F457893

General Info

Members Datasets Scaffolds Average Seq Length
515 268 501 165

Family's Representative Sequence

Representative Sequence 3300042006|Ga0439432_000985|Ga0439432_000985_6187_6759
Length 190
Sequence MGRSIAHVHRTPQACTLGAASITRIEDMSGQQRELTLRFLAQPTDVNYGGKVHGGMVMKWIDQAGYAAAVGWSGRYSVTVAVGGIRFVAPIRISDLVTVSTKLVHTGTSSMHFAVDVMAVDPISDDAPRLCTHCVIVFVALDGVEGKPVAVPPLQLTSDEDKRLAEYAMKVMELSKGIEQTVERYRVAGN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221695 Lysobacter sp. Root494 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
13 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
14 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
80 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
179 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
191 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
246 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
247 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
248 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
255 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
256 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
263 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0.19
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.65
Nodule 0.19
Rhizoplane 3.88
Rhizosphere 77.09
Stem 0
Stem Tuber 0
Unclassified 7.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214831368 2209111006 Bacteria 646
2 JGI25151J46595_10000106 3300003187 Bacteria 113352
3 JGI25151J46595_10052990 3300003187 Bacteria 1360
4 rootH2_10074821 3300003320 Bacteria 2370
5 rootL2_10054142 3300003322 Bacteria 1811
6 Ga0055526_1000011 3300003771 Bacteria 236316
7 Ga0055526_1004338 3300003771 Bacteria 8563
8 Ga0055537_1000007 3300003773 Bacteria 144691
9 Ga0055537_1000498 3300003773 Bacteria 23711
10 Ga0055524_1000034 3300003775 Bacteria 180672
11 Ga0055524_1024398 3300003775 Bacteria 1919
12 Ga0055524_1054090 3300003775 Bacteria 883
13 Ga0055536_1004788 3300003781 Bacteria 6786
14 Ga0055534_1000013 3300003784 Bacteria 151209
15 Ga0055534_1014137 3300003784 Bacteria 1507
16 Ga0055528_1000005 3300003790 Bacteria 236316
17 Ga0055530_10002764 3300003791 Bacteria 10857
18 Ga0055531_10004086 3300003794 Bacteria 9038
19 Ga0055531_10008204 3300003794 Bacteria 5558
20 Ga0055531_10017409 3300003794 Bacteria 3036
21 Ga0055531_10041173 3300003794 Bacteria 1342
22 Ga0065714_10095882 3300005288 Bacteria 1775
23 Ga0065714_10184299 3300005288 Bacteria 951
24 Ga0065715_10015212 3300005293 Bacteria 2509
25 Ga0065715_10031073 3300005293 Bacteria 1723
26 Ga0065715_10111066 3300005293 Bacteria 2590
27 Ga0070658_10249588 3300005327 Bacteria 1505
28 Ga0070676_10057312 3300005328 Bacteria 2305
29 Ga0070676_10124167 3300005328 Bacteria 1624
30 Ga0070683_100539060 3300005329 Bacteria 1116
31 Ga0070670_100165101 3300005331 Bacteria 1919
32 Ga0070670_100180693 3300005331 Bacteria 1832
33 Ga0070670_100642435 3300005331 Bacteria 952
34 Ga0070666_10184417 3300005335 Bacteria 1464
35 Ga0070682_101329567 3300005337 Bacteria 612
36 Ga0068868_100349243 3300005338 Bacteria 1266
37 Ga0070660_100510348 3300005339 Bacteria 1001
38 Ga0070661_100532440 3300005344 Bacteria 943
39 Ga0070661_100737811 3300005344 Bacteria 805
40 Ga0070668_100154980 3300005347 Bacteria 1855
41 Ga0070668_100258878 3300005347 Bacteria 1446
42 Ga0070668_100728132 3300005347 Bacteria 876
43 Ga0070669_100035593 3300005353 Bacteria 3608
44 Ga0070669_100091603 3300005353 Bacteria 2280
45 Ga0070669_100412846 3300005353 Bacteria 1107
46 Ga0070669_100907875 3300005353 Bacteria 753
47 Ga0070675_101045653 3300005354 Bacteria 750
48 Ga0070674_100090414 3300005356 Bacteria 2208
49 Ga0070659_100218049 3300005366 Bacteria 1574
50 Ga0070659_100878608 3300005366 Bacteria 783
51 Ga0070667_100001560 3300005367 Bacteria 20545
52 Ga0070667_100022398 3300005367 Bacteria 5240
53 Ga0070667_100220956 3300005367 Bacteria 1686
54 Ga0070667_100259836 3300005367 Bacteria 1554
55 Ga0070667_100275716 3300005367 Bacteria 1509
56 Ga0070710_10552180 3300005437 Bacteria 796
57 Ga0070711_100197277 3300005439 Bacteria 1551
58 Ga0070663_100013442 3300005455 Bacteria 5221
59 Ga0070663_100240003 3300005455 Bacteria 1430
60 Ga0070663_100927508 3300005455 Bacteria 753
61 Ga0070678_100195776 3300005456 Bacteria 1665
62 Ga0070678_100493145 3300005456 Bacteria 1080
63 Ga0070678_100840999 3300005456 Bacteria 836
64 Ga0070662_100443779 3300005457 Bacteria 1076
65 Ga0070681_10009458 3300005458 Bacteria 9593
66 Ga0070681_10577253 3300005458 Bacteria 1038
67 Ga0070679_100033075 3300005530 Bacteria 5118
68 Ga0068853_100000225 3300005539 Bacteria 40087
69 Ga0068853_100000983 3300005539 Bacteria 20066
70 Ga0068853_100023136 3300005539 Bacteria 5200
71 Ga0068853_100068814 3300005539 Bacteria 3078
72 Ga0070672_100038786 3300005543 Bacteria 3643
73 Ga0070672_100343940 3300005543 Bacteria 1271
74 Ga0070665_100000900 3300005548 Bacteria 38177
75 Ga0070665_100103476 3300005548 Bacteria 2850
76 Ga0070665_100150441 3300005548 Bacteria 2330
77 Ga0070665_100443455 3300005548 Bacteria 1307
78 Ga0070665_101420984 3300005548 Bacteria 703
79 Ga0068855_100002951 3300005563 Bacteria 20789
80 Ga0068855_100437633 3300005563 Bacteria 1428
81 Ga0068855_100533663 3300005563 Bacteria 1272
82 Ga0068855_100779352 3300005563 Bacteria 1018
83 Ga0070664_100384454 3300005564 Bacteria 1282
84 Ga0068857_100079926 3300005577 Bacteria 2919
85 Ga0068857_100524448 3300005577 Bacteria 1114
86 Ga0068854_100253212 3300005578 Bacteria 1407
87 Ga0068854_100285828 3300005578 Bacteria 1329
88 Ga0068856_100403561 3300005614 Bacteria 1386
89 Ga0070702_101219511 3300005615 Bacteria 607
90 Ga0068859_100001366 3300005617 Bacteria 24861
91 Ga0068859_100862586 3300005617 Bacteria 991
92 Ga0068861_100015330 3300005719 Bacteria 5398
93 Ga0068851_10075307 3300005834 Bacteria 1753
94 Ga0068851_10079869 3300005834 Bacteria 1706
95 Ga0068863_100051293 3300005841 Bacteria 3910
96 Ga0068863_100171125 3300005841 Bacteria 2083
97 Ga0068863_100568556 3300005841 Bacteria 1120
98 Ga0068858_100096120 3300005842 Bacteria 2760
99 Ga0068860_100100985 3300005843 Bacteria 2752
100 Ga0068860_100291680 3300005843 Bacteria 1596
101 Ga0068860_100397728 3300005843 Bacteria 1363
102 Ga0068862_100940787 3300005844 Bacteria 852
103 Ga0081540_1000720 3300005983 Bacteria 30494
104 Ga0070712_100480077 3300006175 Bacteria 1039
105 Ga0097621_100059185 3300006237 Bacteria 3135
106 Ga0097621_100212965 3300006237 Bacteria 1681
107 Ga0097621_101837887 3300006237 Bacteria 578
108 Ga0068871_100108114 3300006358 Bacteria 2337
109 Ga0068871_100603230 3300006358 Bacteria 999
110 Ga0068865_100051108 3300006881 Bacteria 2859
111 Ga0097620_100001366 3300006931 Bacteria 24861
112 Ga0097620_100862639 3300006931 Bacteria 991
113 Ga0099826_10309653 3300006948 Bacteria 803
114 Ga0105240_10068429 3300009093 Bacteria 4397
115 Ga0105240_10852751 3300009093 Bacteria 983
116 Ga0105241_11257406 3300009174 Bacteria 703
117 Ga0105248_10039486 3300009177 Bacteria 5287
118 Ga0105248_10298045 3300009177 Bacteria 1816
119 Ga0105237_10004413 3300009545 Bacteria 16303
120 Ga0105237_10041106 3300009545 Bacteria 4664
121 Ga0105237_10086023 3300009545 Bacteria 3134
122 Ga0105237_10400603 3300009545 Bacteria 1377
123 Ga0105237_11085124 3300009545 Bacteria 807
124 Ga0105238_10213801 3300009551 Bacteria 1905
125 Ga0105249_10024631 3300009553 Bacteria 5410
126 Ga0105249_10297302 3300009553 Bacteria 1618
127 Ga0105148_101467 3300009978 Bacteria 1652
128 Ga0105032_100464 3300009979 Bacteria 4036
129 Ga0105239_10009508 3300010375 Bacteria 10947
130 Ga0105239_10234039 3300010375 Bacteria 2061
131 Ga0105239_10299180 3300010375 Bacteria 1812
132 Ga0105239_10574941 3300010375 Bacteria 1284
133 Ga0157373_10296706 3300013100 Bacteria 1147
134 Ga0157371_10023740 3300013102 Bacteria 4483
135 Ga0157371_10105706 3300013102 Bacteria 1997
136 Ga0157370_10187941 3300013104 Bacteria 1918
137 Ga0157370_10629255 3300013104 Bacteria 981
138 Ga0157370_10921716 3300013104 Bacteria 792
139 Ga0157369_10207204 3300013105 Bacteria 2056
140 Ga0157369_11263371 3300013105 Bacteria 753
141 Ga0157374_10117911 3300013296 Bacteria 2559
142 Ga0157374_10372325 3300013296 Bacteria 1422
143 Ga0157378_10270491 3300013297 Bacteria 1634
144 Ga0163162_10433453 3300013306 Bacteria 1447
145 Ga0157372_10033773 3300013307 Bacteria 5621
146 Ga0157372_11199890 3300013307 Bacteria 877
147 Ga0157372_11398381 3300013307 Bacteria 807
148 Ga0157375_11012665 3300013308 Bacteria 970
149 Ga0157375_11761992 3300013308 Bacteria 734
150 Ga0163163_11087155 3300014325 Bacteria 863
151 Ga0157376_11496241 3300014969 Bacteria 708
152 Ga0183360_10001 3300015689 Bacteria 3943671
153 Ga0213876_10185970 3300021384 Bacteria 1105
154 Ga0207425_1002407 3300025245 Bacteria 6593
155 Ga0209565_1000005 3300025263 Bacteria 947317
156 Ga0209565_1009299 3300025263 Bacteria 2507
157 Ga0209673_1000011 3300025273 Bacteria 586604
158 Ga0209673_1002590 3300025273 Bacteria 12215
159 Ga0209130_1009431 3300025284 Bacteria 2782
160 Ga0209675_1000004 3300025291 Bacteria 947166
161 Ga0209675_1015794 3300025291 Bacteria 2225
162 Ga0209676_1000609 3300025292 Bacteria 52392
163 Ga0209676_1000997 3300025292 Bacteria 33277
164 Ga0209676_1002265 3300025292 Bacteria 14133
165 Ga0209676_1010740 3300025292 Bacteria 3773
166 Ga0209025_1000036 3300025294 Bacteria 404113
167 Ga0209025_1001523 3300025294 Bacteria 29655
168 Ga0209025_1004302 3300025294 Bacteria 12481
169 Ga0209025_1034055 3300025294 Bacteria 2337
170 Ga0209025_1037172 3300025294 Bacteria 2165
171 Ga0209564_1000018 3300025295 Bacteria 586913
172 Ga0209564_1007557 3300025295 Bacteria 5594
173 Ga0209758_1020733 3300025297 Bacteria 3094
174 Ga0209050_1002825 3300025298 Bacteria 13847
175 Ga0209050_1009992 3300025298 Bacteria 4748
176 Ga0209256_1000021 3300025299 Bacteria 537097
177 Ga0209256_1003278 3300025299 Bacteria 11567
178 Ga0209256_1020491 3300025299 Bacteria 2062
179 Ga0209051_1009299 3300025303 Bacteria 5078
180 Ga0209051_1040571 3300025303 Bacteria 1666
181 Ga0209257_1000278 3300025304 Bacteria 114707
182 Ga0209257_1000298 3300025304 Bacteria 109259
183 Ga0209257_1000302 3300025304 Bacteria 108038
184 Ga0209257_1000875 3300025304 Bacteria 42688
185 Ga0209257_1001201 3300025304 Bacteria 32534
186 Ga0209257_1006139 3300025304 Bacteria 7946
187 Ga0209257_1011580 3300025304 Bacteria 4223
188 Ga0209257_1084415 3300025304 Bacteria 807
189 Ga0207656_10144519 3300025321 Bacteria 1123
190 Ga0207682_10229238 3300025893 Bacteria 861
191 Ga0207710_10286443 3300025900 Bacteria 830
192 Ga0207645_10169369 3300025907 Bacteria 1431
193 Ga0207707_10183355 3300025912 Bacteria 1827
194 Ga0207707_10329593 3300025912 Bacteria 1317
195 Ga0207695_10385292 3300025913 Bacteria 1287
196 Ga0207695_10776683 3300025913 Bacteria 838
197 Ga0207671_10025627 3300025914 Bacteria 4428
198 Ga0207671_10049985 3300025914 Bacteria 3096
199 Ga0207657_10094119 3300025919 Bacteria 2495
200 Ga0207649_10170328 3300025920 Bacteria 1516
201 Ga0207649_10640804 3300025920 Bacteria 820
202 Ga0207649_10925499 3300025920 Bacteria 684
203 Ga0207652_10232769 3300025921 Bacteria 1660
204 Ga0207681_10064712 3300025923 Bacteria 2526
205 Ga0207681_10092664 3300025923 Bacteria 2160
206 Ga0207650_10106633 3300025925 Bacteria 2164
207 Ga0207650_10511313 3300025925 Bacteria 1004
208 Ga0207650_10786947 3300025925 Bacteria 806
209 Ga0207659_10151242 3300025926 Bacteria 1813
210 Ga0207644_10176261 3300025931 Bacteria 1673
211 Ga0207644_10337311 3300025931 Bacteria 1222
212 Ga0207690_10212998 3300025932 Bacteria 1474
213 Ga0207706_10319720 3300025933 Bacteria 1351
214 Ga0207706_10907128 3300025933 Bacteria 744
215 Ga0207669_10060595 3300025937 Bacteria 2321
216 Ga0207704_10297819 3300025938 Bacteria 1234
217 Ga0207691_10022322 3300025940 Bacteria 5969
218 Ga0207691_10129413 3300025940 Bacteria 2231
219 Ga0207711_10010400 3300025941 Bacteria 7726
220 Ga0207711_11158648 3300025941 Bacteria 714
221 Ga0207679_10155204 3300025945 Bacteria 1868
222 Ga0207679_10581513 3300025945 Bacteria 1007
223 Ga0207679_10705167 3300025945 Bacteria 916
224 Ga0207667_10238399 3300025949 Bacteria 1862
225 Ga0207667_10316733 3300025949 Bacteria 1593
226 Ga0207712_10003676 3300025961 Bacteria 9678
227 Ga0207712_10092499 3300025961 Bacteria 2230
228 Ga0207668_10050765 3300025972 Bacteria 2860
229 Ga0207668_10127287 3300025972 Bacteria 1939
230 Ga0207658_10009992 3300025986 Bacteria 6450
231 Ga0207658_10030939 3300025986 Bacteria 3796
232 Ga0207658_11255050 3300025986 Bacteria 677
233 Ga0207677_10015766 3300026023 Bacteria 4457
234 Ga0207703_10607064 3300026035 Bacteria 1035
235 Ga0207639_10000208 3300026041 Bacteria 44428
236 Ga0207639_10000826 3300026041 Bacteria 21061
237 Ga0207639_10233602 3300026041 Bacteria 1595
238 Ga0207639_10247122 3300026041 Bacteria 1554
239 Ga0207639_10801732 3300026041 Bacteria 877
240 Ga0207639_11366389 3300026041 Bacteria 665
241 Ga0207678_10024939 3300026067 Bacteria 5221
242 Ga0207678_10041515 3300026067 Bacteria 3989
243 Ga0207678_10051615 3300026067 Bacteria 3550
244 Ga0207678_10332154 3300026067 Bacteria 1309
245 Ga0207678_10630411 3300026067 Bacteria 941
246 Ga0207678_10755378 3300026067 Bacteria 857
247 Ga0207678_10824101 3300026067 Bacteria 819
248 Ga0207702_10609749 3300026078 Bacteria 1071
249 Ga0207641_10312117 3300026088 Bacteria 1488
250 Ga0207648_10034433 3300026089 Bacteria 4465
251 Ga0207648_10130098 3300026089 Bacteria 2216
252 Ga0207676_10205540 3300026095 Bacteria 1743
253 Ga0207674_10036873 3300026116 Bacteria 5089
254 Ga0207674_10100053 3300026116 Bacteria 2881
255 Ga0207675_100030912 3300026118 Bacteria 4987
256 Ga0207675_100428895 3300026118 Bacteria 1307
257 Ga0207683_10220997 3300026121 Bacteria 1726
258 Ga0207683_10449274 3300026121 Bacteria 1188
259 Ga0207683_10466388 3300026121 Bacteria 1165
260 Ga0207698_10542259 3300026142 Bacteria 1139
261 Ga0209973_1035534 3300027252 Bacteria 716
262 Ga0209969_1014775 3300027360 Bacteria 1138
263 Ga0210000_1003965 3300027462 Bacteria 2143
264 Ga0209995_1005833 3300027471 Bacteria 1982
265 Ga0209999_1003952 3300027543 Bacteria 2668
266 Ga0209982_1001429 3300027552 Bacteria 3261
267 Ga0209970_1017485 3300027614 Bacteria 1200
268 Ga0209983_1000195 3300027665 Bacteria 11905
269 Ga0209971_1000653 3300027682 Bacteria 9043
270 Ga0209974_10002600 3300027876 Bacteria 6558
271 Ga0268266_10000001 3300028379 Bacteria 4040580
272 Ga0268266_10099640 3300028379 Bacteria 2558
273 Ga0268266_10183913 3300028379 Bacteria 1905
274 Ga0268266_10452955 3300028379 Bacteria 1220
275 Ga0268266_11152327 3300028379 Bacteria 750
276 Ga0268265_10000756 3300028380 Bacteria 31420
277 Ga0268264_10320205 3300028381 Bacteria 1466
278 Ga0316177_1092461 3300030731 Bacteria 2303
279 Ga0314311_1251960 3300030733 Bacteria 2731
280 Ga0307408_100141601 3300031548 Bacteria 1888
281 Ga0307405_10130495 3300031731 Bacteria 1736
282 Ga0307405_10288408 3300031731 Bacteria 1239
283 Ga0307413_10015582 3300031824 Bacteria 3901
284 Ga0307413_10048583 3300031824 Bacteria 2537
285 Ga0307413_10060702 3300031824 Bacteria 2329
286 Ga0307413_10135780 3300031824 Bacteria 1691
287 Ga0307410_10408981 3300031852 Bacteria 1098
288 Ga0307410_11467384 3300031852 Bacteria 600
289 Ga0307406_10009107 3300031901 Bacteria 5557
290 Ga0307406_10017366 3300031901 Bacteria 4188
291 Ga0307406_10562059 3300031901 Bacteria 935
292 Ga0307407_10247168 3300031903 Bacteria 1220
293 Ga0307412_10267423 3300031911 Bacteria 1336
294 Ga0307412_10387284 3300031911 Bacteria 1134
295 Ga0307412_10493003 3300031911 Bacteria 1018
296 Ga0307409_100299678 3300031995 Bacteria 1495
297 Ga0307414_10043638 3300032004 Bacteria 3056
298 Ga0307414_10086674 3300032004 Bacteria 2311
299 Ga0307414_10115732 3300032004 Bacteria 2051
300 Ga0307414_10828722 3300032004 Bacteria 845
301 Ga0307414_11157530 3300032004 Bacteria 715
302 Ga0307411_10091866 3300032005 Bacteria 2121
303 Ga0307411_10498561 3300032005 Bacteria 1029
304 Ga0307411_10540734 3300032005 Bacteria 992
305 Ga0307411_11679055 3300032005 Bacteria 587
306 Ga0307415_100078865 3300032126 Bacteria 2344
307 Ga0307507_10168485 3300033179 Bacteria 1598
308 Ga0395899_0046086 3300037312 Bacteria 3248
309 Ga0395899_0397164 3300037312 Bacteria 913
310 Ga0395900_0081523 3300037418 Bacteria 3324
311 Ga0395900_0097163 3300037418 Bacteria 3026
312 Ga0395900_0351630 3300037418 Bacteria 1447
313 Ga0395898_0018239 3300037466 Bacteria 7158
314 Ga0395898_0080516 3300037466 Bacteria 3141
315 Ga0395898_0126548 3300037466 Bacteria 2448
316 Ga0395898_0132314 3300037466 Bacteria 2388
317 Ga0395905_0005223 3300037471 Bacteria 13292
318 Ga0395905_0051587 3300037471 Bacteria 3853
319 Ga0395905_0465397 3300037471 Bacteria 1163
320 Ga0395905_0850615 3300037471 Bacteria 815
321 Ga0395901_0004653 3300038443 Bacteria 13839
322 Ga0395901_0027590 3300038443 Bacteria 5835
323 Ga0395901_0316340 3300038443 Bacteria 1616
324 Ga0439436_0009256 3300041404 Bacteria 3020
325 Ga0439436_0014762 3300041404 Bacteria 2353
326 Ga0439436_0019129 3300041404 Bacteria 2046
327 Ga0439436_0028566 3300041404 Bacteria 1628
328 Ga0439436_0079576 3300041404 Bacteria 912
329 Ga0439439_0006586 3300041406 Bacteria 2689
330 Ga0439439_0022745 3300041406 Bacteria 1568
331 Ga0439447_018084 3300041407 Bacteria 1907
332 Ga0439465_0007162 3300041413 Bacteria 3544
333 Ga0451789_1138064 3300041443 Bacteria 796
334 Ga0451791_0230566 3300041451 Bacteria 1317
335 Ga0451791_0948652 3300041451 Bacteria 1024
336 Ga0451791_1482568 3300041451 Bacteria 1996
337 Ga0451793_0028848 3300041452 Bacteria 742
338 Ga0451793_0043582 3300041452 Bacteria 1289
339 Ga0451793_0518712 3300041452 Bacteria 2407
340 Ga0451795_0254603 3300041456 Bacteria 1254
341 Ga0451802_0773531 3300041460 Bacteria 773
342 Ga0451802_2191688 3300041460 Bacteria 1163
343 Ga0451807_1395045 3300041486 Bacteria 864
344 Ga0451807_1473641 3300041486 Bacteria 529
345 Ga0451807_2645245 3300041486 Bacteria 712
346 Ga0451833_1056043 3300041491 Bacteria 1780
347 Ga0451837_0081244 3300041494 Bacteria 3765
348 Ga0451839_0830803 3300041496 Bacteria 858
349 Ga0451841_0381032 3300041498 Bacteria 567
350 Ga0451843_0380426 3300041509 Bacteria 1179
351 Ga0451843_0666808 3300041509 Bacteria 594
352 Ga0451843_1321410 3300041509 Bacteria 1179
353 Ga0451843_1425177 3300041509 Bacteria 630
354 Ga0451853_0029108 3300041512 Bacteria 4546
355 Ga0451853_0064262 3300041512 Bacteria 851
356 Ga0451853_0198303 3300041512 Bacteria 1258
357 Ga0451853_1477791 3300041512 Bacteria 1030
358 Ga0451853_2599402 3300041512 Bacteria 1246
359 Ga0439445_0084568 3300042004 Bacteria 889
360 Ga0439432_000985 3300042006 Bacteria 10767
361 Ga0439432_019432 3300042006 Bacteria 2262
362 Ga0439432_050008 3300042006 Bacteria 1305
363 Ga0439432_206498 3300042006 Bacteria 568
364 Ga0439449_0006867 3300042007 Bacteria 4339
365 Ga0439449_0010134 3300042007 Bacteria 3564
366 Ga0439449_0023556 3300042007 Bacteria 2302
367 Ga0439449_0048639 3300042007 Bacteria 1569
368 Ga0439452_043005 3300042010 Bacteria 1057
369 Ga0439457_060400 3300042014 Bacteria 858
370 Ga0439462_0016465 3300042015 Bacteria 1909
371 Ga0450899_013025 3300042135 Bacteria 937
372 Ga0439434_0120176 3300042435 Bacteria 856
373 Ga0466972_0000517 3300044658 Bacteria 19217
374 Ga0466970_0002510 3300044765 Bacteria 8847
375 Ga0466959_0018971 3300045049 Bacteria 5054
376 Ga0466967_0678266 3300045976 Bacteria 1020
377 Ga0495598_0040242 3300046537 Bacteria 1362
378 Ga0495668_0002840 3300046616 Bacteria 13763
379 Ga0495686_0005954 3300047472 Bacteria 9491
380 Ga0496100_0424444 3300048903 Bacteria 1016
381 Ga0496101_0085471 3300048904 Bacteria 2338
382 Ga0496108_0050982 3300048911 Bacteria 3467
383 Ga0496108_0262176 3300048911 Bacteria 1504
384 Ga0496109_0388682 3300048912 Bacteria 1318
385 Ga0496112_0201271 3300048915 Bacteria 1950
386 Ga0496113_0167432 3300048916 Bacteria 1739
387 Ga0496117_0015693 3300048920 Bacteria 6434
388 Ga0496118_0001948 3300048921 Bacteria 29244
389 Ga0496118_0006029 3300048921 Bacteria 13501
390 Ga0496121_0001765 3300048924 Bacteria 35153
391 Ga0496121_0130794 3300048924 Bacteria 1879
392 Ga0496122_0012080 3300048925 Bacteria 8655
393 Ga0496123_0007406 3300048926 Bacteria 10354
394 Ga0496124_0000009 3300048927 Bacteria 734820
395 Ga0496126_0514175 3300048929 Bacteria 955
396 Ga0501308_051831 3300049128 Bacteria 602
397 Ga0501031_0001839 3300049568 Bacteria 13347
398 Ga0501031_0017134 3300049568 Bacteria 4707
399 Ga0501032_0002755 3300049569 Bacteria 13683
400 Ga0501032_0003047 3300049569 Bacteria 12986
401 Ga0501032_0058425 3300049569 Bacteria 2589
402 Ga0501032_0653523 3300049569 Bacteria 668
403 Ga0501033_0006402 3300049570 Bacteria 9222
404 Ga0501033_0098062 3300049570 Bacteria 2140
405 Ga0501033_0228374 3300049570 Bacteria 1323
406 Ga0501034_0018969 3300049571 Bacteria 7047
407 Ga0501034_0027329 3300049571 Bacteria 5804
408 Ga0501034_0044999 3300049571 Bacteria 4461
409 Ga0501034_0098383 3300049571 Bacteria 2921
410 Ga0501034_0675089 3300049571 Bacteria 933
411 Ga0501036_0007830 3300049572 Bacteria 8742
412 Ga0501036_0051345 3300049572 Bacteria 3491
413 Ga0501036_0099718 3300049572 Bacteria 2456
414 Ga0501036_1457668 3300049572 Bacteria 554
415 Ga0501037_0002666 3300049573 Bacteria 12862
416 Ga0501037_0003097 3300049573 Bacteria 12054
417 Ga0501037_0011887 3300049573 Bacteria 6411
418 Ga0501037_0081310 3300049573 Bacteria 2349
419 Ga0501038_0004367 3300049574 Bacteria 13156
420 Ga0501038_0010941 3300049574 Bacteria 8288
421 Ga0501038_0175703 3300049574 Bacteria 1731
422 Ga0501038_0177175 3300049574 Bacteria 1722
423 Ga0501038_0349086 3300049574 Bacteria 1152
424 Ga0501038_0620345 3300049574 Bacteria 817
425 Ga0501039_0014180 3300049575 Bacteria 6103
426 Ga0501039_0199230 3300049575 Bacteria 1574
427 Ga0501039_0224220 3300049575 Bacteria 1477
428 Ga0501042_0122987 3300049578 Bacteria 1868
429 Ga0501043_0028416 3300049579 Bacteria 4390
430 Ga0501043_0081539 3300049579 Bacteria 2542
431 Ga0501043_0638385 3300049579 Bacteria 783
432 Ga0501046_0063540 3300049580 Bacteria 2882
433 Ga0501046_0112596 3300049580 Bacteria 2077
434 Ga0501046_0126896 3300049580 Bacteria 1937
435 Ga0501047_0017221 3300049581 Bacteria 6918
436 Ga0501047_0022140 3300049581 Bacteria 6106
437 Ga0501047_0075321 3300049581 Bacteria 3247
438 Ga0501047_0198082 3300049581 Bacteria 1870
439 Ga0501047_0820963 3300049581 Bacteria 744
440 Ga0501048_0043861 3300049582 Bacteria 3200
441 Ga0501067_0008878 3300049583 Bacteria 5568
442 Ga0501068_0008523 3300049584 Bacteria 5709
443 Ga0501068_0067096 3300049584 Bacteria 2185
444 Ga0501069_0022354 3300049585 Bacteria 3439
445 Ga0501069_0071862 3300049585 Bacteria 1940
446 Ga0501070_0008781 3300049586 Bacteria 8545
447 Ga0501070_0020047 3300049586 Bacteria 5606
448 Ga0501070_0089365 3300049586 Bacteria 2549
449 Ga0501070_0098765 3300049586 Bacteria 2415
450 Ga0501071_0036212 3300049587 Bacteria 3518
451 Ga0501071_0215556 3300049587 Bacteria 1444
452 Ga0501072_0113886 3300049588 Bacteria 2153
453 Ga0501073_0011217 3300049589 Bacteria 6554
454 Ga0501073_0016870 3300049589 Bacteria 5289
455 Ga0501073_0220844 3300049589 Bacteria 1309
456 Ga0501073_0338693 3300049589 Bacteria 1038
457 Ga0501073_0360163 3300049589 Bacteria 1004
458 Ga0501074_0039745 3300049590 Bacteria 3407
459 Ga0501074_0449676 3300049590 Bacteria 913
460 Ga0501076_0193994 3300049592 Bacteria 1658
461 Ga0501216_039051 3300049660 Bacteria 902
462 Ga0501224_038389 3300049664 Bacteria 722
463 Ga0501240_059238 3300049673 Bacteria 672
464 Ga0501250_019066 3300049680 Bacteria 874
465 Ga0501253_060792 3300049683 Bacteria 814
466 Ga0501257_011457 3300049686 Bacteria 2025
467 Ga0501079_0111441 3300049741 Bacteria 2126
468 Ga0501080_0012609 3300049742 Bacteria 7750
469 Ga0501080_0016130 3300049742 Bacteria 6896
470 Ga0501080_0273958 3300049742 Bacteria 1535
471 Ga0501080_0375739 3300049742 Bacteria 1281
472 Ga0501080_0456883 3300049742 Bacteria 1144
473 Ga0501081_0181767 3300049743 Bacteria 1521
474 Ga0501083_0078977 3300049744 Bacteria 2182
475 Ga0501083_0112126 3300049744 Bacteria 1792
476 Ga0501263_020390 3300049760 Bacteria 889
477 Ga0501274_033428 3300049771 Bacteria 590
478 Ga0501276_014638 3300049773 Bacteria 699
479 Ga0501035_0031178 3300049822 Bacteria 4855
480 Ga0501035_0034292 3300049822 Bacteria 4612
481 Ga0501035_0036740 3300049822 Bacteria 4438
482 Ga0501035_0057677 3300049822 Bacteria 3461
483 Ga0501035_0129816 3300049822 Bacteria 2198
484 Ga0501035_0134250 3300049822 Bacteria 2155
485 Ga0501044_0015741 3300049823 Bacteria 8145
486 Ga0501044_0043505 3300049823 Bacteria 4664
487 Ga0501044_0126902 3300049823 Bacteria 2548
488 Ga0501044_0169345 3300049823 Bacteria 2156
489 Ga0501044_0305811 3300049823 Bacteria 1518
490 Ga0500610_0010383 3300053079 Bacteria 4186
491 Ga0500643_035820 3300053087 Bacteria 1485
492 Ga0500651_0000131 3300053093 Bacteria 46394
493 Ga0500597_000323 3300053120 Bacteria 9850
494 Ga0500628_020330 3300053129 Bacteria 1333
495 Ga0500568_0004510 3300053139 Bacteria 7419
496 Ga0500645_081075 3300053730 Bacteria 926
497 Ga0501084_0149072 3300054114 Bacteria 1971
498 Ga0501084_0279584 3300054114 Bacteria 1409
499 Ga0501082_0001536 3300060353 Bacteria 20328
500 Ga0501082_0117136 3300060353 Bacteria 2307
501 Ga0501082_0235299 3300060353 Bacteria 1594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_101045653 Ga0070675_1010456531 149
2 3300025893 Ga0207682_10229238 Ga0207682_102292382 149
3 3300025925 Ga0207650_10786947 Ga0207650_107869472 149
4 3300031824 Ga0307413_10015582 Ga0307413_100155823 151
5 3300041486 Ga0451807_1473641 Ga0451807_1473641_18_491 152
6 3300042014 Ga0439457_060400 Ga0439457_060400_20_502 153
7 iso_pu_bacteria 2571042365 2572256211 154
8 iso_pu_bacteria 2643221695 2644528530 155
9 iso_pu_bacteria 2941489479 2941491669 155
10 iso_pu_bacteria 2995948881 2995952706 155
11 3300049571 Ga0501034_0675089 Ga0501034_0675089_242_724 156
12 iso_pu_bacteria 2643221559 2643815755 156
13 iso_pu_bacteria 2643221586 2643940740 156
14 iso_pu_bacteria 2643221612 2644080213 156
15 iso_pu_bacteria 2643221727 2644695809 156
16 iso_pu_bacteria 2842780639 2842781207 156
17 3300005353 Ga0070669_100091603 Ga0070669_1000916032 157
18 3300009979 Ga0105032_100464 Ga0105032_1004642 157
19 3300025923 Ga0207681_10092664 Ga0207681_100926642 157
20 3300031911 Ga0307412_10493003 Ga0307412_104930032 157
21 iso_pu_bacteria 8003014200 8003014894 157
22 3300031852 Ga0307410_10408981 Ga0307410_104089812 158
23 3300031852 Ga0307410_11467384 Ga0307410_114673841 158
24 3300031901 Ga0307406_10009107 Ga0307406_100091072 158
25 3300031901 Ga0307406_10562059 Ga0307406_105620592 158
26 3300031995 Ga0307409_100299678 Ga0307409_1002996781 158
27 3300032004 Ga0307414_10043638 Ga0307414_100436383 158
28 3300032004 Ga0307414_10828722 Ga0307414_108287222 158
29 3300032005 Ga0307411_10498561 Ga0307411_104985611 158
30 3300032005 Ga0307411_10540734 Ga0307411_105407341 158
31 3300037471 Ga0395905_0850615 Ga0395905_0850615_278_769 158
32 3300049128 Ga0501308_051831 Ga0501308_051831_59_547 158
33 3300049660 Ga0501216_039051 Ga0501216_039051_160_648 158
34 3300049664 Ga0501224_038389 Ga0501224_038389_137_625 158
35 3300049680 Ga0501250_019066 Ga0501250_019066_119_607 158
36 3300049686 Ga0501257_011457 Ga0501257_011457_1300_1788 158
37 3300049773 Ga0501276_014638 Ga0501276_014638_102_590 158
38 iso_pu_bacteria 2643221573 2643878117 158
39 iso_pu_bacteria 2643221593 2643975557 158
40 iso_pu_bacteria 2643221720 2644659426 158
41 iso_pu_bacteria 2643221728 2644700828 158
42 3300003320 rootH2_10074821 rootH2_100748212 159
43 3300003322 rootL2_10054142 rootL2_100541423 159
44 3300003771 Ga0055526_1000011 Ga0055526_1000011125 159
45 3300003773 Ga0055537_1000007 Ga0055537_1000007125 159
46 3300003773 Ga0055537_1000498 Ga0055537_10004983 159
47 3300003775 Ga0055524_1000034 Ga0055524_100003479 159
48 3300003784 Ga0055534_1000013 Ga0055534_100001350 159
49 3300003790 Ga0055528_1000005 Ga0055528_1000005125 159
50 3300003794 Ga0055531_10004086 Ga0055531_100040869 159
51 3300009978 Ga0105148_101467 Ga0105148_1014673 159
52 3300013104 Ga0157370_10921716 Ga0157370_109217161 159
53 3300015689 Ga0183360_10001 Ga0183360_10001502 159
54 3300025263 Ga0209565_1000005 Ga0209565_1000005605 159
55 3300025263 Ga0209565_1009299 Ga0209565_10092993 159
56 3300025273 Ga0209673_1000011 Ga0209673_1000011260 159
57 3300025291 Ga0209675_1000004 Ga0209675_1000004605 159
58 3300025295 Ga0209564_1000018 Ga0209564_1000018260 159
59 3300025299 Ga0209256_1000021 Ga0209256_1000021208 159
60 3300025304 Ga0209257_1000302 Ga0209257_100030259 159
61 3300025972 Ga0207668_10127287 Ga0207668_101272872 159
62 3300031548 Ga0307408_100141601 Ga0307408_1001416012 159
63 3300031731 Ga0307405_10288408 Ga0307405_102884082 159
64 3300031824 Ga0307413_10060702 Ga0307413_100607023 159
65 3300031824 Ga0307413_10135780 Ga0307413_101357802 159
66 3300031901 Ga0307406_10017366 Ga0307406_100173662 159
67 3300031903 Ga0307407_10247168 Ga0307407_102471682 159
68 3300031911 Ga0307412_10387284 Ga0307412_103872842 159
69 3300032004 Ga0307414_10115732 Ga0307414_101157323 159
70 3300032005 Ga0307411_10091866 Ga0307411_100918662 159
71 3300032005 Ga0307411_11679055 Ga0307411_116790551 159
72 3300032126 Ga0307415_100078865 Ga0307415_1000788653 159
73 3300041404 Ga0439436_0014762 Ga0439436_0014762_1098_1589 159
74 3300041404 Ga0439436_0019129 Ga0439436_0019129_1520_2011 159
75 3300041404 Ga0439436_0028566 Ga0439436_0028566_32_529 159
76 3300041406 Ga0439439_0022745 Ga0439439_0022745_716_1207 159
77 3300041407 Ga0439447_018084 Ga0439447_018084_51_548 159
78 3300041512 Ga0451853_0198303 Ga0451853_0198303_120_632 159
79 3300042006 Ga0439432_000985 Ga0439432_000985_6187_6759 159
80 3300042006 Ga0439432_019432 Ga0439432_019432_1748_2239 159
81 3300042006 Ga0439432_050008 Ga0439432_050008_147_638 159
82 3300042007 Ga0439449_0010134 Ga0439449_0010134_794_1285 159
83 3300042007 Ga0439449_0048639 Ga0439449_0048639_1059_1550 159
84 3300042435 Ga0439434_0120176 Ga0439434_0120176_339_830 159
85 3300046616 Ga0495668_0002840 Ga0495668_0002840_367_864 159
86 3300048924 Ga0496121_0001765 Ga0496121_0001765_29598_30095 159
87 3300049673 Ga0501240_059238 Ga0501240_059238_63_554 159
88 3300049683 Ga0501253_060792 Ga0501253_060792_153_644 159
89 3300049771 Ga0501274_033428 Ga0501274_033428_57_548 159
90 3300005615 Ga0070702_101219511 Ga0070702_1012195111 160
91 3300006948 Ga0099826_10309653 Ga0099826_103096532 160
92 3300025292 Ga0209676_1000997 Ga0209676_10009973 160
93 3300027252 Ga0209973_1035534 Ga0209973_10355342 160
94 3300027360 Ga0209969_1014775 Ga0209969_10147752 160
95 3300027462 Ga0210000_1003965 Ga0210000_10039653 160
96 3300027471 Ga0209995_1005833 Ga0209995_10058333 160
97 3300027543 Ga0209999_1003952 Ga0209999_10039524 160
98 3300027552 Ga0209982_1001429 Ga0209982_10014294 160
99 3300027614 Ga0209970_1017485 Ga0209970_10174852 160
100 3300027665 Ga0209983_1000195 Ga0209983_100019511 160
101 3300027682 Ga0209971_1000653 Ga0209971_10006536 160
102 3300027876 Ga0209974_10002600 Ga0209974_100026002 160
103 3300031731 Ga0307405_10130495 Ga0307405_101304952 160
104 3300031911 Ga0307412_10267423 Ga0307412_102674232 160
105 3300032004 Ga0307414_10086674 Ga0307414_100866744 160
106 3300032004 Ga0307414_11157530 Ga0307414_111575301 160
107 3300041498 Ga0451841_0381032 Ga0451841_0381032_51_548 160
108 3300048903 Ga0496100_0424444 Ga0496100_0424444_237_731 160
109 3300048911 Ga0496108_0050982 Ga0496108_0050982_2015_2509 160
110 3300048915 Ga0496112_0201271 Ga0496112_0201271_707_1201 160
111 3300048916 Ga0496113_0167432 Ga0496113_0167432_1021_1515 160
112 3300048927 Ga0496124_0000009 Ga0496124_0000009_56031_56531 160
113 3300049568 Ga0501031_0017134 Ga0501031_0017134_1519_2016 160
114 3300049569 Ga0501032_0002755 Ga0501032_0002755_7501_7998 160
115 3300049569 Ga0501032_0653523 Ga0501032_0653523_78_575 160
116 3300049570 Ga0501033_0228374 Ga0501033_0228374_105_602 160
117 3300049571 Ga0501034_0018969 Ga0501034_0018969_6271_6768 160
118 3300049571 Ga0501034_0098383 Ga0501034_0098383_385_963 160
119 3300049572 Ga0501036_0007830 Ga0501036_0007830_5432_5929 160
120 3300049573 Ga0501037_0003097 Ga0501037_0003097_5878_6375 160
121 3300049574 Ga0501038_0177175 Ga0501038_0177175_1168_1665 160
122 3300049575 Ga0501039_0014180 Ga0501039_0014180_287_784 160
123 3300049579 Ga0501043_0081539 Ga0501043_0081539_1388_1885 160
124 3300049581 Ga0501047_0022140 Ga0501047_0022140_184_681 160
125 3300049581 Ga0501047_0198082 Ga0501047_0198082_271_768 160
126 3300049584 Ga0501068_0067096 Ga0501068_0067096_1081_1578 160
127 3300049586 Ga0501070_0008781 Ga0501070_0008781_2629_3126 160
128 3300049587 Ga0501071_0215556 Ga0501071_0215556_842_1339 160
129 3300049589 Ga0501073_0220844 Ga0501073_0220844_245_742 160
130 3300049742 Ga0501080_0012609 Ga0501080_0012609_5987_6484 160
131 3300049822 Ga0501035_0057677 Ga0501035_0057677_1069_1566 160
132 3300049823 Ga0501044_0169345 Ga0501044_0169345_602_1099 160
133 3300003187 JGI25151J46595_10052990 JGI25151J46595_100529902 161
134 3300003771 Ga0055526_1004338 Ga0055526_10043388 161
135 3300003775 Ga0055524_1024398 Ga0055524_10243983 161
136 3300003775 Ga0055524_1054090 Ga0055524_10540902 161
137 3300003781 Ga0055536_1004788 Ga0055536_10047884 161
138 3300003784 Ga0055534_1014137 Ga0055534_10141372 161
139 3300003791 Ga0055530_10002764 Ga0055530_1000276411 161
140 3300003794 Ga0055531_10008204 Ga0055531_100082043 161
141 3300003794 Ga0055531_10041173 Ga0055531_100411732 161
142 3300005288 Ga0065714_10095882 Ga0065714_100958823 161
143 3300005288 Ga0065714_10184299 Ga0065714_101842992 161
144 3300005293 Ga0065715_10015212 Ga0065715_100152124 161
145 3300005293 Ga0065715_10031073 Ga0065715_100310732 161
146 3300005293 Ga0065715_10111066 Ga0065715_101110662 161
147 3300005327 Ga0070658_10249588 Ga0070658_102495882 161
148 3300005328 Ga0070676_10124167 Ga0070676_101241673 161
149 3300005331 Ga0070670_100180693 Ga0070670_1001806932 161
150 3300005339 Ga0070660_100510348 Ga0070660_1005103482 161
151 3300005353 Ga0070669_100035593 Ga0070669_1000355933 161
152 3300005356 Ga0070674_100090414 Ga0070674_1000904143 161
153 3300005366 Ga0070659_100218049 Ga0070659_1002180491 161
154 3300005455 Ga0070663_100240003 Ga0070663_1002400031 161
155 3300005456 Ga0070678_100840999 Ga0070678_1008409992 161
156 3300005457 Ga0070662_100443779 Ga0070662_1004437792 161
157 3300005458 Ga0070681_10577253 Ga0070681_105772532 161
158 3300005530 Ga0070679_100033075 Ga0070679_1000330755 161
159 3300005543 Ga0070672_100038786 Ga0070672_1000387863 161
160 3300005564 Ga0070664_100384454 Ga0070664_1003844542 161
161 3300013100 Ga0157373_10296706 Ga0157373_102967062 161
162 3300013102 Ga0157371_10023740 Ga0157371_100237403 161
163 3300013102 Ga0157371_10105706 Ga0157371_101057064 161
164 3300013104 Ga0157370_10187941 Ga0157370_101879413 161
165 3300013306 Ga0163162_10433453 Ga0163162_104334532 161
166 3300013308 Ga0157375_11761992 Ga0157375_117619921 161
167 3300025273 Ga0209673_1002590 Ga0209673_100259011 161
168 3300025284 Ga0209130_1009431 Ga0209130_10094314 161
169 3300025291 Ga0209675_1015794 Ga0209675_10157942 161
170 3300025292 Ga0209676_1000609 Ga0209676_100060912 161
171 3300025292 Ga0209676_1002265 Ga0209676_100226513 161
172 3300025292 Ga0209676_1010740 Ga0209676_10107402 161
173 3300025294 Ga0209025_1001523 Ga0209025_100152321 161
174 3300025294 Ga0209025_1004302 Ga0209025_10043029 161
175 3300025294 Ga0209025_1034055 Ga0209025_10340553 161
176 3300025294 Ga0209025_1037172 Ga0209025_10371722 161
177 3300025295 Ga0209564_1007557 Ga0209564_10075577 161
178 3300025298 Ga0209050_1002825 Ga0209050_10028258 161
179 3300025298 Ga0209050_1009992 Ga0209050_10099922 161
180 3300025299 Ga0209256_1003278 Ga0209256_10032788 161
181 3300025299 Ga0209256_1020491 Ga0209256_10204912 161
182 3300025303 Ga0209051_1040571 Ga0209051_10405712 161
183 3300025304 Ga0209257_1000298 Ga0209257_100029813 161
184 3300025304 Ga0209257_1000875 Ga0209257_100087532 161
185 3300025304 Ga0209257_1001201 Ga0209257_100120131 161
186 3300025304 Ga0209257_1006139 Ga0209257_100613910 161
187 3300025304 Ga0209257_1011580 Ga0209257_10115805 161
188 3300025912 Ga0207707_10183355 Ga0207707_101833552 161
189 3300025919 Ga0207657_10094119 Ga0207657_100941193 161
190 3300025920 Ga0207649_10170328 Ga0207649_101703283 161
191 3300025921 Ga0207652_10232769 Ga0207652_102327693 161
192 3300025923 Ga0207681_10064712 Ga0207681_100647123 161
193 3300025925 Ga0207650_10106633 Ga0207650_101066333 161
194 3300025926 Ga0207659_10151242 Ga0207659_101512423 161
195 3300025931 Ga0207644_10337311 Ga0207644_103373112 161
196 3300025932 Ga0207690_10212998 Ga0207690_102129981 161
197 3300025933 Ga0207706_10319720 Ga0207706_103197202 161
198 3300025933 Ga0207706_10907128 Ga0207706_109071282 161
199 3300025937 Ga0207669_10060595 Ga0207669_100605952 161
200 3300025940 Ga0207691_10022322 Ga0207691_100223226 161
201 3300025945 Ga0207679_10155204 Ga0207679_101552042 161
202 3300025945 Ga0207679_10705167 Ga0207679_107051671 161
203 3300026067 Ga0207678_10755378 Ga0207678_107553781 161
204 3300026089 Ga0207648_10034433 Ga0207648_100344332 161
205 3300026121 Ga0207683_10466388 Ga0207683_104663882 161
206 3300030731 Ga0316177_1092461 Ga0316177_10924613 161
207 3300030733 Ga0314311_1251960 Ga0314311_12519604 161
208 3300031824 Ga0307413_10048583 Ga0307413_100485834 161
209 3300037312 Ga0395899_0046086 Ga0395899_0046086_1072_1629 161
210 3300037312 Ga0395899_0397164 Ga0395899_0397164_312_821 161
211 3300037418 Ga0395900_0081523 Ga0395900_0081523_2172_2681 161
212 3300037418 Ga0395900_0097163 Ga0395900_0097163_1265_1822 161
213 3300037418 Ga0395900_0351630 Ga0395900_0351630_875_1375 161
214 3300037466 Ga0395898_0080516 Ga0395898_0080516_30_539 161
215 3300037466 Ga0395898_0126548 Ga0395898_0126548_557_1057 161
216 3300037466 Ga0395898_0132314 Ga0395898_0132314_939_1496 161
217 3300037471 Ga0395905_0005223 Ga0395905_0005223_2233_2790 161
218 3300037471 Ga0395905_0051587 Ga0395905_0051587_1949_2449 161
219 3300037471 Ga0395905_0465397 Ga0395905_0465397_46_546 161
220 3300038443 Ga0395901_0027590 Ga0395901_0027590_3496_4053 161
221 3300038443 Ga0395901_0316340 Ga0395901_0316340_492_992 161
222 3300041404 Ga0439436_0079576 Ga0439436_0079576_367_867 161
223 3300041413 Ga0439465_0007162 Ga0439465_0007162_1729_2229 161
224 3300041451 Ga0451791_0948652 Ga0451791_0948652_174_674 161
225 3300041460 Ga0451802_2191688 Ga0451802_2191688_482_988 161
226 3300041512 Ga0451853_0064262 Ga0451853_0064262_205_711 161
227 3300042004 Ga0439445_0084568 Ga0439445_0084568_79_579 161
228 3300042006 Ga0439432_206498 Ga0439432_206498_49_558 161
229 3300042007 Ga0439449_0006867 Ga0439449_0006867_647_1147 161
230 3300042010 Ga0439452_043005 Ga0439452_043005_544_1044 161
231 3300046537 Ga0495598_0040242 Ga0495598_0040242_467_976 161
232 3300048904 Ga0496101_0085471 Ga0496101_0085471_622_1122 161
233 3300048911 Ga0496108_0262176 Ga0496108_0262176_628_1137 161
234 3300048912 Ga0496109_0388682 Ga0496109_0388682_219_728 161
235 3300049760 Ga0501263_020390 Ga0501263_020390_93_593 161
236 3300049823 Ga0501044_0305811 Ga0501044_0305811_230_736 161
237 3300003187 JGI25151J46595_10000106 JGI25151J46595_1000010654 162
238 3300003794 Ga0055531_10017409 Ga0055531_100174092 162
239 3300005353 Ga0070669_100907875 Ga0070669_1009078751 162
240 3300005455 Ga0070663_100927508 Ga0070663_1009275081 162
241 3300005548 Ga0070665_101420984 Ga0070665_1014209841 162
242 3300005983 Ga0081540_1000720 Ga0081540_10007204 162
243 3300021384 Ga0213876_10185970 Ga0213876_101859702 162
244 3300025245 Ga0207425_1002407 Ga0207425_10024076 162
245 3300025294 Ga0209025_1000036 Ga0209025_1000036180 162
246 3300025297 Ga0209758_1020733 Ga0209758_10207332 162
247 3300025304 Ga0209257_1000278 Ga0209257_100027884 162
248 3300026041 Ga0207639_10801732 Ga0207639_108017321 162
249 3300026067 Ga0207678_10041515 Ga0207678_100415154 162
250 3300026121 Ga0207683_10220997 Ga0207683_102209975 162
251 3300028379 Ga0268266_11152327 Ga0268266_111523271 162
252 3300041404 Ga0439436_0009256 Ga0439436_0009256_2392_2901 162
253 3300041406 Ga0439439_0006586 Ga0439439_0006586_871_1380 162
254 3300041451 Ga0451791_1482568 Ga0451791_1482568_282_773 162
255 3300041486 Ga0451807_1395045 Ga0451807_1395045_282_773 162
256 3300041494 Ga0451837_0081244 Ga0451837_0081244_398_889 162
257 3300041509 Ga0451843_0380426 Ga0451843_0380426_507_998 162
258 3300041509 Ga0451843_0666808 Ga0451843_0666808_41_529 162
259 3300041509 Ga0451843_1321410 Ga0451843_1321410_407_898 162
260 3300042007 Ga0439449_0023556 Ga0439449_0023556_1150_1659 162
261 3300042015 Ga0439462_0016465 Ga0439462_0016465_701_1210 162
262 3300042135 Ga0450899_013025 Ga0450899_013025_186_695 162
263 3300044658 Ga0466972_0000517 Ga0466972_0000517_118_612 162
264 3300044765 Ga0466970_0002510 Ga0466970_0002510_8023_8517 162
265 3300049572 Ga0501036_1457668 Ga0501036_1457668_51_542 162
266 3300049574 Ga0501038_0620345 Ga0501038_0620345_11_502 162
267 3300049579 Ga0501043_0638385 Ga0501043_0638385_238_729 162
268 3300049581 Ga0501047_0820963 Ga0501047_0820963_168_659 162
269 3300049589 Ga0501073_0016870 Ga0501073_0016870_4643_5134 162
270 3300053139 Ga0500568_0004510 Ga0500568_0004510_6103_6621 162
271 3300054114 Ga0501084_0279584 Ga0501084_0279584_186_677 162
272 3300060353 Ga0501082_0001536 Ga0501082_0001536_1911_2402 162
273 2209111006 2214831368 2213870630 163
274 3300005328 Ga0070676_10057312 Ga0070676_100573122 163
275 3300005329 Ga0070683_100539060 Ga0070683_1005390602 163
276 3300005331 Ga0070670_100165101 Ga0070670_1001651011 163
277 3300005331 Ga0070670_100642435 Ga0070670_1006424352 163
278 3300005335 Ga0070666_10184417 Ga0070666_101844172 163
279 3300005337 Ga0070682_101329567 Ga0070682_1013295671 163
280 3300005338 Ga0068868_100349243 Ga0068868_1003492431 163
281 3300005344 Ga0070661_100532440 Ga0070661_1005324402 163
282 3300005344 Ga0070661_100737811 Ga0070661_1007378112 163
283 3300005347 Ga0070668_100154980 Ga0070668_1001549804 163
284 3300005347 Ga0070668_100258878 Ga0070668_1002588782 163
285 3300005347 Ga0070668_100728132 Ga0070668_1007281322 163
286 3300005353 Ga0070669_100412846 Ga0070669_1004128463 163
287 3300005366 Ga0070659_100878608 Ga0070659_1008786082 163
288 3300005367 Ga0070667_100001560 Ga0070667_10000156020 163
289 3300005367 Ga0070667_100022398 Ga0070667_1000223985 163
290 3300005367 Ga0070667_100220956 Ga0070667_1002209565 163
291 3300005367 Ga0070667_100259836 Ga0070667_1002598362 163
292 3300005367 Ga0070667_100275716 Ga0070667_1002757162 163
293 3300005437 Ga0070710_10552180 Ga0070710_105521801 163
294 3300005439 Ga0070711_100197277 Ga0070711_1001972771 163
295 3300005455 Ga0070663_100013442 Ga0070663_1000134424 163
296 3300005456 Ga0070678_100195776 Ga0070678_1001957761 163
297 3300005456 Ga0070678_100493145 Ga0070678_1004931452 163
298 3300005458 Ga0070681_10009458 Ga0070681_1000945812 163
299 3300005539 Ga0068853_100000225 Ga0068853_10000022538 163
300 3300005539 Ga0068853_100000983 Ga0068853_1000009835 163
301 3300005539 Ga0068853_100023136 Ga0068853_1000231365 163
302 3300005539 Ga0068853_100068814 Ga0068853_1000688144 163
303 3300005543 Ga0070672_100343940 Ga0070672_1003439402 163
304 3300005548 Ga0070665_100000900 Ga0070665_10000090039 163
305 3300005548 Ga0070665_100103476 Ga0070665_1001034763 163
306 3300005548 Ga0070665_100150441 Ga0070665_1001504412 163
307 3300005548 Ga0070665_100443455 Ga0070665_1004434551 163
308 3300005563 Ga0068855_100002951 Ga0068855_1000029515 163
309 3300005563 Ga0068855_100437633 Ga0068855_1004376332 163
310 3300005563 Ga0068855_100533663 Ga0068855_1005336631 163
311 3300005563 Ga0068855_100779352 Ga0068855_1007793522 163
312 3300005577 Ga0068857_100079926 Ga0068857_1000799263 163
313 3300005577 Ga0068857_100524448 Ga0068857_1005244482 163
314 3300005578 Ga0068854_100253212 Ga0068854_1002532122 163
315 3300005578 Ga0068854_100285828 Ga0068854_1002858282 163
316 3300005614 Ga0068856_100403561 Ga0068856_1004035612 163
317 3300005617 Ga0068859_100001366 Ga0068859_1000013665 163
318 3300005617 Ga0068859_100862586 Ga0068859_1008625861 163
319 3300005719 Ga0068861_100015330 Ga0068861_1000153305 163
320 3300005834 Ga0068851_10075307 Ga0068851_100753075 163
321 3300005834 Ga0068851_10079869 Ga0068851_100798692 163
322 3300005841 Ga0068863_100051293 Ga0068863_1000512934 163
323 3300005841 Ga0068863_100171125 Ga0068863_1001711255 163
324 3300005841 Ga0068863_100568556 Ga0068863_1005685563 163
325 3300005842 Ga0068858_100096120 Ga0068858_1000961205 163
326 3300005843 Ga0068860_100100985 Ga0068860_1001009855 163
327 3300005843 Ga0068860_100291680 Ga0068860_1002916801 163
328 3300005843 Ga0068860_100397728 Ga0068860_1003977282 163
329 3300005844 Ga0068862_100940787 Ga0068862_1009407871 163
330 3300006175 Ga0070712_100480077 Ga0070712_1004800772 163
331 3300006237 Ga0097621_100059185 Ga0097621_1000591852 163
332 3300006237 Ga0097621_100212965 Ga0097621_1002129654 163
333 3300006237 Ga0097621_101837887 Ga0097621_1018378871 163
334 3300006358 Ga0068871_100108114 Ga0068871_1001081143 163
335 3300006358 Ga0068871_100603230 Ga0068871_1006032301 163
336 3300006881 Ga0068865_100051108 Ga0068865_1000511085 163
337 3300006931 Ga0097620_100001366 Ga0097620_10000136623 163
338 3300006931 Ga0097620_100862639 Ga0097620_1008626391 163
339 3300009093 Ga0105240_10068429 Ga0105240_100684298 163
340 3300009093 Ga0105240_10852751 Ga0105240_108527512 163
341 3300009174 Ga0105241_11257406 Ga0105241_112574061 163
342 3300009177 Ga0105248_10039486 Ga0105248_100394865 163
343 3300009177 Ga0105248_10298045 Ga0105248_102980454 163
344 3300009545 Ga0105237_10004413 Ga0105237_1000441317 163
345 3300009545 Ga0105237_10041106 Ga0105237_100411061 163
346 3300009545 Ga0105237_10086023 Ga0105237_100860234 163
347 3300009545 Ga0105237_10400603 Ga0105237_104006031 163
348 3300009545 Ga0105237_11085124 Ga0105237_110851242 163
349 3300009551 Ga0105238_10213801 Ga0105238_102138013 163
350 3300009553 Ga0105249_10024631 Ga0105249_100246315 163
351 3300009553 Ga0105249_10297302 Ga0105249_102973022 163
352 3300010375 Ga0105239_10009508 Ga0105239_100095082 163
353 3300010375 Ga0105239_10234039 Ga0105239_102340393 163
354 3300010375 Ga0105239_10299180 Ga0105239_102991803 163
355 3300010375 Ga0105239_10574941 Ga0105239_105749412 163
356 3300013104 Ga0157370_10629255 Ga0157370_106292552 163
357 3300013105 Ga0157369_10207204 Ga0157369_102072042 163
358 3300013105 Ga0157369_11263371 Ga0157369_112633711 163
359 3300013296 Ga0157374_10117911 Ga0157374_101179115 163
360 3300013296 Ga0157374_10372325 Ga0157374_103723255 163
361 3300013297 Ga0157378_10270491 Ga0157378_102704912 163
362 3300013307 Ga0157372_10033773 Ga0157372_100337735 163
363 3300013307 Ga0157372_11199890 Ga0157372_111998901 163
364 3300013307 Ga0157372_11398381 Ga0157372_113983811 163
365 3300013308 Ga0157375_11012665 Ga0157375_110126653 163
366 3300014325 Ga0163163_11087155 Ga0163163_110871552 163
367 3300014969 Ga0157376_11496241 Ga0157376_114962411 163
368 3300025303 Ga0209051_1009299 Ga0209051_10092993 163
369 3300025304 Ga0209257_1084415 Ga0209257_10844152 163
370 3300025321 Ga0207656_10144519 Ga0207656_101445192 163
371 3300025900 Ga0207710_10286443 Ga0207710_102864431 163
372 3300025907 Ga0207645_10169369 Ga0207645_101693692 163
373 3300025912 Ga0207707_10329593 Ga0207707_103295931 163
374 3300025913 Ga0207695_10385292 Ga0207695_103852923 163
375 3300025913 Ga0207695_10776683 Ga0207695_107766831 163
376 3300025914 Ga0207671_10025627 Ga0207671_100256275 163
377 3300025914 Ga0207671_10049985 Ga0207671_100499855 163
378 3300025920 Ga0207649_10640804 Ga0207649_106408042 163
379 3300025920 Ga0207649_10925499 Ga0207649_109254991 163
380 3300025925 Ga0207650_10511313 Ga0207650_105113131 163
381 3300025931 Ga0207644_10176261 Ga0207644_101762613 163
382 3300025938 Ga0207704_10297819 Ga0207704_102978193 163
383 3300025940 Ga0207691_10129413 Ga0207691_101294135 163
384 3300025941 Ga0207711_10010400 Ga0207711_100104005 163
385 3300025941 Ga0207711_11158648 Ga0207711_111586481 163
386 3300025945 Ga0207679_10581513 Ga0207679_105815132 163
387 3300025949 Ga0207667_10238399 Ga0207667_102383994 163
388 3300025949 Ga0207667_10316733 Ga0207667_103167332 163
389 3300025961 Ga0207712_10003676 Ga0207712_100036765 163
390 3300025961 Ga0207712_10092499 Ga0207712_100924992 163
391 3300025972 Ga0207668_10050765 Ga0207668_100507655 163
392 3300025986 Ga0207658_10009992 Ga0207658_100099927 163
393 3300025986 Ga0207658_10030939 Ga0207658_100309392 163
394 3300025986 Ga0207658_11255050 Ga0207658_112550501 163
395 3300026023 Ga0207677_10015766 Ga0207677_100157665 163
396 3300026035 Ga0207703_10607064 Ga0207703_106070642 163
397 3300026041 Ga0207639_10000208 Ga0207639_1000020842 163
398 3300026041 Ga0207639_10000826 Ga0207639_100008265 163
399 3300026041 Ga0207639_10233602 Ga0207639_102336021 163
400 3300026041 Ga0207639_10247122 Ga0207639_102471224 163
401 3300026041 Ga0207639_11366389 Ga0207639_113663891 163
402 3300026067 Ga0207678_10024939 Ga0207678_100249395 163
403 3300026067 Ga0207678_10051615 Ga0207678_100516154 163
404 3300026067 Ga0207678_10332154 Ga0207678_103321541 163
405 3300026067 Ga0207678_10630411 Ga0207678_106304112 163
406 3300026067 Ga0207678_10824101 Ga0207678_108241012 163
407 3300026078 Ga0207702_10609749 Ga0207702_106097491 163
408 3300026088 Ga0207641_10312117 Ga0207641_103121175 163
409 3300026089 Ga0207648_10130098 Ga0207648_101300981 163
410 3300026095 Ga0207676_10205540 Ga0207676_102055402 163
411 3300026116 Ga0207674_10036873 Ga0207674_100368736 163
412 3300026116 Ga0207674_10100053 Ga0207674_101000535 163
413 3300026118 Ga0207675_100030912 Ga0207675_1000309125 163
414 3300026118 Ga0207675_100428895 Ga0207675_1004288952 163
415 3300026121 Ga0207683_10449274 Ga0207683_104492742 163
416 3300026142 Ga0207698_10542259 Ga0207698_105422591 163
417 3300028379 Ga0268266_10000001 Ga0268266_100000013304 163
418 3300028379 Ga0268266_10099640 Ga0268266_100996401 163
419 3300028379 Ga0268266_10183913 Ga0268266_101839133 163
420 3300028379 Ga0268266_10452955 Ga0268266_104529552 163
421 3300028380 Ga0268265_10000756 Ga0268265_1000075615 163
422 3300028381 Ga0268264_10320205 Ga0268264_103202051 163
423 3300033179 Ga0307507_10168485 Ga0307507_101684851 163
424 3300037466 Ga0395898_0018239 Ga0395898_0018239_4403_4900 163
425 3300038443 Ga0395901_0004653 Ga0395901_0004653_4575_5072 163
426 3300041443 Ga0451789_1138064 Ga0451789_1138064_121_612 163
427 3300041451 Ga0451791_0230566 Ga0451791_0230566_47_538 163
428 3300041452 Ga0451793_0028848 Ga0451793_0028848_72_563 163
429 3300041452 Ga0451793_0043582 Ga0451793_0043582_662_1153 163
430 3300041452 Ga0451793_0518712 Ga0451793_0518712_704_1195 163
431 3300041456 Ga0451795_0254603 Ga0451795_0254603_281_772 163
432 3300041460 Ga0451802_0773531 Ga0451802_0773531_221_712 163
433 3300041486 Ga0451807_2645245 Ga0451807_2645245_171_662 163
434 3300041491 Ga0451833_1056043 Ga0451833_1056043_416_907 163
435 3300041496 Ga0451839_0830803 Ga0451839_0830803_296_790 163
436 3300041509 Ga0451843_1425177 Ga0451843_1425177_86_577 163
437 3300041512 Ga0451853_0029108 Ga0451853_0029108_3019_3510 163
438 3300041512 Ga0451853_1477791 Ga0451853_1477791_96_587 163
439 3300041512 Ga0451853_2599402 Ga0451853_2599402_230_724 163
440 3300045049 Ga0466959_0018971 Ga0466959_0018971_461_967 163
441 3300045976 Ga0466967_0678266 Ga0466967_0678266_107_601 163
442 3300047472 Ga0495686_0005954 Ga0495686_0005954_129_641 163
443 3300048920 Ga0496117_0015693 Ga0496117_0015693_2177_2683 163
444 3300048921 Ga0496118_0001948 Ga0496118_0001948_4141_4647 163
445 3300048921 Ga0496118_0006029 Ga0496118_0006029_1031_1522 163
446 3300048924 Ga0496121_0130794 Ga0496121_0130794_1241_1753 163
447 3300048925 Ga0496122_0012080 Ga0496122_0012080_1151_1663 163
448 3300048926 Ga0496123_0007406 Ga0496123_0007406_6319_6831 163
449 3300048929 Ga0496126_0514175 Ga0496126_0514175_313_825 163
450 3300049568 Ga0501031_0001839 Ga0501031_0001839_5194_5685 163
451 3300049569 Ga0501032_0003047 Ga0501032_0003047_859_1350 163
452 3300049569 Ga0501032_0058425 Ga0501032_0058425_444_938 163
453 3300049570 Ga0501033_0006402 Ga0501033_0006402_1012_1506 163
454 3300049570 Ga0501033_0098062 Ga0501033_0098062_859_1350 163
455 3300049571 Ga0501034_0027329 Ga0501034_0027329_4483_4974 163
456 3300049571 Ga0501034_0044999 Ga0501034_0044999_826_1320 163
457 3300049572 Ga0501036_0051345 Ga0501036_0051345_852_1343 163
458 3300049572 Ga0501036_0099718 Ga0501036_0099718_1541_2035 163
459 3300049573 Ga0501037_0002666 Ga0501037_0002666_859_1350 163
460 3300049573 Ga0501037_0011887 Ga0501037_0011887_238_732 163
461 3300049573 Ga0501037_0081310 Ga0501037_0081310_816_1310 163
462 3300049574 Ga0501038_0004367 Ga0501038_0004367_855_1346 163
463 3300049574 Ga0501038_0010941 Ga0501038_0010941_5512_6006 163
464 3300049574 Ga0501038_0175703 Ga0501038_0175703_740_1234 163
465 3300049574 Ga0501038_0349086 Ga0501038_0349086_211_705 163
466 3300049575 Ga0501039_0199230 Ga0501039_0199230_569_1060 163
467 3300049575 Ga0501039_0224220 Ga0501039_0224220_202_696 163
468 3300049578 Ga0501042_0122987 Ga0501042_0122987_782_1276 163
469 3300049579 Ga0501043_0028416 Ga0501043_0028416_845_1336 163
470 3300049580 Ga0501046_0063540 Ga0501046_0063540_991_1485 163
471 3300049580 Ga0501046_0112596 Ga0501046_0112596_732_1223 163
472 3300049580 Ga0501046_0126896 Ga0501046_0126896_1187_1681 163
473 3300049581 Ga0501047_0017221 Ga0501047_0017221_1128_1622 163
474 3300049581 Ga0501047_0075321 Ga0501047_0075321_932_1423 163
475 3300049582 Ga0501048_0043861 Ga0501048_0043861_931_1422 163
476 3300049583 Ga0501067_0008878 Ga0501067_0008878_911_1405 163
477 3300049584 Ga0501068_0008523 Ga0501068_0008523_4123_4617 163
478 3300049585 Ga0501069_0022354 Ga0501069_0022354_1947_2441 163
479 3300049585 Ga0501069_0071862 Ga0501069_0071862_916_1416 163
480 3300049586 Ga0501070_0020047 Ga0501070_0020047_4891_5391 163
481 3300049586 Ga0501070_0089365 Ga0501070_0089365_1198_1692 163
482 3300049586 Ga0501070_0098765 Ga0501070_0098765_1570_2061 163
483 3300049587 Ga0501071_0036212 Ga0501071_0036212_1862_2356 163
484 3300049588 Ga0501072_0113886 Ga0501072_0113886_176_670 163
485 3300049589 Ga0501073_0011217 Ga0501073_0011217_323_814 163
486 3300049589 Ga0501073_0338693 Ga0501073_0338693_190_684 163
487 3300049589 Ga0501073_0360163 Ga0501073_0360163_54_548 163
488 3300049590 Ga0501074_0039745 Ga0501074_0039745_2656_3150 163
489 3300049590 Ga0501074_0449676 Ga0501074_0449676_200_694 163
490 3300049592 Ga0501076_0193994 Ga0501076_0193994_253_747 163
491 3300049741 Ga0501079_0111441 Ga0501079_0111441_869_1363 163
492 3300049742 Ga0501080_0016130 Ga0501080_0016130_1539_2039 163
493 3300049742 Ga0501080_0273958 Ga0501080_0273958_366_857 163
494 3300049742 Ga0501080_0375739 Ga0501080_0375739_133_627 163
495 3300049742 Ga0501080_0456883 Ga0501080_0456883_629_1123 163
496 3300049743 Ga0501081_0181767 Ga0501081_0181767_589_1083 163
497 3300049744 Ga0501083_0078977 Ga0501083_0078977_418_912 163
498 3300049744 Ga0501083_0112126 Ga0501083_0112126_867_1361 163
499 3300049822 Ga0501035_0031178 Ga0501035_0031178_3410_3904 163
500 3300049822 Ga0501035_0034292 Ga0501035_0034292_1342_1836 163
501 3300049822 Ga0501035_0036740 Ga0501035_0036740_3093_3584 163
502 3300049822 Ga0501035_0129816 Ga0501035_0129816_1250_1744 163
503 3300049822 Ga0501035_0134250 Ga0501035_0134250_136_630 163
504 3300049823 Ga0501044_0015741 Ga0501044_0015741_1012_1506 163
505 3300049823 Ga0501044_0043505 Ga0501044_0043505_859_1350 163
506 3300049823 Ga0501044_0126902 Ga0501044_0126902_1823_2317 163
507 3300053079 Ga0500610_0010383 Ga0500610_0010383_3685_4176 163
508 3300053087 Ga0500643_035820 Ga0500643_035820_503_1015 163
509 3300053093 Ga0500651_0000131 Ga0500651_0000131_21076_21573 163
510 3300053120 Ga0500597_000323 Ga0500597_000323_436_948 163
511 3300053129 Ga0500628_020330 Ga0500628_020330_528_1025 163
512 3300053730 Ga0500645_081075 Ga0500645_081075_120_617 163
513 3300054114 Ga0501084_0149072 Ga0501084_0149072_223_717 163
514 3300060353 Ga0501082_0117136 Ga0501082_0117136_482_976 163
515 3300060353 Ga0501082_0235299 Ga0501082_0235299_705_1199 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

49

124

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ien-assembly1.cif.gz_A crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 0.9428 4 147
5szu-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9363 4 149
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.9339 4 147
5szy-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9294 5 150
2eis-assembly1.cif.gz_A x-ray structure of acyl-coa hydrolase-like protein, tt1379, from thermus thermophilus hb8 0.9234 8 127
ID Description Score Start End Superfamily
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9428 4 147 3.10.129.10
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9246 7 112 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9211 2 149 3.10.129.10
5dm5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9171 10 119 3.10.129.10
af_E9QJN3_178_320_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9161 1 124 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1I4FUN2-F1-model_v4 Acyl-CoA hydrolase 0.9669 1 163 GO:0005829
GO:0006637
GO:0052816
AF-A0A561GZ31-F1-model_v4 deleted 0.9649 1 158
AF-A0A429WGE8-F1-model_v4 Acyl-CoA thioesterase 0.9611 6 150 GO:0005829
GO:0006637
GO:0052816
AF-A0A1I4FUN2-F1-model_v4 Acyl-CoA hydrolase 0.9611 1 163 GO:0005829
GO:0006637
GO:0052816
AF-A0A4R6Z308-F1-model_v4 Acyl-CoA hydrolase 0.9598 1 158 GO:0005829
GO:0006637
GO:0052816

Feature Viewer

pLDDT pTM Quality
92.58 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map