F457834

General Info

Members Datasets Scaffolds Average Seq Length
515 296 1030 254

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000214|Ga0081455_1000021437
Length 268
Sequence MHDLRGEVIVNIVALVKQVPDTEAERKLNPADNTVDRASVDAVINYIDEFAIEEGLQLKEAHGGEVTILTVGPERATESIRKPLSTGADKAVHVTDEALHGSDAIGTAKAIAAALKTLEYDVVIAGSEATDSRSAIVPALVAEVLGQPAPTQARKVTAEGGTVTIERVTENGFDKVQASTPAIISVVEKINEPRYPSFKGIMAAKSKPIDVKSLADLGLEAGEVGLASAWTQVVPFENAPPRAAGQTVKDEGNGAEAIADFLAGKKLI

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
211 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
212 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 6.41
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.44
Rhizosphere 92.04
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10000214 3300005937 Bacteria 73963
2 JGI24751J29686_10002605 3300002459 Bacteria 3623
3 JGI25406J46586_10002736 3300003203 Bacteria 8300
4 JGI25404J52841_10038797 3300003659 Bacteria 1010
5 JGI25405J52794_10013256 3300003911 Bacteria 1596
6 Ga0070658_10005699 3300005327 Bacteria 10101
7 Ga0070658_10021768 3300005327 Bacteria 5139
8 Ga0070670_100061974 3300005331 Bacteria 3210
9 Ga0068869_100019207 3300005334 Bacteria 4665
10 Ga0070680_100083964 3300005336 Bacteria 2630
11 Ga0070682_100043398 3300005337 Bacteria 2780
12 Ga0070660_100032125 3300005339 Bacteria 3948
13 Ga0070660_100048820 3300005339 Bacteria 3251
14 Ga0070689_100039059 3300005340 Bacteria 3633
15 Ga0070689_100233190 3300005340 Unclassified 1514
16 Ga0070691_10002226 3300005341 Bacteria 8579
17 Ga0070691_10039019 3300005341 Bacteria 2243
18 Ga0070687_100148172 3300005343 Bacteria 1374
19 Ga0070692_10006956 3300005345 Bacteria 4951
20 Ga0070668_100046254 3300005347 Bacteria 3340
21 Ga0070669_100212225 3300005353 Unclassified 1528
22 Ga0070671_100032883 3300005355 Bacteria 4287
23 Ga0070671_100046051 3300005355 Bacteria 3627
24 Ga0070674_100254458 3300005356 Unclassified 1381
25 Ga0070673_100129874 3300005364 Bacteria 2112
26 Ga0070673_100176284 3300005364 Bacteria 1827
27 Ga0070659_100012599 3300005366 Bacteria 6271
28 Ga0070659_100148132 3300005366 Bacteria 1913
29 Ga0070667_100004498 3300005367 Bacteria 11762
30 Ga0070667_100044211 3300005367 Bacteria 3739
31 Ga0070703_10023241 3300005406 Bacteria 1825
32 Ga0070709_10000453 3300005434 Bacteria 24624
33 Ga0070709_10002025 3300005434 Bacteria 11015
34 Ga0070709_10062545 3300005434 Bacteria 2373
35 Ga0070714_100003378 3300005435 Bacteria 11893
36 Ga0070714_100177289 3300005435 Bacteria 1937
37 Ga0070714_100267565 3300005435 Unclassified 1584
38 Ga0070714_100993709 3300005435 Bacteria 816
39 Ga0070713_100000581 3300005436 Bacteria 23193
40 Ga0070713_100005556 3300005436 Bacteria 8638
41 Ga0070713_100007695 3300005436 Bacteria 7583
42 Ga0070713_100054771 3300005436 Bacteria 3311
43 Ga0070713_100090892 3300005436 Bacteria 2625
44 Ga0070713_100830845 3300005436 Bacteria 886
45 Ga0070710_10000020 3300005437 Bacteria 85562
46 Ga0070710_10004829 3300005437 Bacteria 6375
47 Ga0070701_10035255 3300005438 Bacteria 2513
48 Ga0070701_10047840 3300005438 Bacteria 2204
49 Ga0070711_100002515 3300005439 Bacteria 10473
50 Ga0070705_100050384 3300005440 Bacteria 2422
51 Ga0070700_100014259 3300005441 Bacteria 4484
52 Ga0070694_100026952 3300005444 Bacteria 3728
53 Ga0070708_100131496 3300005445 Bacteria 2316
54 Ga0070708_100383015 3300005445 Unclassified 1326
55 Ga0070663_100012310 3300005455 Bacteria 5407
56 Ga0070678_100022416 3300005456 Bacteria 4185
57 Ga0070662_100127088 3300005457 Bacteria 1961
58 Ga0070681_10331293 3300005458 Bacteria 1432
59 Ga0070685_10128797 3300005466 Bacteria 1580
60 Ga0070685_10142634 3300005466 Bacteria 1510
61 Ga0070706_100011889 3300005467 Bacteria 8080
62 Ga0070707_100029677 3300005468 Bacteria 5205
63 Ga0070707_100102862 3300005468 Bacteria 2768
64 Ga0070698_100073531 3300005471 Bacteria 3424
65 Ga0070698_100131302 3300005471 Bacteria 2460
66 Ga0070684_100279218 3300005535 Bacteria 1530
67 Ga0070684_100305698 3300005535 Bacteria 1460
68 Ga0070684_100465703 3300005535 Bacteria 1169
69 Ga0070697_100030995 3300005536 Bacteria 4299
70 Ga0070697_100075506 3300005536 Bacteria 2771
71 Ga0068853_100017823 3300005539 Bacteria 5865
72 Ga0068853_100080458 3300005539 Bacteria 2851
73 Ga0070672_100108141 3300005543 Bacteria 2264
74 Ga0070686_100008970 3300005544 Bacteria 5602
75 Ga0070695_100028939 3300005545 Bacteria 3440
76 Ga0070695_100218104 3300005545 Bacteria 1373
77 Ga0070696_100033505 3300005546 Bacteria 3530
78 Ga0070693_100000566 3300005547 Bacteria 16414
79 Ga0070693_100010945 3300005547 Bacteria 4558
80 Ga0070665_100076264 3300005548 Bacteria 3360
81 Ga0070704_100031066 3300005549 Bacteria 3587
82 Ga0070704_100066523 3300005549 Bacteria 2599
83 Ga0068855_100016715 3300005563 Bacteria 8823
84 Ga0068855_100090700 3300005563 Bacteria 3526
85 Ga0070664_100117324 3300005564 Bacteria 2328
86 Ga0068857_100353112 3300005577 Bacteria 1362
87 Ga0068857_100586402 3300005577 Bacteria 1053
88 Ga0068854_100005717 3300005578 Bacteria 7860
89 Ga0068854_100048104 3300005578 Bacteria 3041
90 Ga0068856_100004890 3300005614 Bacteria 13267
91 Ga0068856_100036068 3300005614 Bacteria 4848
92 Ga0068856_100437343 3300005614 Bacteria 1328
93 Ga0070702_100002437 3300005615 Bacteria 8022
94 Ga0070702_100007642 3300005615 Bacteria 5183
95 Ga0068852_100046636 3300005616 Bacteria 3693
96 Ga0068852_100127869 3300005616 Bacteria 2336
97 Ga0068852_100216488 3300005616 Bacteria 1820
98 Ga0068852_100281310 3300005616 Bacteria 1604
99 Ga0068859_100002953 3300005617 Bacteria 17252
100 Ga0068859_100089417 3300005617 Bacteria 3130
101 Ga0068859_100100329 3300005617 Bacteria 2950
102 Ga0068864_100017166 3300005618 Bacteria 6036
103 Ga0068864_100202644 3300005618 Bacteria 1823
104 Ga0068866_10203257 3300005718 Bacteria 1185
105 Ga0068861_100136192 3300005719 Bacteria 1999
106 Ga0068851_10044689 3300005834 Bacteria 2237
107 Ga0068851_10058391 3300005834 Bacteria 1972
108 Ga0068870_10001480 3300005840 Bacteria 9507
109 Ga0068863_100010860 3300005841 Bacteria 8830
110 Ga0068863_100241666 3300005841 Unclassified 1743
111 Ga0068858_100014429 3300005842 Bacteria 7448
112 Ga0068858_100016152 3300005842 Bacteria 7013
113 Ga0068860_100082613 3300005843 Bacteria 3055
114 Ga0068862_100231706 3300005844 Bacteria 1676
115 Ga0081455_10003333 3300005937 Bacteria 18522
116 Ga0081540_1001246 3300005983 Bacteria 22225
117 Ga0081540_1002638 3300005983 Bacteria 14577
118 Ga0081540_1038206 3300005983 Bacteria 2533
119 Ga0070717_10002013 3300006028 Bacteria 14211
120 Ga0070717_10013575 3300006028 Bacteria 6247
121 Ga0070717_10661497 3300006028 Bacteria 948
122 Ga0070715_10032306 3300006163 Bacteria 2132
123 Ga0070715_10068781 3300006163 Bacteria 1576
124 Ga0070716_100000057 3300006173 Bacteria 43470
125 Ga0070716_100003310 3300006173 Bacteria 7573
126 Ga0070716_100051412 3300006173 Bacteria 2342
127 Ga0070712_100003864 3300006175 Bacteria 9222
128 Ga0070712_100041649 3300006175 Bacteria 3154
129 Ga0070712_100188668 3300006175 Bacteria 1611
130 Ga0097621_100022239 3300006237 Bacteria 4920
131 Ga0097621_100426839 3300006237 Unclassified 1191
132 Ga0068871_100016162 3300006358 Bacteria 5610
133 Ga0068871_100018826 3300006358 Bacteria 5260
134 Ga0075428_100123202 3300006844 Bacteria 2822
135 Ga0075433_10010456 3300006852 Bacteria 7451
136 Ga0075433_10026570 3300006852 Bacteria 4903
137 Ga0075433_10152797 3300006852 Bacteria 2053
138 Ga0075434_100013134 3300006871 Bacteria 7866
139 Ga0075434_100068993 3300006871 Bacteria 3523
140 Ga0075429_100062718 3300006880 Bacteria 3238
141 Ga0068865_100136525 3300006881 Bacteria 1844
142 Ga0075436_100014935 3300006914 Bacteria 5322
143 Ga0075436_100025774 3300006914 Bacteria 4046
144 Ga0097620_100002953 3300006931 Bacteria 17252
145 Ga0097620_100089413 3300006931 Bacteria 3130
146 Ga0097620_100100328 3300006931 Bacteria 2950
147 Ga0075435_100005151 3300007076 Bacteria 9087
148 Ga0075435_100038041 3300007076 Bacteria 3835
149 Ga0075435_100049921 3300007076 Bacteria 3366
150 Ga0075435_100247969 3300007076 Bacteria 1516
151 Ga0105251_10026665 3300009011 Bacteria 2940
152 Ga0105250_10143327 3300009092 Bacteria 991
153 Ga0105240_10084166 3300009093 Bacteria 3900
154 Ga0105240_10136472 3300009093 Bacteria 2937
155 Ga0105240_10171554 3300009093 Bacteria 2569
156 Ga0105240_10781778 3300009093 Bacteria 1035
157 Ga0111539_10043585 3300009094 Bacteria 5378
158 Ga0111539_10094396 3300009094 Bacteria 3514
159 Ga0111539_10679784 3300009094 Bacteria 1198
160 Ga0105245_10020230 3300009098 Bacteria 5834
161 Ga0105245_10054380 3300009098 Bacteria 3595
162 Ga0105245_10084355 3300009098 Bacteria 2910
163 Ga0105245_10597049 3300009098 Bacteria 1130
164 Ga0105247_10034325 3300009101 Bacteria 3090
165 Ga0105247_10170817 3300009101 Unclassified 1445
166 Ga0105243_10123774 3300009148 Bacteria 2184
167 Ga0105241_10028316 3300009174 Bacteria 4175
168 Ga0105241_10037898 3300009174 Bacteria 3634
169 Ga0105242_10113449 3300009176 Bacteria 2314
170 Ga0105248_10065363 3300009177 Bacteria 4085
171 Ga0105248_10106152 3300009177 Bacteria 3167
172 Ga0105237_10013597 3300009545 Bacteria 8527
173 Ga0105237_10032117 3300009545 Bacteria 5316
174 Ga0105237_10051039 3300009545 Bacteria 4156
175 Ga0105238_10056934 3300009551 Bacteria 3921
176 Ga0105238_10134137 3300009551 Bacteria 2454
177 Ga0105249_10010704 3300009553 Bacteria 8058
178 Ga0105239_10089861 3300010375 Bacteria 3388
179 Ga0105239_10096213 3300010375 Bacteria 3271
180 Ga0105239_10138828 3300010375 Bacteria 2707
181 Ga0105239_10437810 3300010375 Bacteria 1482
182 Ga0105246_10007484 3300011119 Bacteria 6692
183 Ga0157373_10133236 3300013100 Bacteria 1747
184 Ga0157373_10185919 3300013100 Bacteria 1464
185 Ga0157371_10037837 3300013102 Bacteria 3453
186 Ga0157370_10049713 3300013104 Bacteria 4012
187 Ga0157369_10012349 3300013105 Bacteria 9697
188 Ga0157369_10074443 3300013105 Bacteria 3642
189 Ga0157369_10310432 3300013105 Bacteria 1640
190 Ga0157369_10405444 3300013105 Bacteria 1414
191 Ga0157374_10031359 3300013296 Bacteria 4831
192 Ga0157374_10105294 3300013296 Bacteria 2709
193 Ga0157374_10163304 3300013296 Bacteria 2170
194 Ga0157378_10193426 3300013297 Bacteria 1920
195 Ga0163162_10052254 3300013306 Bacteria 4104
196 Ga0157372_10500116 3300013307 Unclassified 1417
197 Ga0157375_10055811 3300013308 Bacteria 3896
198 Ga0157375_10096113 3300013308 Bacteria 3035
199 Ga0157380_10039834 3300014326 Bacteria 3656
200 Ga0157377_10022811 3300014745 Bacteria 3310
201 Ga0157379_10048338 3300014968 Bacteria 3797
202 Ga0157379_10075915 3300014968 Bacteria 3010
203 Ga0157376_10144825 3300014969 Bacteria 2136
204 Ga0163161_10003689 3300017792 Bacteria 10739
205 Ga0197907_10036107 3300020069 Bacteria 1707
206 Ga0197907_10201625 3300020069 Bacteria 2170
207 Ga0197907_10498597 3300020069 Bacteria 1082
208 Ga0197907_10543746 3300020069 Bacteria 1145
209 Ga0197907_11384885 3300020069 Bacteria 1857
210 Ga0206356_10585625 3300020070 Bacteria 835
211 Ga0206356_11663142 3300020070 Bacteria 1236
212 Ga0206356_11751250 3300020070 Bacteria 1877
213 Ga0206349_1180060 3300020075 Bacteria 2269
214 Ga0206349_1717423 3300020075 Bacteria 1637
215 Ga0206349_1800766 3300020075 Bacteria 1161
216 Ga0206349_1803370 3300020075 Bacteria 1180
217 Ga0206349_1868316 3300020075 Bacteria 1578
218 Ga0206355_1001705 3300020076 Bacteria 924
219 Ga0206355_1200182 3300020076 Bacteria 1011
220 Ga0206351_10977008 3300020077 Bacteria 1166
221 Ga0206352_10943704 3300020078 Bacteria 1017
222 Ga0206352_11223561 3300020078 Bacteria 1324
223 Ga0206352_11338050 3300020078 Bacteria 1180
224 Ga0206350_10271617 3300020080 Bacteria 2700
225 Ga0206350_10527618 3300020080 Bacteria 1179
226 Ga0206350_10839841 3300020080 Bacteria 1028
227 Ga0206350_11230203 3300020080 Bacteria 1066
228 Ga0206350_11479828 3300020080 Bacteria 892
229 Ga0206354_11250478 3300020081 Bacteria 3059
230 Ga0206353_11877654 3300020082 Bacteria 1891
231 Ga0154015_1321855 3300020610 Bacteria 1402
232 Ga0213876_10024800 3300021384 Bacteria 3166
233 Ga0213875_10000836 3300021388 Bacteria 22855
234 Ga0224712_10022618 3300022467 Bacteria 2170
235 Ga0224712_10029350 3300022467 Bacteria 1974
236 Ga0224712_10063235 3300022467 Bacteria 1481
237 Ga0224712_10064384 3300022467 Bacteria 1470
238 Ga0224712_10064902 3300022467 Bacteria 1466
239 Ga0224712_10072613 3300022467 Bacteria 1401
240 Ga0207656_10044505 3300025321 Bacteria 1896
241 Ga0207653_10003819 3300025885 Bacteria 4743
242 Ga0207692_10000601 3300025898 Bacteria 12754
243 Ga0207692_10001817 3300025898 Bacteria 8100
244 Ga0207642_10054599 3300025899 Bacteria 1823
245 Ga0207710_10029447 3300025900 Bacteria 2390
246 Ga0207688_10000775 3300025901 Bacteria 15896
247 Ga0207688_10014277 3300025901 Bacteria 4321
248 Ga0207647_10081903 3300025904 Bacteria 1933
249 Ga0207647_10122670 3300025904 Bacteria 1531
250 Ga0207647_10158735 3300025904 Bacteria 1320
251 Ga0207685_10032204 3300025905 Bacteria 1885
252 Ga0207699_10000254 3300025906 Bacteria 29530
253 Ga0207699_10002720 3300025906 Bacteria 8360
254 Ga0207699_10030970 3300025906 Bacteria 2999
255 Ga0207645_10028524 3300025907 Bacteria 3603
256 Ga0207643_10000047 3300025908 Bacteria 79590
257 Ga0207705_10007667 3300025909 Bacteria 7933
258 Ga0207705_10010304 3300025909 Bacteria 6798
259 Ga0207684_10054538 3300025910 Bacteria 3391
260 Ga0207654_10021039 3300025911 Bacteria 3465
261 Ga0207654_10049875 3300025911 Bacteria 2403
262 Ga0207707_10018049 3300025912 Bacteria 6147
263 Ga0207707_10260801 3300025912 Bacteria 1504
264 Ga0207695_10100674 3300025913 Bacteria 2885
265 Ga0207695_10225547 3300025913 Bacteria 1780
266 Ga0207695_10282930 3300025913 Bacteria 1552
267 Ga0207695_10437538 3300025913 Bacteria 1191
268 Ga0207671_10026616 3300025914 Bacteria 4331
269 Ga0207671_10074510 3300025914 Bacteria 2537
270 Ga0207671_10125753 3300025914 Bacteria 1964
271 Ga0207671_10240571 3300025914 Unclassified 1422
272 Ga0207693_10000510 3300025915 Bacteria 35052
273 Ga0207693_10066087 3300025915 Bacteria 2832
274 Ga0207693_10192095 3300025915 Bacteria 1606
275 Ga0207693_10283725 3300025915 Bacteria 1297
276 Ga0207663_10001678 3300025916 Bacteria 10408
277 Ga0207663_10120222 3300025916 Bacteria 1798
278 Ga0207660_10025497 3300025917 Bacteria 4013
279 Ga0207662_10054400 3300025918 Bacteria 2386
280 Ga0207657_10009591 3300025919 Bacteria 9716
281 Ga0207649_10018655 3300025920 Bacteria 3950
282 Ga0207646_10043665 3300025922 Bacteria 4025
283 Ga0207694_10255182 3300025924 Bacteria 1436
284 Ga0207650_10024821 3300025925 Bacteria 4266
285 Ga0207659_10045328 3300025926 Bacteria 3100
286 Ga0207687_10011367 3300025927 Bacteria 5819
287 Ga0207687_10019228 3300025927 Bacteria 4524
288 Ga0207687_10064177 3300025927 Bacteria 2603
289 Ga0207700_10000043 3300025928 Bacteria 92646
290 Ga0207700_10008114 3300025928 Bacteria 6482
291 Ga0207700_10036195 3300025928 Bacteria 3562
292 Ga0207700_10395427 3300025928 Bacteria 1210
293 Ga0207664_10000876 3300025929 Bacteria 20357
294 Ga0207664_10002988 3300025929 Bacteria 11234
295 Ga0207664_10153776 3300025929 Bacteria 1956
296 Ga0207644_10027701 3300025931 Bacteria 3916
297 Ga0207644_10211993 3300025931 Bacteria 1532
298 Ga0207690_10036211 3300025932 Bacteria 3194
299 Ga0207690_10110720 3300025932 Bacteria 1977
300 Ga0207706_10082283 3300025933 Bacteria 2830
301 Ga0207686_10096710 3300025934 Bacteria 1963
302 Ga0207709_10045466 3300025935 Bacteria 2659
303 Ga0207670_10225342 3300025936 Unclassified 1437
304 Ga0207665_10001036 3300025939 Bacteria 18727
305 Ga0207665_10001555 3300025939 Bacteria 15458
306 Ga0207665_10004769 3300025939 Bacteria 9020
307 Ga0207691_10365284 3300025940 Bacteria 1233
308 Ga0207711_10055466 3300025941 Bacteria 3402
309 Ga0207689_10001102 3300025942 Bacteria 26053
310 Ga0207689_10078282 3300025942 Bacteria 2717
311 Ga0207661_10005820 3300025944 Bacteria 8694
312 Ga0207667_10026130 3300025949 Bacteria 6383
313 Ga0207667_10029535 3300025949 Bacteria 5945
314 Ga0207667_10201138 3300025949 Bacteria 2044
315 Ga0207667_10334925 3300025949 Bacteria 1545
316 Ga0207651_10031731 3300025960 Bacteria 3382
317 Ga0207651_10168191 3300025960 Bacteria 1726
318 Ga0207712_10031694 3300025961 Bacteria 3563
319 Ga0207668_10054843 3300025972 Bacteria 2768
320 Ga0207640_10027702 3300025981 Bacteria 3456
321 Ga0207640_10176474 3300025981 Bacteria 1597
322 Ga0207658_10013374 3300025986 Bacteria 5605
323 Ga0207677_10031040 3300026023 Bacteria 3419
324 Ga0207677_10421291 3300026023 Bacteria 1137
325 Ga0207703_10045672 3300026035 Bacteria 3524
326 Ga0207639_10063003 3300026041 Bacteria 2869
327 Ga0207639_10274341 3300026041 Bacteria 1480
328 Ga0207678_10001981 3300026067 Bacteria 18662
329 Ga0207678_10006036 3300026067 Bacteria 10775
330 Ga0207702_10004519 3300026078 Bacteria 12336
331 Ga0207702_10010704 3300026078 Bacteria 7664
332 Ga0207702_10113501 3300026078 Bacteria 2413
333 Ga0207702_10136225 3300026078 Bacteria 2216
334 Ga0207641_10448478 3300026088 Unclassified 1246
335 Ga0207676_10001351 3300026095 Bacteria 18242
336 Ga0207674_10098023 3300026116 Bacteria 2915
337 Ga0207674_10149200 3300026116 Bacteria 2295
338 Ga0207675_100003148 3300026118 Bacteria 16183
339 Ga0207683_10001887 3300026121 Bacteria 18547
340 Ga0207683_10016426 3300026121 Bacteria 6301
341 Ga0207698_10033263 3300026142 Bacteria 3745
342 Ga0207698_10162698 3300026142 Bacteria 1954
343 Ga0207698_10225906 3300026142 Bacteria 1696
344 Ga0207428_10260496 3300027907 Unclassified 1292
345 Ga0307413_10041137 3300031824 Bacteria 2704
346 Ga0373948_0013080 3300034817 Bacteria 1493
347 Ga0373928_0062650 3300035084 Bacteria 903
348 Ga0373929_0045053 3300035085 Bacteria 992
349 Ga0373949_0013576 3300035090 Unclassified 1808
350 Ga0373951_0038391 3300035091 Bacteria 1148
351 Ga0373952_0005177 3300035092 Bacteria 2379
352 Ga0373923_0029930 3300035111 Bacteria 2187
353 Ga0373932_0004011 3300035112 Bacteria 3506
354 Ga0373957_0007911 3300035120 Bacteria 3421
355 Ga0373960_0066766 3300035121 Bacteria 1103
356 Ga0373943_0114090 3300035170 Bacteria 1429
357 Ga0373955_0011243 3300035172 Bacteria 4257
358 Ga0373962_0029967 3300035242 Unclassified 1486
359 Ga0316574_0467447 3300035398 Bacteria 789
360 Ga0373931_0005099 3300035691 Bacteria 6047
361 Ga0373935_0151081 3300035692 Bacteria 1576
362 Ga0373935_0172740 3300035692 Bacteria 1479
363 Ga0373927_0299796 3300035695 Bacteria 1058
364 Ga0373937_0177863 3300036401 Bacteria 1997
365 Ga0373925_0097983 3300037068 Bacteria 2249
366 Ga0436364_0189792 3300037853 Bacteria 1750
367 Ga0436364_0950845 3300037853 Bacteria 8040
368 Ga0436365_0007785 3300039437 Bacteria 3276
369 Ga0436363_0438840 3300039450 Bacteria 943
370 Ga0436362_0922272 3300039453 Bacteria 868
371 Ga0439448_0021736 3300042005 Bacteria 1990
372 Ga0439455_0022713 3300042012 Bacteria 1506
373 Ga0439458_0022631 3300042157 Bacteria 1461
374 Ga0439459_0005345 3300042438 Bacteria 2107
375 Ga0466972_0009173 3300044658 Bacteria 4969
376 Ga0466972_0022081 3300044658 Bacteria 3169
377 Ga0466965_0232651 3300044683 Bacteria 985
378 Ga0466966_0017074 3300044684 Bacteria 4800
379 Ga0466966_0035670 3300044684 Bacteria 3212
380 Ga0466966_0073131 3300044684 Bacteria 2145
381 Ga0466961_0008948 3300044693 Bacteria 6387
382 Ga0466961_0024673 3300044693 Bacteria 3868
383 Ga0466961_0216811 3300044693 Bacteria 1180
384 Ga0466961_0305562 3300044693 Bacteria 971
385 Ga0466963_0006723 3300044694 Bacteria 6831
386 Ga0466963_0073684 3300044694 Bacteria 2302
387 Ga0466963_0078979 3300044694 Bacteria 2226
388 Ga0466968_0039983 3300044735 Bacteria 1976
389 Ga0466970_0053781 3300044765 Bacteria 2150
390 Ga0466970_0053944 3300044765 Bacteria 2147
391 Ga0466957_0064202 3300044842 Bacteria 2259
392 Ga0466957_0069853 3300044842 Bacteria 2170
393 Ga0466957_0101210 3300044842 Bacteria 1817
394 Ga0466960_0023276 3300044901 Bacteria 2780
395 Ga0466960_0325979 3300044901 Bacteria 871
396 Ga0466959_0009181 3300045049 Bacteria 7022
397 Ga0466959_0012178 3300045049 Bacteria 6207
398 Ga0466959_0038337 3300045049 Bacteria 3541
399 Ga0466959_0069703 3300045049 Bacteria 2547
400 Ga0466959_0116265 3300045049 Bacteria 1905
401 Ga0466958_0009403 3300045836 Bacteria 5447
402 Ga0466958_0034505 3300045836 Bacteria 3018
403 Ga0466958_0056882 3300045836 Bacteria 2377
404 Ga0466967_0001195 3300045976 Bacteria 14600
405 Ga0466967_0005436 3300045976 Bacteria 8833
406 Ga0466967_0021292 3300045976 Bacteria 5262
407 Ga0466967_0024133 3300045976 Bacteria 4995
408 Ga0466967_0259390 3300045976 Bacteria 1663
409 Ga0466967_0295440 3300045976 Bacteria 1557
410 Ga0495592_0094270 3300046454 Bacteria 2143
411 Ga0495629_0022669 3300046459 Bacteria 4475
412 Ga0495641_0020596 3300046461 Bacteria 3338
413 Ga0495651_0006017 3300046462 Bacteria 9263
414 Ga0495653_0036638 3300046463 Bacteria 3862
415 Ga0495653_0062933 3300046463 Bacteria 2802
416 Ga0495582_0051844 3300046473 Bacteria 2262
417 Ga0495664_0062500 3300046477 Bacteria 2218
418 Ga0495628_0086389 3300046516 Bacteria 2432
419 Ga0495630_0057090 3300046517 Bacteria 2926
420 Ga0495666_0041456 3300046526 Bacteria 2229
421 Ga0495652_0015718 3300046529 Bacteria 6774
422 Ga0495652_0370643 3300046529 Bacteria 1021
423 Ga0495665_0036815 3300046531 Bacteria 2611
424 Ga0495640_0124522 3300046533 Bacteria 1672
425 Ga0495587_0236083 3300046536 Bacteria 1029
426 Ga0495645_0051065 3300046543 Bacteria 3009
427 Ga0495667_0011356 3300046559 Bacteria 6029
428 Ga0495635_0310658 3300046663 Bacteria 1056
429 Ga0495657_0008971 3300046675 Bacteria 7609
430 Ga0495623_0032642 3300046679 Bacteria 3345
431 Ga0495600_0053987 3300046809 Bacteria 2625
432 Ga0495674_0014210 3300047319 Bacteria 7457
433 Ga0495676_0221273 3300047321 Bacteria 1304
434 Ga0495680_0020107 3300047322 Bacteria 5625
435 Ga0495680_0088889 3300047322 Bacteria 2320
436 Ga0495684_0025162 3300047471 Bacteria 4577
437 Ga0495684_0084809 3300047471 Bacteria 2402
438 Ga0495593_0054064 3300047673 Bacteria 2118
439 Ga0495602_0029597 3300048088 Bacteria 5211
440 Ga0495614_0138007 3300048089 Bacteria 1082
441 Ga0496100_0051093 3300048903 Bacteria 2682
442 Ga0496101_0144312 3300048904 Bacteria 1817
443 Ga0496101_0426751 3300048904 Bacteria 1045
444 Ga0496101_0492310 3300048904 Bacteria 968
445 Ga0496102_0000207 3300048905 Bacteria 79241
446 Ga0496102_0001304 3300048905 Bacteria 22424
447 Ga0496102_0031179 3300048905 Bacteria 4780
448 Ga0496102_0376832 3300048905 Bacteria 1335
449 Ga0496103_0003281 3300048906 Bacteria 9913
450 Ga0496104_0058688 3300048907 Bacteria 3642
451 Ga0496104_0303084 3300048907 Bacteria 1510
452 Ga0496105_0047188 3300048908 Bacteria 3554
453 Ga0496105_0058621 3300048908 Bacteria 3178
454 Ga0496105_0059213 3300048908 Bacteria 3161
455 Ga0496107_0040322 3300048910 Bacteria 3352
456 Ga0496107_0407215 3300048910 Bacteria 1011
457 Ga0496108_0600496 3300048911 Bacteria 959
458 Ga0496109_0008326 3300048912 Bacteria 8804
459 Ga0496110_0047412 3300048913 Bacteria 3762
460 Ga0496110_0049270 3300048913 Bacteria 3694
461 Ga0496111_0026131 3300048914 Bacteria 4121
462 Ga0496112_0016220 3300048915 Bacteria 6970
463 Ga0496113_0018999 3300048916 Bacteria 4799
464 Ga0496113_0026397 3300048916 Bacteria 4152
465 Ga0496114_0028644 3300048917 Bacteria 4571
466 Ga0496115_0038586 3300048918 Bacteria 3790
467 Ga0496115_0148137 3300048918 Bacteria 1937
468 Ga0496115_0232346 3300048918 Bacteria 1520
469 Ga0496118_0043376 3300048921 Bacteria 3537
470 Ga0496119_0002966 3300048922 Bacteria 18024
471 Ga0496119_0085016 3300048922 Bacteria 1812
472 Ga0496120_0007894 3300048923 Bacteria 7841
473 Ga0496121_0158591 3300048924 Bacteria 1657
474 Ga0496126_0297299 3300048929 Bacteria 1333
475 Ga0496126_0401337 3300048929 Bacteria 1112
476 Ga0501031_0027304 3300049568 Bacteria 3722
477 Ga0501032_0010484 3300049569 Bacteria 6684
478 Ga0501033_0062177 3300049570 Bacteria 2750
479 Ga0501034_0070896 3300049571 Bacteria 3495
480 Ga0501036_0001448 3300049572 Bacteria 18233
481 Ga0501036_0066237 3300049572 Bacteria 3056
482 Ga0501037_0071898 3300049573 Bacteria 2516
483 Ga0501038_0001446 3300049574 Bacteria 21798
484 Ga0501038_0023470 3300049574 Bacteria 5514
485 Ga0501042_0067724 3300049578 Bacteria 2552
486 Ga0501043_0002512 3300049579 Bacteria 15506
487 Ga0501043_0008070 3300049579 Bacteria 8309
488 Ga0501047_0011857 3300049581 Bacteria 8244
489 Ga0501047_0028327 3300049581 Bacteria 5400
490 Ga0501047_0039051 3300049581 Bacteria 4592
491 Ga0501048_0000279 3300049582 Bacteria 34489
492 Ga0501048_0026113 3300049582 Bacteria 4253
493 Ga0501069_0113785 3300049585 Bacteria 1543
494 Ga0501070_0033318 3300049586 Bacteria 4311
495 Ga0501073_0054265 3300049589 Bacteria 2806
496 Ga0501074_0002498 3300049590 Bacteria 12817
497 Ga0501074_0543495 3300049590 Bacteria 823
498 Ga0501081_0193789 3300049743 Bacteria 1472
499 Ga0501081_0243886 3300049743 Bacteria 1310
500 Ga0501044_0047794 3300049823 Bacteria 4425
501 nmdc:mga06r32_164804_c1 3300050510 Bacteria 2199
502 nmdc:mga08y16_100484_c1 3300050511 Bacteria 3012
503 nmdc:mga08y16_141561_c1 3300050511 Bacteria 2500
504 nmdc:mga0n895_10462_c1 3300050512 Bacteria 8199
505 nmdc:mga0n895_163328_c1 3300050512 Bacteria 2259
506 nmdc:mga0rr50_28395_c1 3300050513 Bacteria 3933
507 nmdc:mga0rr50_53638_c1 3300050513 Bacteria 3000
508 nmdc:mga0rr50_78352_c1 3300050513 Bacteria 2543
509 nmdc:mga0rr50_87338_c1 3300050513 Bacteria 2421
510 nmdc:mga08x19_220275_c1 3300050514 Bacteria 1304
511 nmdc:mga0a205_25541_c1 3300050515 Bacteria 5628
512 nmdc:mga0a205_39032_c1 3300050515 Bacteria 4570
513 nmdc:mga0a205_63776_c1 3300050515 Bacteria 3559
514 Ga0466962_0073321 3300061719 Bacteria 1636
515 2676489006 2675903060 Bacteria 10051191
516 Ga0081455_10000214
517 JGI24751J29686_10002605
518 JGI25406J46586_10002736
519 JGI25404J52841_10038797
520 JGI25405J52794_10013256
521 Ga0070658_10005699
522 Ga0070658_10021768
523 Ga0070670_100061974
524 Ga0068869_100019207
525 Ga0070680_100083964
526 Ga0070682_100043398
527 Ga0070660_100032125
528 Ga0070660_100048820
529 Ga0070689_100039059
530 Ga0070689_100233190
531 Ga0070691_10002226
532 Ga0070691_10039019
533 Ga0070687_100148172
534 Ga0070692_10006956
535 Ga0070668_100046254
536 Ga0070669_100212225
537 Ga0070671_100032883
538 Ga0070671_100046051
539 Ga0070674_100254458
540 Ga0070673_100129874
541 Ga0070673_100176284
542 Ga0070659_100012599
543 Ga0070659_100148132
544 Ga0070667_100004498
545 Ga0070667_100044211
546 Ga0070703_10023241
547 Ga0070709_10000453
548 Ga0070709_10002025
549 Ga0070709_10062545
550 Ga0070714_100003378
551 Ga0070714_100177289
552 Ga0070714_100267565
553 Ga0070714_100993709
554 Ga0070713_100000581
555 Ga0070713_100005556
556 Ga0070713_100007695
557 Ga0070713_100054771
558 Ga0070713_100090892
559 Ga0070713_100830845
560 Ga0070710_10000020
561 Ga0070710_10004829
562 Ga0070701_10035255
563 Ga0070701_10047840
564 Ga0070711_100002515
565 Ga0070705_100050384
566 Ga0070700_100014259
567 Ga0070694_100026952
568 Ga0070708_100131496
569 Ga0070708_100383015
570 Ga0070663_100012310
571 Ga0070678_100022416
572 Ga0070662_100127088
573 Ga0070681_10331293
574 Ga0070685_10128797
575 Ga0070685_10142634
576 Ga0070706_100011889
577 Ga0070707_100029677
578 Ga0070707_100102862
579 Ga0070698_100073531
580 Ga0070698_100131302
581 Ga0070684_100279218
582 Ga0070684_100305698
583 Ga0070684_100465703
584 Ga0070697_100030995
585 Ga0070697_100075506
586 Ga0068853_100017823
587 Ga0068853_100080458
588 Ga0070672_100108141
589 Ga0070686_100008970
590 Ga0070695_100028939
591 Ga0070695_100218104
592 Ga0070696_100033505
593 Ga0070693_100000566
594 Ga0070693_100010945
595 Ga0070665_100076264
596 Ga0070704_100031066
597 Ga0070704_100066523
598 Ga0068855_100016715
599 Ga0068855_100090700
600 Ga0070664_100117324
601 Ga0068857_100353112
602 Ga0068857_100586402
603 Ga0068854_100005717
604 Ga0068854_100048104
605 Ga0068856_100004890
606 Ga0068856_100036068
607 Ga0068856_100437343
608 Ga0070702_100002437
609 Ga0070702_100007642
610 Ga0068852_100046636
611 Ga0068852_100127869
612 Ga0068852_100216488
613 Ga0068852_100281310
614 Ga0068859_100002953
615 Ga0068859_100089417
616 Ga0068859_100100329
617 Ga0068864_100017166
618 Ga0068864_100202644
619 Ga0068866_10203257
620 Ga0068861_100136192
621 Ga0068851_10044689
622 Ga0068851_10058391
623 Ga0068870_10001480
624 Ga0068863_100010860
625 Ga0068863_100241666
626 Ga0068858_100014429
627 Ga0068858_100016152
628 Ga0068860_100082613
629 Ga0068862_100231706
630 Ga0081455_10003333
631 Ga0081540_1001246
632 Ga0081540_1002638
633 Ga0081540_1038206
634 Ga0070717_10002013
635 Ga0070717_10013575
636 Ga0070717_10661497
637 Ga0070715_10032306
638 Ga0070715_10068781
639 Ga0070716_100000057
640 Ga0070716_100003310
641 Ga0070716_100051412
642 Ga0070712_100003864
643 Ga0070712_100041649
644 Ga0070712_100188668
645 Ga0097621_100022239
646 Ga0097621_100426839
647 Ga0068871_100016162
648 Ga0068871_100018826
649 Ga0075428_100123202
650 Ga0075433_10010456
651 Ga0075433_10026570
652 Ga0075433_10152797
653 Ga0075434_100013134
654 Ga0075434_100068993
655 Ga0075429_100062718
656 Ga0068865_100136525
657 Ga0075436_100014935
658 Ga0075436_100025774
659 Ga0097620_100002953
660 Ga0097620_100089413
661 Ga0097620_100100328
662 Ga0075435_100005151
663 Ga0075435_100038041
664 Ga0075435_100049921
665 Ga0075435_100247969
666 Ga0105251_10026665
667 Ga0105250_10143327
668 Ga0105240_10084166
669 Ga0105240_10136472
670 Ga0105240_10171554
671 Ga0105240_10781778
672 Ga0111539_10043585
673 Ga0111539_10094396
674 Ga0111539_10679784
675 Ga0105245_10020230
676 Ga0105245_10054380
677 Ga0105245_10084355
678 Ga0105245_10597049
679 Ga0105247_10034325
680 Ga0105247_10170817
681 Ga0105243_10123774
682 Ga0105241_10028316
683 Ga0105241_10037898
684 Ga0105242_10113449
685 Ga0105248_10065363
686 Ga0105248_10106152
687 Ga0105237_10013597
688 Ga0105237_10032117
689 Ga0105237_10051039
690 Ga0105238_10056934
691 Ga0105238_10134137
692 Ga0105249_10010704
693 Ga0105239_10089861
694 Ga0105239_10096213
695 Ga0105239_10138828
696 Ga0105239_10437810
697 Ga0105246_10007484
698 Ga0157373_10133236
699 Ga0157373_10185919
700 Ga0157371_10037837
701 Ga0157370_10049713
702 Ga0157369_10012349
703 Ga0157369_10074443
704 Ga0157369_10310432
705 Ga0157369_10405444
706 Ga0157374_10031359
707 Ga0157374_10105294
708 Ga0157374_10163304
709 Ga0157378_10193426
710 Ga0163162_10052254
711 Ga0157372_10500116
712 Ga0157375_10055811
713 Ga0157375_10096113
714 Ga0157380_10039834
715 Ga0157377_10022811
716 Ga0157379_10048338
717 Ga0157379_10075915
718 Ga0157376_10144825
719 Ga0163161_10003689
720 Ga0197907_10036107
721 Ga0197907_10201625
722 Ga0197907_10498597
723 Ga0197907_10543746
724 Ga0197907_11384885
725 Ga0206356_10585625
726 Ga0206356_11663142
727 Ga0206356_11751250
728 Ga0206349_1180060
729 Ga0206349_1717423
730 Ga0206349_1800766
731 Ga0206349_1803370
732 Ga0206349_1868316
733 Ga0206355_1001705
734 Ga0206355_1200182
735 Ga0206351_10977008
736 Ga0206352_10943704
737 Ga0206352_11223561
738 Ga0206352_11338050
739 Ga0206350_10271617
740 Ga0206350_10527618
741 Ga0206350_10839841
742 Ga0206350_11230203
743 Ga0206350_11479828
744 Ga0206354_11250478
745 Ga0206353_11877654
746 Ga0154015_1321855
747 Ga0213876_10024800
748 Ga0213875_10000836
749 Ga0224712_10022618
750 Ga0224712_10029350
751 Ga0224712_10063235
752 Ga0224712_10064384
753 Ga0224712_10064902
754 Ga0224712_10072613
755 Ga0207656_10044505
756 Ga0207653_10003819
757 Ga0207692_10000601
758 Ga0207692_10001817
759 Ga0207642_10054599
760 Ga0207710_10029447
761 Ga0207688_10000775
762 Ga0207688_10014277
763 Ga0207647_10081903
764 Ga0207647_10122670
765 Ga0207647_10158735
766 Ga0207685_10032204
767 Ga0207699_10000254
768 Ga0207699_10002720
769 Ga0207699_10030970
770 Ga0207645_10028524
771 Ga0207643_10000047
772 Ga0207705_10007667
773 Ga0207705_10010304
774 Ga0207684_10054538
775 Ga0207654_10021039
776 Ga0207654_10049875
777 Ga0207707_10018049
778 Ga0207707_10260801
779 Ga0207695_10100674
780 Ga0207695_10225547
781 Ga0207695_10282930
782 Ga0207695_10437538
783 Ga0207671_10026616
784 Ga0207671_10074510
785 Ga0207671_10125753
786 Ga0207671_10240571
787 Ga0207693_10000510
788 Ga0207693_10066087
789 Ga0207693_10192095
790 Ga0207693_10283725
791 Ga0207663_10001678
792 Ga0207663_10120222
793 Ga0207660_10025497
794 Ga0207662_10054400
795 Ga0207657_10009591
796 Ga0207649_10018655
797 Ga0207646_10043665
798 Ga0207694_10255182
799 Ga0207650_10024821
800 Ga0207659_10045328
801 Ga0207687_10011367
802 Ga0207687_10019228
803 Ga0207687_10064177
804 Ga0207700_10000043
805 Ga0207700_10008114
806 Ga0207700_10036195
807 Ga0207700_10395427
808 Ga0207664_10000876
809 Ga0207664_10002988
810 Ga0207664_10153776
811 Ga0207644_10027701
812 Ga0207644_10211993
813 Ga0207690_10036211
814 Ga0207690_10110720
815 Ga0207706_10082283
816 Ga0207686_10096710
817 Ga0207709_10045466
818 Ga0207670_10225342
819 Ga0207665_10001036
820 Ga0207665_10001555
821 Ga0207665_10004769
822 Ga0207691_10365284
823 Ga0207711_10055466
824 Ga0207689_10001102
825 Ga0207689_10078282
826 Ga0207661_10005820
827 Ga0207667_10026130
828 Ga0207667_10029535
829 Ga0207667_10201138
830 Ga0207667_10334925
831 Ga0207651_10031731
832 Ga0207651_10168191
833 Ga0207712_10031694
834 Ga0207668_10054843
835 Ga0207640_10027702
836 Ga0207640_10176474
837 Ga0207658_10013374
838 Ga0207677_10031040
839 Ga0207677_10421291
840 Ga0207703_10045672
841 Ga0207639_10063003
842 Ga0207639_10274341
843 Ga0207678_10001981
844 Ga0207678_10006036
845 Ga0207702_10004519
846 Ga0207702_10010704
847 Ga0207702_10113501
848 Ga0207702_10136225
849 Ga0207641_10448478
850 Ga0207676_10001351
851 Ga0207674_10098023
852 Ga0207674_10149200
853 Ga0207675_100003148
854 Ga0207683_10001887
855 Ga0207683_10016426
856 Ga0207698_10033263
857 Ga0207698_10162698
858 Ga0207698_10225906
859 Ga0207428_10260496
860 Ga0307413_10041137
861 Ga0373948_0013080
862 Ga0373928_0062650
863 Ga0373929_0045053
864 Ga0373949_0013576
865 Ga0373951_0038391
866 Ga0373952_0005177
867 Ga0373923_0029930
868 Ga0373932_0004011
869 Ga0373957_0007911
870 Ga0373960_0066766
871 Ga0373943_0114090
872 Ga0373955_0011243
873 Ga0373962_0029967
874 Ga0316574_0467447
875 Ga0373931_0005099
876 Ga0373935_0151081
877 Ga0373935_0172740
878 Ga0373927_0299796
879 Ga0373937_0177863
880 Ga0373925_0097983
881 Ga0436364_0189792
882 Ga0436364_0950845
883 Ga0436365_0007785
884 Ga0436363_0438840
885 Ga0436362_0922272
886 Ga0439448_0021736
887 Ga0439455_0022713
888 Ga0439458_0022631
889 Ga0439459_0005345
890 Ga0466972_0009173
891 Ga0466972_0022081
892 Ga0466965_0232651
893 Ga0466966_0017074
894 Ga0466966_0035670
895 Ga0466966_0073131
896 Ga0466961_0008948
897 Ga0466961_0024673
898 Ga0466961_0216811
899 Ga0466961_0305562
900 Ga0466963_0006723
901 Ga0466963_0073684
902 Ga0466963_0078979
903 Ga0466968_0039983
904 Ga0466970_0053781
905 Ga0466970_0053944
906 Ga0466957_0064202
907 Ga0466957_0069853
908 Ga0466957_0101210
909 Ga0466960_0023276
910 Ga0466960_0325979
911 Ga0466959_0009181
912 Ga0466959_0012178
913 Ga0466959_0038337
914 Ga0466959_0069703
915 Ga0466959_0116265
916 Ga0466958_0009403
917 Ga0466958_0034505
918 Ga0466958_0056882
919 Ga0466967_0001195
920 Ga0466967_0005436
921 Ga0466967_0021292
922 Ga0466967_0024133
923 Ga0466967_0259390
924 Ga0466967_0295440
925 Ga0495592_0094270
926 Ga0495629_0022669
927 Ga0495641_0020596
928 Ga0495651_0006017
929 Ga0495653_0036638
930 Ga0495653_0062933
931 Ga0495582_0051844
932 Ga0495664_0062500
933 Ga0495628_0086389
934 Ga0495630_0057090
935 Ga0495666_0041456
936 Ga0495652_0015718
937 Ga0495652_0370643
938 Ga0495665_0036815
939 Ga0495640_0124522
940 Ga0495587_0236083
941 Ga0495645_0051065
942 Ga0495667_0011356
943 Ga0495635_0310658
944 Ga0495657_0008971
945 Ga0495623_0032642
946 Ga0495600_0053987
947 Ga0495674_0014210
948 Ga0495676_0221273
949 Ga0495680_0020107
950 Ga0495680_0088889
951 Ga0495684_0025162
952 Ga0495684_0084809
953 Ga0495593_0054064
954 Ga0495602_0029597
955 Ga0495614_0138007
956 Ga0496100_0051093
957 Ga0496101_0144312
958 Ga0496101_0426751
959 Ga0496101_0492310
960 Ga0496102_0000207
961 Ga0496102_0001304
962 Ga0496102_0031179
963 Ga0496102_0376832
964 Ga0496103_0003281
965 Ga0496104_0058688
966 Ga0496104_0303084
967 Ga0496105_0047188
968 Ga0496105_0058621
969 Ga0496105_0059213
970 Ga0496107_0040322
971 Ga0496107_0407215
972 Ga0496108_0600496
973 Ga0496109_0008326
974 Ga0496110_0047412
975 Ga0496110_0049270
976 Ga0496111_0026131
977 Ga0496112_0016220
978 Ga0496113_0018999
979 Ga0496113_0026397
980 Ga0496114_0028644
981 Ga0496115_0038586
982 Ga0496115_0148137
983 Ga0496115_0232346
984 Ga0496118_0043376
985 Ga0496119_0002966
986 Ga0496119_0085016
987 Ga0496120_0007894
988 Ga0496121_0158591
989 Ga0496126_0297299
990 Ga0496126_0401337
991 Ga0501031_0027304
992 Ga0501032_0010484
993 Ga0501033_0062177
994 Ga0501034_0070896
995 Ga0501036_0001448
996 Ga0501036_0066237
997 Ga0501037_0071898
998 Ga0501038_0001446
999 Ga0501038_0023470
1000 Ga0501042_0067724
1001 Ga0501043_0002512
1002 Ga0501043_0008070
1003 Ga0501047_0011857
1004 Ga0501047_0028327
1005 Ga0501047_0039051
1006 Ga0501048_0000279
1007 Ga0501048_0026113
1008 Ga0501069_0113785
1009 Ga0501070_0033318
1010 Ga0501073_0054265
1011 Ga0501074_0002498
1012 Ga0501074_0543495
1013 Ga0501081_0193789
1014 Ga0501081_0243886
1015 Ga0501044_0047794
1016 nmdc:mga06r32_164804_c1
1017 nmdc:mga08y16_100484_c1
1018 nmdc:mga08y16_141561_c1
1019 nmdc:mga0n895_10462_c1
1020 nmdc:mga0n895_163328_c1
1021 nmdc:mga0rr50_28395_c1
1022 nmdc:mga0rr50_53638_c1
1023 nmdc:mga0rr50_78352_c1
1024 nmdc:mga0rr50_87338_c1
1025 nmdc:mga08x19_220275_c1
1026 nmdc:mga0a205_25541_c1
1027 nmdc:mga0a205_39032_c1
1028 nmdc:mga0a205_63776_c1
1029 Ga0466962_0073321
1030 2676489006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

32

217

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cj2-assembly2.cif.gz_D crystal structure of hewl in complex with affitin h4 0.8819 143 170
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8802 1 231
1wtx-assembly1.cif.gz_A hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gtaattac 0.8759 143 170
2xiw-assembly1.cif.gz_B-2 crystal structure of the sac7d-derived igg1-binder c3-c24s 0.8723 143 170
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.8688 1 231
ID Description Score Start End Superfamily
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8782 1 230 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8688 1 231 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8652 1 231 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8642 1 230 3.40.50.620
af_P0DOV2_527_619_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8581 144 170 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A372J095-F1-model_v4 Electron transfer flavoprotein beta subunit/FixA family protein 0.9527 1 207 GO:0005829
GO:0009055
AF-A0A372J095-F1-model_v4 Electron transfer flavoprotein beta subunit/FixA family protein 0.9438 1 207 GO:0005829
GO:0009055
AF-X1LKP6-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.942 40 211 GO:0003824
GO:0009055
AF-A0A0F5VJB4-F1-model_v4 Electron transfer flavoprotein subunit beta 0.942 85 199 GO:0005829
GO:0009055
AF-A0A6G3BPL7-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9385 1 188 GO:0005829
GO:0009055

Map