F457901

General Info

Members Datasets Scaffolds Average Seq Length
515 280 1030 70

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0127050|Ga0495661_0127050_567_770
Length 67
Sequence MGIVNMDDDLHDQIRKASAVSHRSINAQAAFWVKLAEMNPTLSFNEIVTRELRAAGIADETIRVASA

Samples

Sample ID Description Type Environment
1 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
102 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
103 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
116 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
231 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
234 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
240 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
254 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
255 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
256 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
257 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
258 2738541297 Duganella sp. GV083 Isolate Unclassified
259 2738541357 Duganella sp. GV053 Isolate Unclassified
260 2738543003 Duganella sp. GV066 Isolate Unclassified
261 2738543026 Duganella sp. GV089 Isolate Unclassified
262 2738543029 Duganella sp. GV039 Isolate Unclassified
263 2821131069 Duganella sp. 1224 Isolate Unclassified
264 2855730933 Achromobacter sp. HZ28 Isolate Nodule
265 2855767633 Achromobacter sp. HZ34 Isolate Nodule
266 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
267 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
268 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
269 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
270 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
271 2904424332 Duganella sp. 1411 Isolate Rhizosphere
272 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
273 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
274 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
275 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
276 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
277 2941471342 Luteibacter sp. 621 Isolate Unclassified
278 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
279 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
280 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.82
Metatranscriptomes 1.75
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.61
Nodule 0.78
Rhizoplane 2.91
Rhizosphere 63.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495661_0127050 3300046665 Bacteria 1402
2 JGI24741J21665_1000149 3300001915 Bacteria 19701
3 JGI24740J21852_10003968 3300001979 Bacteria 6425
4 JGI24739J22299_10104360 3300001989 Bacteria 854
5 JGI24735J21928_10010995 3300002067 Bacteria 2875
6 JGI25156J39149_1001230 3300002705 Bacteria 11246
7 JGI25156J39149_1011038 3300002705 Bacteria 2073
8 JGI25156J39149_1023460 3300002705 Bacteria 1028
9 JGI25162J39368_1000993 3300002737 Bacteria 17917
10 JGI25162J39368_1003457 3300002737 Bacteria 4545
11 JGI25157J39369_1001782 3300002741 Bacteria 6980
12 JGI25164J39214_1000061 3300002772 Bacteria 110617
13 JGI25165J46597_1000151 3300003214 Bacteria 114835
14 JGI25165J46597_1000606 3300003214 Bacteria 30552
15 Ga0055538_1004657 3300003751 Bacteria 1523
16 Ga0055538_1009052 3300003751 Bacteria 824
17 Ga0055533_1000140 3300003756 Bacteria 76502
18 Ga0055533_1005112 3300003756 Bacteria 2187
19 Ga0055533_1005878 3300003756 Bacteria 1903
20 Ga0055533_1008308 3300003756 Bacteria 1329
21 Ga0055532_1000003 3300003758 Bacteria 494004
22 Ga0055532_1000090 3300003758 Bacteria 104391
23 Ga0055525_1000383 3300003759 Bacteria 28771
24 Ga0055525_1002312 3300003759 Bacteria 2037
25 Ga0055527_1000006 3300003760 Bacteria 494004
26 Ga0055527_1000479 3300003760 Bacteria 14726
27 Ga0055535_1000003 3300003761 Bacteria 494004
28 Ga0055535_1000085 3300003761 Bacteria 104391
29 Ga0055535_1002156 3300003761 Bacteria 7634
30 Ga0055542_1000007 3300003762 Bacteria 494004
31 Ga0055542_1001011 3300003762 Bacteria 17923
32 Ga0055529_1000003 3300003763 Bacteria 494004
33 Ga0055529_1000134 3300003763 Bacteria 104391
34 Ga0055529_1000140 3300003763 Bacteria 102393
35 Ga0055541_1009305 3300003841 Bacteria 1525
36 Ga0055541_1011132 3300003841 Bacteria 1329
37 Ga0065714_10246095 3300005288 Bacteria 785
38 Ga0070658_10590120 3300005327 Bacteria 963
39 Ga0070682_100116385 3300005337 Bacteria 1788
40 Ga0070682_100165571 3300005337 Bacteria 1531
41 Ga0070660_100263755 3300005339 Bacteria 1407
42 Ga0070660_100415821 3300005339 Bacteria 1113
43 Ga0070661_100000141 3300005344 Bacteria 58825
44 Ga0070692_11377981 3300005345 Bacteria 508
45 Ga0070659_100277231 3300005366 Bacteria 1394
46 Ga0070663_100000034 3300005455 Bacteria 68516
47 Ga0070663_100261463 3300005455 Bacteria 1373
48 Ga0070679_100428457 3300005530 Bacteria 1268
49 Ga0068853_100046960 3300005539 Bacteria 3705
50 Ga0070696_100238095 3300005546 Bacteria 1372
51 Ga0070665_100746144 3300005548 Bacteria 992
52 Ga0068855_100098790 3300005563 Bacteria 3362
53 Ga0070664_100000057 3300005564 Bacteria 68516
54 Ga0070664_100051154 3300005564 Bacteria 3498
55 Ga0068857_100029333 3300005577 Bacteria 4855
56 Ga0068857_100058067 3300005577 Bacteria 3435
57 Ga0068857_101436088 3300005577 Bacteria 671
58 Ga0068854_100000937 3300005578 Bacteria 17545
59 Ga0068856_100004528 3300005614 Bacteria 13821
60 Ga0068852_100115207 3300005616 Bacteria 2450
61 Ga0075363_100130804 3300006048 Bacteria 1407
62 Ga0075364_10586672 3300006051 Bacteria 762
63 Ga0075362_10603063 3300006177 Bacteria 568
64 Ga0075366_10278273 3300006195 Bacteria 1022
65 Ga0079104_1027701 3300006946 Bacteria 1449
66 Ga0105244_10015891 3300009036 Bacteria 4305
67 Ga0105240_10031977 3300009093 Bacteria 6815
68 Ga0105240_10186475 3300009093 Bacteria 2443
69 Ga0105240_11210031 3300009093 Bacteria 800
70 Ga0105240_11502432 3300009093 Bacteria 706
71 Ga0105241_10071225 3300009174 Bacteria 2698
72 Ga0105241_11026628 3300009174 Bacteria 773
73 Ga0105238_10002989 3300009551 Bacteria 16888
74 Ga0105238_10217878 3300009551 Bacteria 1885
75 Ga0105239_10391425 3300010375 Bacteria 1572
76 Ga0157373_10009246 3300013100 Bacteria 7287
77 Ga0157373_10009358 3300013100 Bacteria 7240
78 Ga0157371_10000323 3300013102 Bacteria 61980
79 Ga0157371_10002814 3300013102 Bacteria 16290
80 Ga0157370_10000038 3300013104 Bacteria 135182
81 Ga0157370_10018703 3300013104 Bacteria 6967
82 Ga0157369_10019608 3300013105 Bacteria 7567
83 Ga0157369_10034990 3300013105 Bacteria 5508
84 Ga0157369_10123870 3300013105 Bacteria 2742
85 Ga0157369_11197402 3300013105 Bacteria 775
86 Ga0157369_12173659 3300013105 Bacteria 563
87 Ga0157372_10000776 3300013307 Bacteria 34547
88 Ga0157372_10003304 3300013307 Bacteria 17420
89 Ga0157372_10323738 3300013307 Bacteria 1795
90 Ga0157376_10082633 3300014969 Bacteria 2761
91 Ga0182006_1002616 3300015261 Bacteria 9730
92 Ga0182006_1089862 3300015261 Bacteria 1107
93 Ga0182007_10384265 3300015262 Bacteria 533
94 Ga0182005_1009887 3300015265 Bacteria 2757
95 Ga0182005_1037603 3300015265 Bacteria 1316
96 Ga0197907_10519253 3300020069 Bacteria 678
97 Ga0206355_1170558 3300020076 Bacteria 722
98 Ga0154015_1552384 3300020610 Bacteria 22900
99 Ga0213872_10309399 3300021361 Bacteria 654
100 Ga0224712_10002754 3300022467 Bacteria 4421
101 Ga0209784_100006 3300025224 Bacteria 930704
102 Ga0209784_101664 3300025224 Bacteria 2713
103 Ga0209566_100002 3300025225 Bacteria 2614868
104 Ga0209566_101800 3300025225 Bacteria 4976
105 Ga0209566_106078 3300025225 Bacteria 1453
106 Ga0209674_100025 3300025226 Bacteria 515942
107 Ga0209674_100097 3300025226 Bacteria 167285
108 Ga0209674_100403 3300025226 Bacteria 21586
109 Ga0209674_101329 3300025226 Bacteria 6800
110 Ga0209672_100002 3300025228 Bacteria 1733325
111 Ga0209672_100107 3300025228 Bacteria 99267
112 Ga0209672_100208 3300025228 Bacteria 46403
113 Ga0209147_100003 3300025229 Bacteria 1733325
114 Ga0209147_100018 3300025229 Bacteria 515719
115 Ga0209563_100041 3300025230 Bacteria 407467
116 Ga0209563_100206 3300025230 Bacteria 31352
117 Ga0207427_100021 3300025231 Bacteria 494115
118 Ga0207427_100471 3300025231 Bacteria 22019
119 Ga0207427_125949 3300025231 Bacteria 509
120 Ga0209437_100150 3300025233 Bacteria 157430
121 Ga0209437_101405 3300025233 Bacteria 6017
122 Ga0209258_100005 3300025242 Bacteria 1087938
123 Ga0209258_100028 3300025242 Bacteria 515719
124 Ga0209258_100299 3300025242 Bacteria 80970
125 Ga0209646_1000917 3300025246 Bacteria 9465
126 Ga0209026_1000856 3300025250 Bacteria 15889
127 Ga0209026_1003779 3300025250 Bacteria 4800
128 Ga0209026_1024729 3300025250 Bacteria 909
129 Ga0209677_100007 3300025253 Bacteria 1021332
130 Ga0209677_117383 3300025253 Bacteria 896
131 Ga0209148_1000006 3300025254 Bacteria 1733325
132 Ga0209148_1000205 3300025254 Bacteria 104659
133 Ga0209759_1000014 3300025256 Bacteria 396291
134 Ga0209759_1000589 3300025256 Bacteria 35485
135 Ga0209759_1002850 3300025256 Bacteria 7288
136 Ga0209759_1006458 3300025256 Bacteria 3935
137 Ga0209233_1000018 3300025261 Bacteria 886857
138 Ga0209233_1000023 3300025261 Bacteria 738870
139 Ga0209455_1000003 3300025272 Bacteria 1471893
140 Ga0209455_1000081 3300025272 Bacteria 263674
141 Ga0209455_1000107 3300025272 Bacteria 195136
142 Ga0209025_1144055 3300025294 Bacteria 670
143 Ga0209564_1000010 3300025295 Bacteria 885399
144 Ga0209256_1007336 3300025299 Bacteria 5479
145 Ga0207655_1008758 3300025728 Bacteria 6372
146 Ga0207647_10000056 3300025904 Bacteria 86476
147 Ga0207654_11433041 3300025911 Bacteria 504
148 Ga0207695_10002492 3300025913 Bacteria 27113
149 Ga0207695_10452018 3300025913 Bacteria 1168
150 Ga0207695_10803860 3300025913 Bacteria 820
151 Ga0207695_10927617 3300025913 Bacteria 750
152 Ga0207671_10889007 3300025914 Bacteria 704
153 Ga0207657_10126076 3300025919 Bacteria 2103
154 Ga0207649_10000111 3300025920 Bacteria 68568
155 Ga0207649_10611939 3300025920 Bacteria 839
156 Ga0207694_10128316 3300025924 Bacteria 2031
157 Ga0207694_10777422 3300025924 Bacteria 809
158 Ga0207690_10035847 3300025932 Bacteria 3208
159 Ga0207679_10000105 3300025945 Bacteria 68561
160 Ga0207667_10180283 3300025949 Bacteria 2169
161 Ga0207640_10000154 3300025981 Bacteria 49637
162 Ga0207639_10079237 3300026041 Bacteria 2595
163 Ga0207678_10000106 3300026067 Bacteria 68474
164 Ga0207678_10189585 3300026067 Bacteria 1757
165 Ga0207678_11261988 3300026067 Bacteria 654
166 Ga0207702_10000135 3300026078 Bacteria 88092
167 Ga0207674_10002847 3300026116 Bacteria 21514
168 Ga0207674_10028505 3300026116 Bacteria 5893
169 Ga0207698_10091909 3300026142 Bacteria 2486
170 Ga0209281_1018054 3300027111 Bacteria 1418
171 Ga0268266_10316338 3300028379 Bacteria 1460
172 Ga0307517_10069884 3300028786 Bacteria 3173
173 Ga0237817_12869 3300030083 Bacteria 727
174 Ga0316181_1002101 3300030744 Bacteria 787
175 Ga0316182_1192874 3300030745 Bacteria 1221
176 Ga0307405_12160474 3300031731 Bacteria 500
177 Ga0307406_11050514 3300031901 Bacteria 701
178 Ga0307510_10664809 3300033180 Bacteria 502
179 Ga0395899_0001294 3300037312 Bacteria 21605
180 Ga0395899_0038128 3300037312 Bacteria 3601
181 Ga0395899_0078640 3300037312 Bacteria 2404
182 Ga0395900_0005262 3300037418 Bacteria 13569
183 Ga0395900_0007334 3300037418 Bacteria 11410
184 Ga0395905_0039045 3300037471 Bacteria 4454
185 Ga0395901_0000009 3300038443 Bacteria 479396
186 Ga0395901_0236521 3300038443 Bacteria 1906
187 Ga0395901_0584256 3300038443 Bacteria 1128
188 Ga0395901_1684205 3300038443 Bacteria 586
189 Ga0436361_0321845 3300039447 Bacteria 1238
190 Ga0436361_1003488 3300039447 Bacteria 601
191 Ga0439436_0000095 3300041404 Bacteria 20869
192 Ga0439465_0006327 3300041413 Bacteria 3761
193 Ga0451793_0181729 3300041452 Bacteria 944
194 Ga0451847_0363688 3300041503 Bacteria 811
195 Ga0466982_0000040 3300044672 Bacteria 41234
196 Ga0495617_000020 3300046452 Bacteria 230257
197 Ga0495627_033386 3300046453 Bacteria 1614
198 Ga0495627_199474 3300046453 Bacteria 551
199 Ga0495603_0028731 3300046455 Bacteria 3355
200 Ga0495638_0010934 3300046460 Bacteria 6275
201 Ga0495638_0070430 3300046460 Bacteria 2141
202 Ga0495653_0014048 3300046463 Bacteria 6529
203 Ga0495653_0019749 3300046463 Bacteria 5463
204 Ga0495653_0049210 3300046463 Bacteria 3248
205 Ga0495653_0055040 3300046463 Bacteria 3037
206 Ga0495650_0000085 3300046471 Bacteria 235655
207 Ga0495650_0000462 3300046471 Bacteria 63149
208 Ga0495650_0009321 3300046471 Bacteria 5595
209 Ga0495650_0093421 3300046471 Bacteria 1140
210 Ga0495580_0512854 3300046472 Bacteria 799
211 Ga0495582_0012620 3300046473 Bacteria 4658
212 Ga0495582_0017497 3300046473 Bacteria 3922
213 Ga0495605_0011697 3300046474 Bacteria 4884
214 Ga0495664_0248760 3300046477 Bacteria 1075
215 Ga0495584_0029859 3300046491 Bacteria 2762
216 Ga0495584_0083705 3300046491 Bacteria 1606
217 Ga0495584_0441883 3300046491 Bacteria 661
218 Ga0495585_0000424 3300046492 Bacteria 40738
219 Ga0495585_0017021 3300046492 Bacteria 4207
220 Ga0495594_0000828 3300046499 Bacteria 15980
221 Ga0495594_0002110 3300046499 Bacteria 10356
222 Ga0495594_0010168 3300046499 Bacteria 4876
223 Ga0495596_0002923 3300046500 Bacteria 8877
224 Ga0495596_0014942 3300046500 Bacteria 3262
225 Ga0495607_0004924 3300046501 Bacteria 9709
226 Ga0495583_0000051 3300046506 Bacteria 212400
227 Ga0495583_0004240 3300046506 Bacteria 10401
228 Ga0495583_0021928 3300046506 Bacteria 3273
229 Ga0495583_0098912 3300046506 Bacteria 1247
230 Ga0495606_0000041 3300046507 Bacteria 220225
231 Ga0495606_0000101 3300046507 Bacteria 146752
232 Ga0495606_0318411 3300046507 Bacteria 837
233 Ga0495606_0365512 3300046507 Bacteria 761
234 Ga0495610_0000014 3300046512 Bacteria 444708
235 Ga0495610_0000293 3300046512 Bacteria 52547
236 Ga0495610_0000789 3300046512 Bacteria 29694
237 Ga0495610_0024547 3300046512 Bacteria 3250
238 Ga0495616_0000446 3300046513 Bacteria 31542
239 Ga0495616_0025138 3300046513 Bacteria 3185
240 Ga0495620_0080364 3300046515 Bacteria 1320
241 Ga0495630_0034925 3300046517 Bacteria 3756
242 Ga0495631_0000791 3300046518 Bacteria 20226
243 Ga0495631_0005725 3300046518 Bacteria 6482
244 Ga0495631_0016490 3300046518 Bacteria 3520
245 Ga0495631_0315746 3300046518 Bacteria 665
246 Ga0495632_0000048 3300046519 Bacteria 137883
247 Ga0495632_0419167 3300046519 Bacteria 583
248 Ga0495637_0025683 3300046520 Bacteria 2652
249 Ga0495637_0031841 3300046520 Bacteria 2329
250 Ga0495637_0034206 3300046520 Bacteria 2227
251 Ga0495643_0000030 3300046522 Bacteria 260229
252 Ga0495643_0000259 3300046522 Bacteria 77609
253 Ga0495643_0000971 3300046522 Bacteria 29402
254 Ga0495643_0001780 3300046522 Bacteria 18476
255 Ga0495644_0161021 3300046523 Bacteria 860
256 Ga0495648_0002372 3300046524 Bacteria 17491
257 Ga0495648_0006165 3300046524 Bacteria 9831
258 Ga0495648_0016682 3300046524 Bacteria 5286
259 Ga0495648_0020755 3300046524 Bacteria 4570
260 Ga0495648_0076633 3300046524 Bacteria 1919
261 Ga0495648_0269736 3300046524 Bacteria 812
262 Ga0495648_0299211 3300046524 Bacteria 754
263 Ga0495663_0000003 3300046525 Bacteria 362694
264 Ga0495663_0017764 3300046525 Bacteria 2021
265 Ga0495642_0031018 3300046528 Bacteria 2142
266 Ga0495642_0036858 3300046528 Bacteria 1977
267 Ga0495642_0121626 3300046528 Bacteria 1120
268 Ga0495642_0228795 3300046528 Bacteria 812
269 Ga0495654_0002221 3300046530 Bacteria 12587
270 Ga0495654_0032258 3300046530 Bacteria 2656
271 Ga0495654_0093757 3300046530 Bacteria 1390
272 Ga0495654_0260226 3300046530 Bacteria 719
273 Ga0495654_0284036 3300046530 Bacteria 680
274 Ga0495654_0426538 3300046530 Bacteria 524
275 Ga0495665_0002029 3300046531 Bacteria 10962
276 Ga0495586_0039997 3300046535 Bacteria 2521
277 Ga0495586_0600808 3300046535 Bacteria 636
278 Ga0495587_0012506 3300046536 Bacteria 5338
279 Ga0495587_0047406 3300046536 Bacteria 2548
280 Ga0495587_0235679 3300046536 Bacteria 1030
281 Ga0495609_0000298 3300046538 Bacteria 45867
282 Ga0495597_0010567 3300046542 Bacteria 4504
283 Ga0495597_0413059 3300046542 Bacteria 512
284 Ga0495645_0475995 3300046543 Bacteria 784
285 Ga0495622_0000002 3300046557 Bacteria 321742
286 Ga0495633_0000215 3300046558 Bacteria 72445
287 Ga0495633_0003511 3300046558 Bacteria 10400
288 Ga0495633_0008773 3300046558 Bacteria 5655
289 Ga0495633_0045361 3300046558 Bacteria 2081
290 Ga0495633_0050567 3300046558 Bacteria 1959
291 Ga0495633_0051377 3300046558 Bacteria 1942
292 Ga0495633_0102959 3300046558 Bacteria 1325
293 Ga0495633_0465790 3300046558 Bacteria 570
294 Ga0495668_0000066 3300046616 Bacteria 178533
295 Ga0495668_0000579 3300046616 Bacteria 44604
296 Ga0495668_0000712 3300046616 Bacteria 40090
297 Ga0495668_0001564 3300046616 Bacteria 21690
298 Ga0495668_0006113 3300046616 Bacteria 7971
299 Ga0495668_0477619 3300046616 Bacteria 687
300 Ga0495634_0110452 3300046642 Bacteria 1768
301 Ga0495611_0005640 3300046648 Bacteria 5337
302 Ga0495625_0006597 3300046660 Bacteria 10306
303 Ga0495625_0016910 3300046660 Bacteria 5725
304 Ga0495625_0079450 3300046660 Bacteria 2287
305 Ga0495625_0251139 3300046660 Bacteria 1148
306 Ga0495625_0411291 3300046660 Bacteria 843
307 Ga0495625_0587190 3300046660 Bacteria 670
308 Ga0495635_0836521 3300046663 Bacteria 592
309 Ga0495661_0091538 3300046665 Bacteria 1729
310 Ga0495661_0106682 3300046665 Bacteria 1567
311 Ga0495661_0134895 3300046665 Bacteria 1348
312 Ga0495661_0345306 3300046665 Bacteria 734
313 Ga0495661_0447094 3300046665 Bacteria 622
314 Ga0495661_0499519 3300046665 Bacteria 580
315 Ga0495588_0534308 3300046674 Bacteria 614
316 Ga0495599_0769806 3300046678 Bacteria 551
317 Ga0495623_0011819 3300046679 Bacteria 5656
318 Ga0495623_0384100 3300046679 Bacteria 759
319 Ga0495646_0093224 3300046680 Bacteria 1736
320 Ga0495670_0000845 3300046691 Bacteria 14804
321 Ga0495671_0000005 3300046692 Bacteria 509397
322 Ga0495671_0000043 3300046692 Bacteria 163036
323 Ga0495671_0003679 3300046692 Bacteria 9336
324 Ga0495671_0012037 3300046692 Bacteria 4732
325 Ga0495671_0013778 3300046692 Bacteria 4366
326 Ga0495671_0173071 3300046692 Bacteria 1049
327 Ga0495671_0607822 3300046692 Bacteria 520
328 Ga0495649_0000022 3300046694 Bacteria 179407
329 Ga0495649_0002415 3300046694 Bacteria 13178
330 Ga0495649_0021575 3300046694 Bacteria 3608
331 Ga0495649_0025985 3300046694 Bacteria 3259
332 Ga0495589_0050440 3300046794 Bacteria 2058
333 Ga0495589_0052226 3300046794 Bacteria 2020
334 Ga0495660_0000779 3300046810 Bacteria 23870
335 Ga0495660_0078601 3300046810 Bacteria 1734
336 Ga0495660_0114702 3300046810 Bacteria 1370
337 Ga0495581_0191678 3300047315 Bacteria 1196
338 Ga0495604_0017012 3300047317 Bacteria 5815
339 Ga0495604_0037792 3300047317 Bacteria 3800
340 Ga0495604_0050678 3300047317 Bacteria 3222
341 Ga0495636_0010960 3300047318 Bacteria 3589
342 Ga0495636_0554112 3300047318 Bacteria 559
343 Ga0495674_0374141 3300047319 Bacteria 1153
344 Ga0495672_0000188 3300047320 Bacteria 89538
345 Ga0495680_0021570 3300047322 Bacteria 5390
346 Ga0495680_0070849 3300047322 Bacteria 2656
347 Ga0495683_0001975 3300047323 Bacteria 12798
348 Ga0495683_0011455 3300047323 Bacteria 4667
349 Ga0495683_0405618 3300047323 Bacteria 566
350 Ga0495687_001550 3300047443 Bacteria 20895
351 Ga0495687_045043 3300047443 Bacteria 1913
352 Ga0495687_046170 3300047443 Bacteria 1882
353 Ga0495675_0174237 3300047444 Bacteria 1320
354 Ga0495675_0347099 3300047444 Bacteria 873
355 Ga0495677_0317462 3300047445 Bacteria 613
356 Ga0495679_002173 3300047446 Bacteria 10289
357 Ga0495679_008263 3300047446 Bacteria 4247
358 Ga0495685_019404 3300047447 Bacteria 2336
359 Ga0495673_0000009 3300047469 Bacteria 731993
360 Ga0495681_0000667 3300047470 Bacteria 26095
361 Ga0495681_0003758 3300047470 Bacteria 10527
362 Ga0495681_0075130 3300047470 Bacteria 1522
363 Ga0495681_0154111 3300047470 Bacteria 962
364 Ga0495681_0351320 3300047470 Bacteria 560
365 Ga0495684_1030643 3300047471 Bacteria 521
366 Ga0495686_0000054 3300047472 Bacteria 259400
367 Ga0495686_0012570 3300047472 Bacteria 5918
368 Ga0495686_0012597 3300047472 Bacteria 5911
369 Ga0495686_0019149 3300047472 Bacteria 4578
370 Ga0495686_0233483 3300047472 Bacteria 1040
371 Ga0495686_0353815 3300047472 Bacteria 798
372 Ga0495593_0310881 3300047673 Bacteria 788
373 Ga0495602_0005370 3300048088 Bacteria 13449
374 Ga0495602_0220437 3300048088 Bacteria 1432
375 Ga0495614_0170000 3300048089 Bacteria 978
376 Ga0495626_0004117 3300048091 Bacteria 9034
377 Ga0495626_0030810 3300048091 Bacteria 2585
378 Ga0495626_0049041 3300048091 Bacteria 1956
379 Ga0495626_0057082 3300048091 Bacteria 1786
380 Ga0496102_0122227 3300048905 Bacteria 2432
381 Ga0496103_0007939 3300048906 Bacteria 6308
382 Ga0496103_0041166 3300048906 Bacteria 2839
383 Ga0496104_1381035 3300048907 Bacteria 607
384 Ga0496106_0333359 3300048909 Bacteria 1218
385 Ga0496106_1024704 3300048909 Bacteria 648
386 Ga0496107_1033484 3300048910 Bacteria 595
387 Ga0496108_0250532 3300048911 Bacteria 1541
388 Ga0496109_0115634 3300048912 Bacteria 2496
389 Ga0496110_0001119 3300048913 Bacteria 18923
390 Ga0496111_0060901 3300048914 Bacteria 2736
391 Ga0496112_1312647 3300048915 Bacteria 639
392 Ga0496115_0342011 3300048918 Bacteria 1221
393 Ga0496116_0211048 3300048919 Bacteria 1006
394 Ga0496116_0334568 3300048919 Bacteria 701
395 Ga0496117_0003157 3300048920 Bacteria 19622
396 Ga0496117_0204595 3300048920 Bacteria 1112
397 Ga0496117_0315880 3300048920 Bacteria 820
398 Ga0496118_0008099 3300048921 Bacteria 10954
399 Ga0496118_0008860 3300048921 Bacteria 10291
400 Ga0496118_0102977 3300048921 Bacteria 1922
401 Ga0496118_0212766 3300048921 Bacteria 1133
402 Ga0496120_0027723 3300048923 Bacteria 3479
403 Ga0496120_0071852 3300048923 Bacteria 1898
404 Ga0496121_0000044 3300048924 Bacteria 337672
405 Ga0496121_0006850 3300048924 Bacteria 13931
406 Ga0496121_0637214 3300048924 Bacteria 651
407 Ga0496121_0860713 3300048924 Bacteria 526
408 Ga0496122_0024809 3300048925 Bacteria 5236
409 Ga0496122_0064252 3300048925 Bacteria 2672
410 Ga0496122_0268064 3300048925 Bacteria 943
411 Ga0496122_0310146 3300048925 Bacteria 845
412 Ga0496122_0320318 3300048925 Bacteria 825
413 Ga0496123_0003625 3300048926 Bacteria 17092
414 Ga0496123_0035088 3300048926 Bacteria 3580
415 Ga0496123_0044143 3300048926 Bacteria 3051
416 Ga0496123_0161496 3300048926 Bacteria 1194
417 Ga0496123_0328041 3300048926 Bacteria 720
418 Ga0496123_0393800 3300048926 Bacteria 632
419 Ga0496123_0529567 3300048926 Bacteria 510
420 Ga0496124_0000137 3300048927 Bacteria 151186
421 Ga0496124_0257252 3300048927 Bacteria 1287
422 Ga0496124_0372392 3300048927 Bacteria 1002
423 Ga0496125_0002030 3300048928 Bacteria 27427
424 Ga0496125_0003880 3300048928 Bacteria 17674
425 Ga0496125_0010728 3300048928 Bacteria 9231
426 Ga0496126_0026860 3300048929 Bacteria 5511
427 Ga0496126_0125425 3300048929 Bacteria 2222
428 Ga0496126_0273150 3300048929 Bacteria 1402
429 Ga0496126_0827407 3300048929 Bacteria 708
430 Ga0495678_000006 3300049459 Bacteria 463690
431 Ga0495678_001985 3300049459 Bacteria 14727
432 Ga0495678_002123 3300049459 Bacteria 14081
433 Ga0495678_022131 3300049459 Bacteria 2786
434 Ga0495678_093599 3300049459 Bacteria 1053
435 Ga0495682_0000107 3300049460 Bacteria 73486
436 Ga0495682_0068963 3300049460 Bacteria 1273
437 Ga0501311_032625 3300049527 Bacteria 760
438 Ga0501316_044793 3300049532 Bacteria 625
439 Ga0501034_0166710 3300049571 Bacteria 2171
440 Ga0501034_0505333 3300049571 Bacteria 1122
441 Ga0501038_0920065 3300049574 Bacteria 645
442 Ga0501047_0719821 3300049581 Bacteria 815
443 Ga0501047_1089623 3300049581 Bacteria 612
444 Ga0501223_082431 3300049663 Bacteria 645
445 Ga0501249_004483 3300049679 Bacteria 2836
446 Ga0501269_000016 3300049766 Bacteria 58863
447 Ga0501035_0148309 3300049822 Bacteria 2037
448 Ga0501044_0177987 3300049823 Bacteria 2095
449 Ga0501044_0389883 3300049823 Bacteria 1307
450 Ga0501044_0527270 3300049823 Bacteria 1080
451 nmdc:mga03683_315987_c1 3300050489 Bacteria 735
452 nmdc:mga00v17_153209_c1 3300050491 Bacteria 1481
453 nmdc:mga0yw44_24851_c2 3300050492 Bacteria 2568
454 nmdc:mga0k408_267273_c1 3300050493 Bacteria 1021
455 Ga0500578_0502107 3300053086 Bacteria 682
456 Ga0500643_033389 3300053087 Bacteria 1556
457 Ga0500643_063484 3300053087 Bacteria 1034
458 Ga0500643_184828 3300053087 Bacteria 559
459 Ga0500651_0126344 3300053093 Bacteria 1549
460 Ga0500651_0721921 3300053093 Bacteria 531
461 Ga0500556_0000004 3300053104 Bacteria 666287
462 Ga0500562_031066 3300053108 Bacteria 1408
463 Ga0500569_018669 3300053109 Bacteria 1794
464 Ga0500594_0187514 3300053118 Bacteria 676
465 Ga0500607_038969 3300053121 Bacteria 2583
466 Ga0500608_051274 3300053122 Bacteria 1982
467 Ga0500618_000088 3300053125 Bacteria 74892
468 Ga0500618_000519 3300053125 Bacteria 24282
469 Ga0500618_005608 3300053125 Bacteria 3791
470 Ga0500658_0038786 3300053134 Bacteria 1900
471 Ga0500559_0001931 3300053136 Bacteria 11224
472 Ga0500568_0023303 3300053139 Bacteria 2634
473 Ga0500586_007919 3300053145 Bacteria 2865
474 Ga0500590_223783 3300053148 Bacteria 773
475 Ga0500604_0063458 3300053151 Bacteria 1165
476 Ga0500616_0000014 3300053153 Bacteria 637918
477 Ga0500622_0175260 3300053156 Bacteria 995
478 Ga0500624_047654 3300053157 Bacteria 789
479 Ga0500627_0036236 3300053158 Bacteria 2099
480 Ga0500627_0053545 3300053158 Bacteria 1764
481 Ga0500634_0165211 3300053161 Bacteria 1016
482 Ga0500636_0041258 3300053177 Bacteria 2729
483 Ga0500637_0224318 3300053178 Bacteria 1061
484 Ga0500645_008912 3300053730 Bacteria 3393
485 Ga0587088_078551 3300059508 Bacteria 702
486 Ga0587067_003478 3300059640 Bacteria 1971
487 Ga0587072_056118 3300059643 Bacteria 801
488 2501081279 2501025502 Bacteria 9641094
489 2511094265 2510917013 Bacteria 9951648
490 2511386319 2511231026 Bacteria 5225445
491 2512641805 2512564014 Bacteria 4639632
492 2599448428 2599185178 Bacteria 5365746
493 2738826345 2738541297 Bacteria 6549566
494 2739150142 2738541357 Bacteria 6549408
495 2739192061 2738543003 Bacteria 6549560
496 2739318538 2738543026 Bacteria 6549408
497 2739336779 2738543029 Bacteria 6549249
498 2821134855 2821131069 Bacteria 6108407
499 2855732291 2855730933 Bacteria 7047938
500 2855768999 2855767633 Bacteria 7049357
501 2857358051 2857357740 Bacteria 9937880
502 2857529014 2857524615 Bacteria 6615449
503 2885388107 2885383462 Bacteria 9473874
504 2893070463 2893066018 Bacteria 6158120
505 2895517553 2895511927 Bacteria 6802080
506 2904428223 2904424332 Bacteria 7633521
507 2904486964 2904483920 Bacteria 7545285
508 2919528278 2919527303 Bacteria 7718827
509 2923519756 2923516293 Bacteria 3716336
510 2928973392 2928972540 Bacteria 3058286
511 2939670046 2939669807 Bacteria 5028511
512 2941475856 2941471342 Bacteria 5018624
513 2953994451 2953994433 Bacteria 4303959
514 2977240631 2977240413 Bacteria 3191065
515 2990710727 2990703756 Bacteria 7715990
516 Ga0495661_0127050
517 JGI24741J21665_1000149
518 JGI24740J21852_10003968
519 JGI24739J22299_10104360
520 JGI24735J21928_10010995
521 JGI25156J39149_1001230
522 JGI25156J39149_1011038
523 JGI25156J39149_1023460
524 JGI25162J39368_1000993
525 JGI25162J39368_1003457
526 JGI25157J39369_1001782
527 JGI25164J39214_1000061
528 JGI25165J46597_1000151
529 JGI25165J46597_1000606
530 Ga0055538_1004657
531 Ga0055538_1009052
532 Ga0055533_1000140
533 Ga0055533_1005112
534 Ga0055533_1005878
535 Ga0055533_1008308
536 Ga0055532_1000003
537 Ga0055532_1000090
538 Ga0055525_1000383
539 Ga0055525_1002312
540 Ga0055527_1000006
541 Ga0055527_1000479
542 Ga0055535_1000003
543 Ga0055535_1000085
544 Ga0055535_1002156
545 Ga0055542_1000007
546 Ga0055542_1001011
547 Ga0055529_1000003
548 Ga0055529_1000134
549 Ga0055529_1000140
550 Ga0055541_1009305
551 Ga0055541_1011132
552 Ga0065714_10246095
553 Ga0070658_10590120
554 Ga0070682_100116385
555 Ga0070682_100165571
556 Ga0070660_100263755
557 Ga0070660_100415821
558 Ga0070661_100000141
559 Ga0070692_11377981
560 Ga0070659_100277231
561 Ga0070663_100000034
562 Ga0070663_100261463
563 Ga0070679_100428457
564 Ga0068853_100046960
565 Ga0070696_100238095
566 Ga0070665_100746144
567 Ga0068855_100098790
568 Ga0070664_100000057
569 Ga0070664_100051154
570 Ga0068857_100029333
571 Ga0068857_100058067
572 Ga0068857_101436088
573 Ga0068854_100000937
574 Ga0068856_100004528
575 Ga0068852_100115207
576 Ga0075363_100130804
577 Ga0075364_10586672
578 Ga0075362_10603063
579 Ga0075366_10278273
580 Ga0079104_1027701
581 Ga0105244_10015891
582 Ga0105240_10031977
583 Ga0105240_10186475
584 Ga0105240_11210031
585 Ga0105240_11502432
586 Ga0105241_10071225
587 Ga0105241_11026628
588 Ga0105238_10002989
589 Ga0105238_10217878
590 Ga0105239_10391425
591 Ga0157373_10009246
592 Ga0157373_10009358
593 Ga0157371_10000323
594 Ga0157371_10002814
595 Ga0157370_10000038
596 Ga0157370_10018703
597 Ga0157369_10019608
598 Ga0157369_10034990
599 Ga0157369_10123870
600 Ga0157369_11197402
601 Ga0157369_12173659
602 Ga0157372_10000776
603 Ga0157372_10003304
604 Ga0157372_10323738
605 Ga0157376_10082633
606 Ga0182006_1002616
607 Ga0182006_1089862
608 Ga0182007_10384265
609 Ga0182005_1009887
610 Ga0182005_1037603
611 Ga0197907_10519253
612 Ga0206355_1170558
613 Ga0154015_1552384
614 Ga0213872_10309399
615 Ga0224712_10002754
616 Ga0209784_100006
617 Ga0209784_101664
618 Ga0209566_100002
619 Ga0209566_101800
620 Ga0209566_106078
621 Ga0209674_100025
622 Ga0209674_100097
623 Ga0209674_100403
624 Ga0209674_101329
625 Ga0209672_100002
626 Ga0209672_100107
627 Ga0209672_100208
628 Ga0209147_100003
629 Ga0209147_100018
630 Ga0209563_100041
631 Ga0209563_100206
632 Ga0207427_100021
633 Ga0207427_100471
634 Ga0207427_125949
635 Ga0209437_100150
636 Ga0209437_101405
637 Ga0209258_100005
638 Ga0209258_100028
639 Ga0209258_100299
640 Ga0209646_1000917
641 Ga0209026_1000856
642 Ga0209026_1003779
643 Ga0209026_1024729
644 Ga0209677_100007
645 Ga0209677_117383
646 Ga0209148_1000006
647 Ga0209148_1000205
648 Ga0209759_1000014
649 Ga0209759_1000589
650 Ga0209759_1002850
651 Ga0209759_1006458
652 Ga0209233_1000018
653 Ga0209233_1000023
654 Ga0209455_1000003
655 Ga0209455_1000081
656 Ga0209455_1000107
657 Ga0209025_1144055
658 Ga0209564_1000010
659 Ga0209256_1007336
660 Ga0207655_1008758
661 Ga0207647_10000056
662 Ga0207654_11433041
663 Ga0207695_10002492
664 Ga0207695_10452018
665 Ga0207695_10803860
666 Ga0207695_10927617
667 Ga0207671_10889007
668 Ga0207657_10126076
669 Ga0207649_10000111
670 Ga0207649_10611939
671 Ga0207694_10128316
672 Ga0207694_10777422
673 Ga0207690_10035847
674 Ga0207679_10000105
675 Ga0207667_10180283
676 Ga0207640_10000154
677 Ga0207639_10079237
678 Ga0207678_10000106
679 Ga0207678_10189585
680 Ga0207678_11261988
681 Ga0207702_10000135
682 Ga0207674_10002847
683 Ga0207674_10028505
684 Ga0207698_10091909
685 Ga0209281_1018054
686 Ga0268266_10316338
687 Ga0307517_10069884
688 Ga0237817_12869
689 Ga0316181_1002101
690 Ga0316182_1192874
691 Ga0307405_12160474
692 Ga0307406_11050514
693 Ga0307510_10664809
694 Ga0395899_0001294
695 Ga0395899_0038128
696 Ga0395899_0078640
697 Ga0395900_0005262
698 Ga0395900_0007334
699 Ga0395905_0039045
700 Ga0395901_0000009
701 Ga0395901_0236521
702 Ga0395901_0584256
703 Ga0395901_1684205
704 Ga0436361_0321845
705 Ga0436361_1003488
706 Ga0439436_0000095
707 Ga0439465_0006327
708 Ga0451793_0181729
709 Ga0451847_0363688
710 Ga0466982_0000040
711 Ga0495617_000020
712 Ga0495627_033386
713 Ga0495627_199474
714 Ga0495603_0028731
715 Ga0495638_0010934
716 Ga0495638_0070430
717 Ga0495653_0014048
718 Ga0495653_0019749
719 Ga0495653_0049210
720 Ga0495653_0055040
721 Ga0495650_0000085
722 Ga0495650_0000462
723 Ga0495650_0009321
724 Ga0495650_0093421
725 Ga0495580_0512854
726 Ga0495582_0012620
727 Ga0495582_0017497
728 Ga0495605_0011697
729 Ga0495664_0248760
730 Ga0495584_0029859
731 Ga0495584_0083705
732 Ga0495584_0441883
733 Ga0495585_0000424
734 Ga0495585_0017021
735 Ga0495594_0000828
736 Ga0495594_0002110
737 Ga0495594_0010168
738 Ga0495596_0002923
739 Ga0495596_0014942
740 Ga0495607_0004924
741 Ga0495583_0000051
742 Ga0495583_0004240
743 Ga0495583_0021928
744 Ga0495583_0098912
745 Ga0495606_0000041
746 Ga0495606_0000101
747 Ga0495606_0318411
748 Ga0495606_0365512
749 Ga0495610_0000014
750 Ga0495610_0000293
751 Ga0495610_0000789
752 Ga0495610_0024547
753 Ga0495616_0000446
754 Ga0495616_0025138
755 Ga0495620_0080364
756 Ga0495630_0034925
757 Ga0495631_0000791
758 Ga0495631_0005725
759 Ga0495631_0016490
760 Ga0495631_0315746
761 Ga0495632_0000048
762 Ga0495632_0419167
763 Ga0495637_0025683
764 Ga0495637_0031841
765 Ga0495637_0034206
766 Ga0495643_0000030
767 Ga0495643_0000259
768 Ga0495643_0000971
769 Ga0495643_0001780
770 Ga0495644_0161021
771 Ga0495648_0002372
772 Ga0495648_0006165
773 Ga0495648_0016682
774 Ga0495648_0020755
775 Ga0495648_0076633
776 Ga0495648_0269736
777 Ga0495648_0299211
778 Ga0495663_0000003
779 Ga0495663_0017764
780 Ga0495642_0031018
781 Ga0495642_0036858
782 Ga0495642_0121626
783 Ga0495642_0228795
784 Ga0495654_0002221
785 Ga0495654_0032258
786 Ga0495654_0093757
787 Ga0495654_0260226
788 Ga0495654_0284036
789 Ga0495654_0426538
790 Ga0495665_0002029
791 Ga0495586_0039997
792 Ga0495586_0600808
793 Ga0495587_0012506
794 Ga0495587_0047406
795 Ga0495587_0235679
796 Ga0495609_0000298
797 Ga0495597_0010567
798 Ga0495597_0413059
799 Ga0495645_0475995
800 Ga0495622_0000002
801 Ga0495633_0000215
802 Ga0495633_0003511
803 Ga0495633_0008773
804 Ga0495633_0045361
805 Ga0495633_0050567
806 Ga0495633_0051377
807 Ga0495633_0102959
808 Ga0495633_0465790
809 Ga0495668_0000066
810 Ga0495668_0000579
811 Ga0495668_0000712
812 Ga0495668_0001564
813 Ga0495668_0006113
814 Ga0495668_0477619
815 Ga0495634_0110452
816 Ga0495611_0005640
817 Ga0495625_0006597
818 Ga0495625_0016910
819 Ga0495625_0079450
820 Ga0495625_0251139
821 Ga0495625_0411291
822 Ga0495625_0587190
823 Ga0495635_0836521
824 Ga0495661_0091538
825 Ga0495661_0106682
826 Ga0495661_0134895
827 Ga0495661_0345306
828 Ga0495661_0447094
829 Ga0495661_0499519
830 Ga0495588_0534308
831 Ga0495599_0769806
832 Ga0495623_0011819
833 Ga0495623_0384100
834 Ga0495646_0093224
835 Ga0495670_0000845
836 Ga0495671_0000005
837 Ga0495671_0000043
838 Ga0495671_0003679
839 Ga0495671_0012037
840 Ga0495671_0013778
841 Ga0495671_0173071
842 Ga0495671_0607822
843 Ga0495649_0000022
844 Ga0495649_0002415
845 Ga0495649_0021575
846 Ga0495649_0025985
847 Ga0495589_0050440
848 Ga0495589_0052226
849 Ga0495660_0000779
850 Ga0495660_0078601
851 Ga0495660_0114702
852 Ga0495581_0191678
853 Ga0495604_0017012
854 Ga0495604_0037792
855 Ga0495604_0050678
856 Ga0495636_0010960
857 Ga0495636_0554112
858 Ga0495674_0374141
859 Ga0495672_0000188
860 Ga0495680_0021570
861 Ga0495680_0070849
862 Ga0495683_0001975
863 Ga0495683_0011455
864 Ga0495683_0405618
865 Ga0495687_001550
866 Ga0495687_045043
867 Ga0495687_046170
868 Ga0495675_0174237
869 Ga0495675_0347099
870 Ga0495677_0317462
871 Ga0495679_002173
872 Ga0495679_008263
873 Ga0495685_019404
874 Ga0495673_0000009
875 Ga0495681_0000667
876 Ga0495681_0003758
877 Ga0495681_0075130
878 Ga0495681_0154111
879 Ga0495681_0351320
880 Ga0495684_1030643
881 Ga0495686_0000054
882 Ga0495686_0012570
883 Ga0495686_0012597
884 Ga0495686_0019149
885 Ga0495686_0233483
886 Ga0495686_0353815
887 Ga0495593_0310881
888 Ga0495602_0005370
889 Ga0495602_0220437
890 Ga0495614_0170000
891 Ga0495626_0004117
892 Ga0495626_0030810
893 Ga0495626_0049041
894 Ga0495626_0057082
895 Ga0496102_0122227
896 Ga0496103_0007939
897 Ga0496103_0041166
898 Ga0496104_1381035
899 Ga0496106_0333359
900 Ga0496106_1024704
901 Ga0496107_1033484
902 Ga0496108_0250532
903 Ga0496109_0115634
904 Ga0496110_0001119
905 Ga0496111_0060901
906 Ga0496112_1312647
907 Ga0496115_0342011
908 Ga0496116_0211048
909 Ga0496116_0334568
910 Ga0496117_0003157
911 Ga0496117_0204595
912 Ga0496117_0315880
913 Ga0496118_0008099
914 Ga0496118_0008860
915 Ga0496118_0102977
916 Ga0496118_0212766
917 Ga0496120_0027723
918 Ga0496120_0071852
919 Ga0496121_0000044
920 Ga0496121_0006850
921 Ga0496121_0637214
922 Ga0496121_0860713
923 Ga0496122_0024809
924 Ga0496122_0064252
925 Ga0496122_0268064
926 Ga0496122_0310146
927 Ga0496122_0320318
928 Ga0496123_0003625
929 Ga0496123_0035088
930 Ga0496123_0044143
931 Ga0496123_0161496
932 Ga0496123_0328041
933 Ga0496123_0393800
934 Ga0496123_0529567
935 Ga0496124_0000137
936 Ga0496124_0257252
937 Ga0496124_0372392
938 Ga0496125_0002030
939 Ga0496125_0003880
940 Ga0496125_0010728
941 Ga0496126_0026860
942 Ga0496126_0125425
943 Ga0496126_0273150
944 Ga0496126_0827407
945 Ga0495678_000006
946 Ga0495678_001985
947 Ga0495678_002123
948 Ga0495678_022131
949 Ga0495678_093599
950 Ga0495682_0000107
951 Ga0495682_0068963
952 Ga0501311_032625
953 Ga0501316_044793
954 Ga0501034_0166710
955 Ga0501034_0505333
956 Ga0501038_0920065
957 Ga0501047_0719821
958 Ga0501047_1089623
959 Ga0501223_082431
960 Ga0501249_004483
961 Ga0501269_000016
962 Ga0501035_0148309
963 Ga0501044_0177987
964 Ga0501044_0389883
965 Ga0501044_0527270
966 nmdc:mga03683_315987_c1
967 nmdc:mga00v17_153209_c1
968 nmdc:mga0yw44_24851_c2
969 nmdc:mga0k408_267273_c1
970 Ga0500578_0502107
971 Ga0500643_033389
972 Ga0500643_063484
973 Ga0500643_184828
974 Ga0500651_0126344
975 Ga0500651_0721921
976 Ga0500556_0000004
977 Ga0500562_031066
978 Ga0500569_018669
979 Ga0500594_0187514
980 Ga0500607_038969
981 Ga0500608_051274
982 Ga0500618_000088
983 Ga0500618_000519
984 Ga0500618_005608
985 Ga0500658_0038786
986 Ga0500559_0001931
987 Ga0500568_0023303
988 Ga0500586_007919
989 Ga0500590_223783
990 Ga0500604_0063458
991 Ga0500616_0000014
992 Ga0500622_0175260
993 Ga0500624_047654
994 Ga0500627_0036236
995 Ga0500627_0053545
996 Ga0500634_0165211
997 Ga0500636_0041258
998 Ga0500637_0224318
999 Ga0500645_008912
1000 Ga0587088_078551
1001 Ga0587067_003478
1002 Ga0587072_056118
1003 2501081279
1004 2511094265
1005 2511386319
1006 2512641805
1007 2599448428
1008 2738826345
1009 2739150142
1010 2739192061
1011 2739318538
1012 2739336779
1013 2821134855
1014 2855732291
1015 2855768999
1016 2857358051
1017 2857529014
1018 2885388107
1019 2893070463
1020 2895517553
1021 2904428223
1022 2904486964
1023 2919528278
1024 2923519756
1025 2928973392
1026 2939670046
1027 2941475856
1028 2953994451
1029 2977240631
1030 2990710727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11903

ParD_like

ParD-like antitoxin of type II bacterial toxin-antitoxin system

1

66

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1arr-assembly1.cif.gz_B relaxation matrix refinement of the solution structure of the arc repressor 0.6997 4 40
6iya-assembly2.cif.gz_D structure of the dna binding domain of antitoxin copaso 0.6602 4 45
1par-assembly1.cif.gz_D dna recognition by beta-sheets in the arc repressor-operator crystal structure 0.6565 4 40
1myk-assembly1.cif.gz_B crystal structure, folding, and operator binding of the hyperstable arc repressor mutant pl8 0.6545 4 40
2rbf-assembly1.cif.gz_A structure of the ribbon-helix-helix domain of escherichia coli puta (puta52) complexed with operator dna (o2) 0.6239 1 38
ID Description Score Start End Superfamily
1b28A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7818 4 33 1.10.1220.10
1b28B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7533 4 34 1.10.1220.10
1arrB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6997 4 40 1.10.1220.10
1parD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6565 4 40 1.10.1220.10
1mykB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6545 4 40 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A5P8RQ20-F1-model_v4 deleted 0.6967 1 59
AF-A0A6J6L1A9-F1-model_v4 Unannotated protein 0.6955 4 59
AF-A0A078L161-F1-model_v4 ParD-like antitoxin of type II toxin-antitoxin system 0.6765 1 59
AF-V4NF50-F1-model_v4 ParD-like antitoxin of type II toxin-antitoxin system 0.6744 1 62
AF-A0A1B8YL77-F1-model_v4 ParD-like antitoxin of type II bacterial toxin-antitoxin system 0.6621 1 59

Map