ga0099795_100008693 255
293 3300007788 Ga0099795_10002805 Ga0099795_100028052 255
294 3300007788 Ga0099795_10012379 Ga0099795_100123793 255
295 3300007788 Ga0099795_10185380 Ga0099795_101853801 255
296 3300009092 Ga0105250_10120802 Ga0105250_101208022 255
297 3300009094 Ga0111539_10223206 Ga0111539_102232062 255
298 3300009098 Ga0105245_10001109 Ga0105245_1000110927 255
299 3300009098 Ga0105245_10202149 Ga0105245_102021492 255
300 3300009101 Ga0105247_10348649 Ga0105247_103486492 255
301 3300009147 Ga0114129_10081766 Ga0114129_100817662 255
302 3300009147 Ga0114129_10108303 Ga0114129_101083034 255
303 3300009147 Ga0114129_10221714 Ga0114129_102217143 255
304 3300009147 Ga0114129_10383522 Ga0114129_103835222 255
305 3300009148 Ga0105243_10229254 Ga0105243_102292542 255
306 3300009174 Ga0105241_10289423 Ga0105241_102894231 255
307 3300009176 Ga0105242_10035307 Ga0105242_100353074 255
308 3300009176 Ga0105242_10055767 Ga0105242_100557672 255
309 3300009177 Ga0105248_10090827 Ga0105248_100908272 255
310 3300009545 Ga0105237_10323295 Ga0105237_103232952 255
311 3300009551 Ga0105238_10510100 Ga0105238_105101001 255
312 3300009553 Ga0105249_10111981 Ga0105249_101119812 255
313 3300010375 Ga0105239_10918939 Ga0105239_109189391 255
314 3300013296 Ga0157374_10032645 Ga0157374_100326453 255
315 3300013297 Ga0157378_10109432 Ga0157378_101094322 255
316 3300013306 Ga0163162_10057629 Ga0163162_100576292 255
317 3300013307 Ga0157372_10178951 Ga0157372_101789512 255
318 3300013308 Ga0157375_10034942 Ga0157375_100349424 255
319 3300014325 Ga0163163_10407057 Ga0163163_104070572 255
320 3300014968 Ga0157379_10070381 Ga0157379_100703812 255
321 3300014969 Ga0157376_10077266 Ga0157376_100772663 255
322 3300017792 Ga0163161_10031787 Ga0163161_100317874 255
323 3300021361 Ga0213872_10135504 Ga0213872_101355041 255
324 3300024225 Ga0224572_1003138 Ga0224572_10031383 255
325 3300025297 Ga0209758_1000669 Ga0209758_100066932 255
326 3300025315 Ga0207697_10084983 Ga0207697_100849832 255
327 3300025321 Ga0207656_10011934 Ga0207656_100119343 255
328 3300025893 Ga0207682_10051692 Ga0207682_100516922 255
329 3300025898 Ga0207692_10037952 Ga0207692_100379522 255
330 3300025899 Ga0207642_10028785 Ga0207642_100287852 255
331 3300025901 Ga0207688_10001397 Ga0207688_100013975 255
332 3300025903 Ga0207680_10291286 Ga0207680_102912862 255
333 3300025903 Ga0207680_10424909 Ga0207680_104249091 255
334 3300025907 Ga0207645_10008224 Ga0207645_100082245 255
335 3300025908 Ga0207643_10002323 Ga0207643_100023236 255
336 3300025909 Ga0207705_10072088 Ga0207705_100720882 255
337 3300025911 Ga0207654_10035548 Ga0207654_100355483 255
338 3300025915 Ga0207693_10025550 Ga0207693_100255504 255
339 3300025916 Ga0207663_10283684 Ga0207663_102836842 255
340 3300025918 Ga0207662_10001015 Ga0207662_100010153 255
341 3300025919 Ga0207657_10009994 Ga0207657_100099947 255
342 3300025924 Ga0207694_10426427 Ga0207694_104264272 255
343 3300025925 Ga0207650_10045304 Ga0207650_100453043 255
344 3300025926 Ga0207659_10015880 Ga0207659_100158804 255
345 3300025927 Ga0207687_10039544 Ga0207687_100395443 255
346 3300025927 Ga0207687_10293700 Ga0207687_102937001 255
347 3300025928 Ga0207700_10349843 Ga0207700_103498432 255
348 3300025931 Ga0207644_10213698 Ga0207644_102136982 255
349 3300025931 Ga0207644_10270916 Ga0207644_102709162 255
350 3300025933 Ga0207706_10018825 Ga0207706_100188254 255
351 3300025934 Ga0207686_10035638 Ga0207686_100356383 255
352 3300025935 Ga0207709_10011693 Ga0207709_100116934 255
353 3300025935 Ga0207709_10100357 Ga0207709_101003572 255
354 3300025936 Ga0207670_10005305 Ga0207670_100053053 255
355 3300025938 Ga0207704_10006351 Ga0207704_100063513 255
356 3300025938 Ga0207704_10636328 Ga0207704_106363281 255
357 3300025940 Ga0207691_10007276 Ga0207691_100072765 255
358 3300025942 Ga0207689_10002382 Ga0207689_100023827 255
359 3300025944 Ga0207661_10241731 Ga0207661_102417312 255
360 3300025945 Ga0207679_10048595 Ga0207679_100485953 255
361 3300025972 Ga0207668_10069387 Ga0207668_100693872 255
362 3300025981 Ga0207640_10049873 Ga0207640_100498733 255
363 3300025986 Ga0207658_10023867 Ga0207658_100238673 255
364 3300026023 Ga0207677_10006221 Ga0207677_100062214 255
365 3300026035 Ga0207703_10003777 Ga0207703_1000377710 255
366 3300026067 Ga0207678_10047857 Ga0207678_100478574 255
367 3300026075 Ga0207708_10000538 Ga0207708_100005386 255
368 3300026078 Ga0207702_10023134 Ga0207702_100231345 255
369 3300026089 Ga0207648_10010145 Ga0207648_100101453 255
370 3300026095 Ga0207676_10016680 Ga0207676_100166804 255
371 3300026116 Ga0207674_10161272 Ga0207674_101612722 255
372 3300026118 Ga0207675_100007644 Ga0207675_1000076443 255
373 3300026121 Ga0207683_10023729 Ga0207683_100237293 255
374 3300026121 Ga0207683_10115505 Ga0207683_101155052 255
375 3300026142 Ga0207698_10002575 Ga0207698_100025755 255
376 3300027512 Ga0209179_1004188 Ga0209179_10041881 255
377 3300027512 Ga0209179_1030899 Ga0209179_10308991 255
378 3300027671 Ga0209588_1030863 Ga0209588_10308632 255
379 3300028379 Ga0268266_10172028 Ga0268266_101720282 255
380 3300028380 Ga0268265_10014615 Ga0268265_100146153 255
381 3300028381 Ga0268264_10022390 Ga0268264_100223903 255
382 3300030763 Ga0265763_1001871 Ga0265763_10018712 255
383 3300031241 Ga0265325_10000776 Ga0265325_100007763 255
384 3300031247 Ga0265340_10038322 Ga0265340_100383223 255
385 3300035089 Ga0373944_0069944 Ga0373944_0069944_275_1042 255
386 3300035111 Ga0373923_0075482 Ga0373923_0075482_590_1357 255
387 3300035113 Ga0373936_0115476 Ga0373936_0115476_335_1102 255
388 3300035117 Ga0373953_0030490 Ga0373953_0030490_160_927 255
389 3300035172 Ga0373955_0236855 Ga0373955_0236855_32_799 255
390 3300035691 Ga0373931_0011255 Ga0373931_0011255_2810_3577 255
391 3300035695 Ga0373927_0044071 Ga0373927_0044071_1512_2279 255
392 3300035695 Ga0373927_0044172 Ga0373927_0044172_793_1560 255
393 3300035695 Ga0373927_0080091 Ga0373927_0080091_887_1654 255
394 3300036401 Ga0373937_0691604 Ga0373937_0691604_135_902 255
395 3300037068 Ga0373925_0039718 Ga0373925_0039718_1436_2203 255
396 3300039437 Ga0436365_0461050 Ga0436365_0461050_461_1228 255
397 3300039438 Ga0436360_0052375 Ga0436360_0052375_114_881 255
398 3300039438 Ga0436360_1357001 Ga0436360_1357001_479_1249 255
399 3300039447 Ga0436361_0700316 Ga0436361_0700316_7748_8518 255
400 3300039453 Ga0436362_1049789 Ga0436362_1049789_18_788 255
401 3300041512 Ga0451853_0917328 Ga0451853_0917328_880_1647 255
402 3300046460 Ga0495638_0100144 Ga0495638_0100144_95_862 255
403 3300046472 Ga0495580_0078541 Ga0495580_0078541_294_1061 255
404 3300046474 Ga0495605_0117647 Ga0495605_0117647_259_1026 255
405 3300046475 Ga0495639_0043506 Ga0495639_0043506_945_1712 255
406 3300046475 Ga0495639_0087732 Ga0495639_0087732_437_1204 255
407 3300046476 Ga0495662_0024432 Ga0495662_0024432_1319_2086 255
408 3300046491 Ga0495584_0028229 Ga0495584_0028229_675_1442 255
409 3300046491 Ga0495584_0101499 Ga0495584_0101499_303_1070 255
410 3300046499 Ga0495594_0132280 Ga0495594_0132280_292_1059 255
411 3300046517 Ga0495630_0056017 Ga0495630_0056017_1115_1882 255
412 3300046517 Ga0495630_0365994 Ga0495630_0365994_198_965 255
413 3300046529 Ga0495652_0268997 Ga0495652_0268997_192_959 255
414 3300046531 Ga0495665_0068455 Ga0495665_0068455_658_1425 255
415 3300046531 Ga0495665_0089320 Ga0495665_0089320_800_1567 255
416 3300046531 Ga0495665_0303002 Ga0495665_0303002_12_779 255
417 3300046538 Ga0495609_0124346 Ga0495609_0124346_289_1056 255
418 3300046557 Ga0495622_0218845 Ga0495622_0218845_14_781 255
419 3300046558 Ga0495633_0090047 Ga0495633_0090047_400_1167 255
420 3300046559 Ga0495667_0089941 Ga0495667_0089941_412_1179 255
421 3300046615 Ga0495656_0044203 Ga0495656_0044203_538_1305 255
422 3300046616 Ga0495668_0122496 Ga0495668_0122496_79_846 255
423 3300046664 Ga0495659_0028434 Ga0495659_0028434_1101_1868 255
424 3300046665 Ga0495661_0032055 Ga0495661_0032055_42_809 255
425 3300046674 Ga0495588_0110414 Ga0495588_0110414_322_1089 255
426 3300046684 Ga0495669_0105685 Ga0495669_0105685_403_1170 255
427 3300046689 Ga0495613_0189415 Ga0495613_0189415_428_1195 255
428 3300046690 Ga0495624_0092665 Ga0495624_0092665_200_967 255
429 3300046690 Ga0495624_0313991 Ga0495624_0313991_157_924 255
430 3300046810 Ga0495660_0168364 Ga0495660_0168364_56_823 255
431 3300047315 Ga0495581_0103889 Ga0495581_0103889_23_790 255
432 3300047315 Ga0495581_0137346 Ga0495581_0137346_566_1333 255
433 3300047472 Ga0495686_0237648 Ga0495686_0237648_231_998 255
434 3300047673 Ga0495593_0070311 Ga0495593_0070311_425_1192 255
435 3300048088 Ga0495602_0399003 Ga0495602_0399003_204_971 255
436 3300048903 Ga0496100_0015505 Ga0496100_0015505_1464_2231 255
437 3300048903 Ga0496100_0037822 Ga0496100_0037822_1232_1999 255
438 3300048903 Ga0496100_0288813 Ga0496100_0288813_145_912 255
439 3300048904 Ga0496101_0041464 Ga0496101_0041464_2002_2769 255
440 3300048904 Ga0496101_0335197 Ga0496101_0335197_202_969 255
441 3300048904 Ga0496101_0361485 Ga0496101_0361485_359_1126 255
442 3300048905 Ga0496102_0047703 Ga0496102_0047703_719_1486 255
443 3300048905 Ga0496102_0081426 Ga0496102_0081426_1291_2058 255
444 3300048905 Ga0496102_0654408 Ga0496102_0654408_193_960 255
445 3300048906 Ga0496103_0000608 Ga0496103_0000608_10971_11738 255
446 3300048907 Ga0496104_0001288 Ga0496104_0001288_19518_20285 255
447 3300048907 Ga0496104_0002212 Ga0496104_0002212_9210_9977 255
448 3300048907 Ga0496104_0067132 Ga0496104_0067132_887_1654 255
449 3300048907 Ga0496104_0085442 Ga0496104_0085442_1336_2103 255
450 3300048907 Ga0496104_0097338 Ga0496104_0097338_165_932 255
451 3300048908 Ga0496105_0019993 Ga0496105_0019993_2675_3442 255
452 3300048908 Ga0496105_0059956 Ga0496105_0059956_909_1676 255
453 3300048908 Ga0496105_0142723 Ga0496105_0142723_1187_1954 255
454 3300048908 Ga0496105_0540346 Ga0496105_0540346_118_885 255
455 3300048909 Ga0496106_0285505 Ga0496106_0285505_455_1222 255
456 3300048909 Ga0496106_0583840 Ga0496106_0583840_47_814 255
457 3300048910 Ga0496107_0007970 Ga0496107_0007970_5509_6276 255
458 3300048910 Ga0496107_0230896 Ga0496107_0230896_288_1055 255
459 3300048911 Ga0496108_0023856 Ga0496108_0023856_2805_3572 255
460 3300048911 Ga0496108_0085865 Ga0496108_0085865_69_836 255
461 3300048912 Ga0496109_0010314 Ga0496109_0010314_101_868 255
462 3300048912 Ga0496109_0145855 Ga0496109_0145855_45_812 255
463 3300048913 Ga0496110_0061628 Ga0496110_0061628_69_836 255
464 3300048913 Ga0496110_0296235 Ga0496110_0296235_69_836 255
465 3300048914 Ga0496111_0000865 Ga0496111_0000865_3249_4016 255
466 3300048914 Ga0496111_0065384 Ga0496111_0065384_766_1533 255
467 3300048914 Ga0496111_0474103 Ga0496111_0474103_117_884 255
468 3300048915 Ga0496112_0000113 Ga0496112_0000113_48813_49580 255
469 3300048915 Ga0496112_0060235 Ga0496112_0060235_909_1676 255
470 3300048915 Ga0496112_0514420 Ga0496112_0514420_96_866 255
471 3300048916 Ga0496113_0016061 Ga0496113_0016061_2502_3269 255
472 3300048916 Ga0496113_0020728 Ga0496113_0020728_1796_2563 255
473 3300048916 Ga0496113_0038776 Ga0496113_0038776_1594_2361 255
474 3300048917 Ga0496114_0005029 Ga0496114_0005029_5763_6530 255
475 3300048917 Ga0496114_0011378 Ga0496114_0011378_3996_4763 255
476 3300048918 Ga0496115_0007156 Ga0496115_0007156_1656_2423 255
477 3300048918 Ga0496115_0012056 Ga0496115_0012056_3383_4150 255
478 3300048927 Ga0496124_0000080 Ga0496124_0000080_143896_144732 255
479 3300049571 Ga0501034_0439921 Ga0501034_0439921_88_855 255
480 3300049571 Ga0501034_0533743 Ga0501034_0533743_22_789 255
481 3300049582 Ga0501048_0053621 Ga0501048_0053621_1848_2615 255
482 3300049588 Ga0501072_0136155 Ga0501072_0136155_464_1231 255
483 3300049590 Ga0501074_0418253 Ga0501074_0418253_129_896 255
484 3300049593 Ga0501077_0099108 Ga0501077_0099108_179_946 255
485 3300049741 Ga0501079_0269073 Ga0501079_0269073_518_1285 255
486 3300049743 Ga0501081_0332657 Ga0501081_0332657_325_1092 255
487 3300050489 nmdc:mga03683_87718_c1 nmdc:mga03683_87718_c1_547_1314 255
488 3300050492 nmdc:mga0yw44_111041_c1 nmdc:mga0yw44_111041_c1_474_1241 255
489 3300050492 nmdc:mga0yw44_17733_c1 nmdc:mga0yw44_17733_c1_230_997 255
490 3300050492 nmdc:mga0yw44_447125_c1 nmdc:mga0yw44_447125_c1_42_812 255
491 3300050493 nmdc:mga0k408_10377_c1 nmdc:mga0k408_10377_c1_2493_3260 255
492 3300050493 nmdc:mga0k408_132455_c1 nmdc:mga0k408_132455_c1_290_1057 255
493 3300050493 nmdc:mga0k408_137122_c1 nmdc:mga0k408_137122_c1_13_780 255
494 3300050493 nmdc:mga0k408_167193_c1 nmdc:mga0k408_167193_c1_352_1122 255
495 3300050507 nmdc:mga05p37_11140_c1 nmdc:mga05p37_11140_c1_1608_2375 255
496 3300050507 nmdc:mga05p37_253468_c1 nmdc:mga05p37_253468_c1_1113_1880 255
497 3300050507 nmdc:mga05p37_324898_c1 nmdc:mga05p37_324898_c1_165_932 255
498 3300050507 nmdc:mga05p37_645454_c1 nmdc:mga05p37_645454_c1_392_1162 255
499 3300050508 nmdc:mga09592_126622_c1 nmdc:mga09592_126622_c1_659_1426 255
500 3300050509 nmdc:mga0qj67_157469_c1 nmdc:mga0qj67_157469_c1_775_1542 255
501 3300050509 nmdc:mga0qj67_210845_c1 nmdc:mga0qj67_210845_c1_272_1039 255
502 3300050510 nmdc:mga06r32_158679_c1 nmdc:mga06r32_158679_c1_986_1753 255
503 3300050510 nmdc:mga06r32_579172_c1 nmdc:mga06r32_579172_c1_168_935 255
504 3300050512 nmdc:mga0n895_134863_c1 nmdc:mga0n895_134863_c1_1681_2448 255
505 3300050512 nmdc:mga0n895_353093_c1 nmdc:mga0n895_353093_c1_413_1183 255
506 3300050516 nmdc:mga0sz30_58700_c1 nmdc:mga0sz30_58700_c1_745_1515 255
507 3300053077 Ga0495601_0158395 Ga0495601_0158395_384_1151 255
508 3300053078 Ga0495612_0048971 Ga0495612_0048971_436_1203 255
509 3300053085 Ga0495619_0050737 Ga0495619_0050737_952_1719 255
510 3300053085 Ga0495619_0093229 Ga0495619_0093229_1174_1941 255
511 3300053119 Ga0500595_012826 Ga0500595_012826_2196_2966 255
512 3300053130 Ga0500642_0133490 Ga0500642_0133490_362_1129 255
513 3300053131 Ga0500652_000086 Ga0500652_000086_9239_10009 255
514 3300053177 Ga0500636_0000262 Ga0500636_0000262_11435_12271 255
515 3300060353 Ga0501082_0181355 Ga0501082_0181355_334_1101 255
516 3300061734 Ga0530510_0185625 Ga0530510_0185625_508_1275 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

82

253

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8366 61 249
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7723 47 249
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7562 63 249
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7464 61 237
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7409 20 246
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.925 54 247 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9167 58 249 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.916 54 247 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9093 61 246 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.896 56 251 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5S5CJ07-F1-model_v4 Sulfonate transport system permease protein 0.9502 9 255 GO:0005886
GO:0055085
AF-K6Q0B9-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component 0.9468 9 255 GO:0005886
GO:0010438
GO:0055085
AF-A0A222VS71-F1-model_v4 NitT/TauT family transport system permease protein 0.9466 6 255 GO:0005886
GO:0010438
GO:0055085
AF-A0A2W4K9D9-F1-model_v4 deleted 0.9454 6 255
AF-A0A2W4KQ75-F1-model_v4 ABC transporter permease 0.9448 9 255 GO:0005886
GO:0010438
GO:0055085

Feature Viewer

pLDDT pTM Quality
87.4 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map