F457817

General Info

Members Datasets Scaffolds Average Seq Length
515 183 1030 171

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100007989|Ga0070680_1000079896
Length 182
Sequence MAGTGGVRMNAVYRSANLDDAEALRALFAESFVETFGHIYRPADLQEFLDGNSKAKWEANLSDPEVSIRVAETGGELAGFVELAPKKLPYVTEAPAIELRRLYLKSSAHGRGISDELMKWALQEAARRGAQELVLSVYVDNHRARRFYERYGFETVGKYDFMVGSHADEDLILRHIIMQAHA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
66 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
176 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
177 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
180 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
183 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.39
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 4.08
Rhizosphere 92.62
Stem 0
Stem Tuber 0.19
Unclassified 7.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100007989 3300005336 Bacteria 8079
2 LJQas_1003125 3300000549 Bacteria 2237
3 JGI24741J21665_1000617 3300001915 Bacteria 10730
4 JGI24741J21665_1002803 3300001915 Bacteria 4394
5 JGI25152J39213_1024415 3300002773 Bacteria 1015
6 rootH1_10103381 3300003316 Bacteria 1409
7 rootH2_10005468 3300003320 Bacteria 1433
8 Ga0055526_1007617 3300003771 Bacteria 5587
9 Ga0055526_1039584 3300003771 Bacteria 1199
10 Ga0055537_1003499 3300003773 Bacteria 4811
11 Ga0070658_10000264 3300005327 Bacteria 46199
12 Ga0070658_10009024 3300005327 Bacteria 8020
13 Ga0070658_10009851 3300005327 Bacteria 7677
14 Ga0070658_10030042 3300005327 Bacteria 4367
15 Ga0070658_10038444 3300005327 Bacteria 3859
16 Ga0070658_10048975 3300005327 Bacteria 3422
17 Ga0070658_10073624 3300005327 Bacteria 2801
18 Ga0070658_10202055 3300005327 Bacteria 1677
19 Ga0070658_10204473 3300005327 Bacteria 1667
20 Ga0070658_10333581 3300005327 Bacteria 1296
21 Ga0070658_10532021 3300005327 Bacteria 1016
22 Ga0070658_10992056 3300005327 Bacteria 730
23 Ga0070683_100856697 3300005329 Bacteria 871
24 Ga0070690_100040957 3300005330 Bacteria 2931
25 Ga0070677_10000111 3300005333 Bacteria 26731
26 Ga0068869_101348043 3300005334 Bacteria 630
27 Ga0070666_10010275 3300005335 Bacteria 5850
28 Ga0070666_10282156 3300005335 Unclassified 1181
29 Ga0070666_10382199 3300005335 Bacteria 1011
30 Ga0070680_100018024 3300005336 Bacteria 5576
31 Ga0070680_100020986 3300005336 Bacteria 5187
32 Ga0070680_100114062 3300005336 Bacteria 2251
33 Ga0070680_100123160 3300005336 Bacteria 2165
34 Ga0070680_100287327 3300005336 Bacteria 1394
35 Ga0070680_100731298 3300005336 Bacteria 852
36 Ga0068868_100010101 3300005338 Bacteria 6820
37 Ga0070660_100008130 3300005339 Bacteria 7330
38 Ga0070660_100066106 3300005339 Bacteria 2814
39 Ga0070660_100067236 3300005339 Bacteria 2792
40 Ga0070660_100427999 3300005339 Bacteria 1096
41 Ga0070660_100696876 3300005339 Bacteria 851
42 Ga0070689_101531318 3300005340 Bacteria 604
43 Ga0070687_100029213 3300005343 Bacteria 2682
44 Ga0070661_100015328 3300005344 Bacteria 5409
45 Ga0070661_100271544 3300005344 Unclassified 1313
46 Ga0070661_100607672 3300005344 Bacteria 885
47 Ga0070661_100815340 3300005344 Bacteria 766
48 Ga0070692_10002931 3300005345 Bacteria 6774
49 Ga0070692_10024128 3300005345 Bacteria 2986
50 Ga0070692_10040827 3300005345 Bacteria 2375
51 Ga0070675_100111454 3300005354 Bacteria 2315
52 Ga0070671_100004554 3300005355 Bacteria 10979
53 Ga0070671_100023916 3300005355 Bacteria 4999
54 Ga0070671_100046139 3300005355 Bacteria 3623
55 Ga0070671_100051513 3300005355 Bacteria 3424
56 Ga0070671_100805750 3300005355 Unclassified 818
57 Ga0070674_100008301 3300005356 Bacteria 6178
58 Ga0070673_100048511 3300005364 Bacteria 3311
59 Ga0070673_100102366 3300005364 Bacteria 2361
60 Ga0070673_100122553 3300005364 Bacteria 2171
61 Ga0070659_100014479 3300005366 Bacteria 5894
62 Ga0070659_100024877 3300005366 Bacteria 4593
63 Ga0070659_100047017 3300005366 Bacteria 3383
64 Ga0070659_100070355 3300005366 Bacteria 2779
65 Ga0070659_100182632 3300005366 Bacteria 1722
66 Ga0070659_100869765 3300005366 Bacteria 786
67 Ga0070667_100005901 3300005367 Bacteria 10196
68 Ga0070667_100086539 3300005367 Bacteria 2689
69 Ga0070714_100446973 3300005435 Bacteria 1227
70 Ga0070713_100207615 3300005436 Bacteria 1772
71 Ga0070713_100227353 3300005436 Bacteria 1695
72 Ga0070663_100028632 3300005455 Bacteria 3795
73 Ga0070663_100292460 3300005455 Bacteria 1301
74 Ga0070663_100331546 3300005455 Bacteria 1227
75 Ga0070663_100465158 3300005455 Bacteria 1045
76 Ga0070663_100614424 3300005455 Bacteria 916
77 Ga0070662_100032561 3300005457 Bacteria 3664
78 Ga0070662_100273235 3300005457 Bacteria 1365
79 Ga0070662_100404340 3300005457 Bacteria 1127
80 Ga0070681_10051883 3300005458 Bacteria 4091
81 Ga0070681_10098876 3300005458 Bacteria 2864
82 Ga0070681_10586673 3300005458 Bacteria 1029
83 Ga0070681_10986094 3300005458 Bacteria 762
84 Ga0068867_100063757 3300005459 Bacteria 2739
85 Ga0068867_101114028 3300005459 Bacteria 721
86 Ga0070679_100031461 3300005530 Bacteria 5242
87 Ga0070679_100154472 3300005530 Bacteria 2270
88 Ga0070679_100220989 3300005530 Bacteria 1855
89 Ga0070679_100685335 3300005530 Bacteria 967
90 Ga0070679_100766716 3300005530 Bacteria 908
91 Ga0070684_100720536 3300005535 Bacteria 930
92 Ga0068853_100150509 3300005539 Bacteria 2095
93 Ga0068853_100185902 3300005539 Bacteria 1886
94 Ga0068853_100468525 3300005539 Bacteria 1186
95 Ga0070672_100011310 3300005543 Bacteria 6225
96 Ga0070672_100134543 3300005543 Bacteria 2035
97 Ga0070686_100013044 3300005544 Bacteria 4745
98 Ga0070693_100957001 3300005547 Bacteria 645
99 Ga0070665_101097595 3300005548 Bacteria 807
100 Ga0068855_100113988 3300005563 Bacteria 3100
101 Ga0068855_100145045 3300005563 Bacteria 2703
102 Ga0068855_100203536 3300005563 Bacteria 2228
103 Ga0068855_100684825 3300005563 Bacteria 1098
104 Ga0070664_100023104 3300005564 Bacteria 5133
105 Ga0070664_100042265 3300005564 Bacteria 3848
106 Ga0070664_100133401 3300005564 Bacteria 2182
107 Ga0070664_100374030 3300005564 Bacteria 1299
108 Ga0070664_100504408 3300005564 Bacteria 1115
109 Ga0068857_100068596 3300005577 Bacteria 3156
110 Ga0068857_100483587 3300005577 Bacteria 1160
111 Ga0068857_101132894 3300005577 Bacteria 756
112 Ga0068857_101381517 3300005577 Bacteria 685
113 Ga0068854_100003582 3300005578 Bacteria 9709
114 Ga0068854_100011653 3300005578 Bacteria 5734
115 Ga0068854_100141155 3300005578 Bacteria 1849
116 Ga0068854_100777917 3300005578 Bacteria 832
117 Ga0068856_100016360 3300005614 Bacteria 7176
118 Ga0068856_100017784 3300005614 Bacteria 6894
119 Ga0068856_100035616 3300005614 Bacteria 4878
120 Ga0068856_100148823 3300005614 Bacteria 2350
121 Ga0068856_100705305 3300005614 Bacteria 1029
122 Ga0068852_100000980 3300005616 Bacteria 18776
123 Ga0068852_100034223 3300005616 Bacteria 4225
124 Ga0068852_100076740 3300005616 Bacteria 2951
125 Ga0068852_100149123 3300005616 Bacteria 2173
126 Ga0068852_100311596 3300005616 Unclassified 1526
127 Ga0068852_100314721 3300005616 Bacteria 1519
128 Ga0068852_100507665 3300005616 Bacteria 1201
129 Ga0068864_100002541 3300005618 Bacteria 15068
130 Ga0068864_100095929 3300005618 Bacteria 2624
131 Ga0068866_10012793 3300005718 Bacteria 3664
132 Ga0068863_100028370 3300005841 Bacteria 5344
133 Ga0068863_100070829 3300005841 Bacteria 3298
134 Ga0068858_100001356 3300005842 Bacteria 25201
135 Ga0068858_100017552 3300005842 Bacteria 6712
136 Ga0068862_100034942 3300005844 Bacteria 4255
137 Ga0081539_10006970 3300005985 Bacteria 10494
138 Ga0097621_100833695 3300006237 Unclassified 856
139 Ga0068871_100595144 3300006358 Bacteria 1005
140 Ga0105240_10018511 3300009093 Bacteria 9350
141 Ga0105248_10000898 3300009177 Bacteria 33299
142 Ga0105248_10005021 3300009177 Bacteria 14611
143 Ga0105248_10017191 3300009177 Bacteria 7969
144 Ga0105248_11275843 3300009177 Unclassified 831
145 Ga0105238_11851715 3300009551 Bacteria 636
146 Ga0105246_10341594 3300011119 Bacteria 1224
147 Ga0157373_10049331 3300013100 Bacteria 3000
148 Ga0157373_10103231 3300013100 Bacteria 2006
149 Ga0157373_10385927 3300013100 Bacteria 1002
150 Ga0157373_10502127 3300013100 Bacteria 876
151 Ga0157371_10006634 3300013102 Bacteria 9488
152 Ga0157371_10151443 3300013102 Bacteria 1654
153 Ga0157371_10247401 3300013102 Unclassified 1283
154 Ga0157371_10343790 3300013102 Unclassified 1085
155 Ga0157371_10398106 3300013102 Bacteria 1007
156 Ga0157371_10675228 3300013102 Bacteria 772
157 Ga0157371_10749854 3300013102 Bacteria 733
158 Ga0157370_10031706 3300013104 Bacteria 5168
159 Ga0157370_10053804 3300013104 Bacteria 3838
160 Ga0157370_10092322 3300013104 Bacteria 2841
161 Ga0157370_10205663 3300013104 Bacteria 1825
162 Ga0157370_10679477 3300013104 Unclassified 940
163 Ga0157370_10965174 3300013104 Bacteria 772
164 Ga0157370_11001145 3300013104 Bacteria 757
165 Ga0157369_10022075 3300013105 Bacteria 7112
166 Ga0157369_10104383 3300013105 Bacteria 3018
167 Ga0157369_10205779 3300013105 Bacteria 2064
168 Ga0157369_10306770 3300013105 Bacteria 1651
169 Ga0157369_11205657 3300013105 Bacteria 772
170 Ga0157378_10157959 3300013297 Bacteria 2118
171 Ga0157378_10266007 3300013297 Bacteria 1647
172 Ga0157378_11191951 3300013297 Unclassified 801
173 Ga0157372_10074698 3300013307 Bacteria 3823
174 Ga0157372_11520150 3300013307 Bacteria 771
175 Ga0157379_10204163 3300014968 Bacteria 1788
176 Ga0183363_1003 3300015690 Bacteria 421263
177 Ga0183361_13266 3300016635 Bacteria 884
178 Ga0206354_11315564 3300020081 Bacteria 1657
179 Ga0206353_11648045 3300020082 Bacteria 1923
180 Ga0213875_10031205 3300021388 Bacteria 2522
181 Ga0209565_1000044 3300025263 Bacteria 229969
182 Ga0209565_1014251 3300025263 Bacteria 1834
183 Ga0209564_1004768 3300025295 Bacteria 8099
184 Ga0207426_1013899 3300025302 Bacteria 2967
185 Ga0207682_10000110 3300025893 Bacteria 37556
186 Ga0207682_10224790 3300025893 Bacteria 869
187 Ga0207642_10021632 3300025899 Bacteria 2536
188 Ga0207680_10000407 3300025903 Bacteria 20574
189 Ga0207647_10005282 3300025904 Bacteria 9500
190 Ga0207647_10059510 3300025904 Bacteria 2337
191 Ga0207647_10093291 3300025904 Bacteria 1794
192 Ga0207647_10126678 3300025904 Bacteria 1503
193 Ga0207645_10105521 3300025907 Bacteria 1821
194 Ga0207705_10016040 3300025909 Bacteria 5378
195 Ga0207705_10028187 3300025909 Bacteria 4003
196 Ga0207705_10049726 3300025909 Bacteria 3017
197 Ga0207705_10077202 3300025909 Bacteria 2423
198 Ga0207705_10079960 3300025909 Bacteria 2381
199 Ga0207705_10160769 3300025909 Bacteria 1687
200 Ga0207705_10449050 3300025909 Bacteria 1000
201 Ga0207707_10052208 3300025912 Bacteria 3561
202 Ga0207707_10296146 3300025912 Bacteria 1400
203 Ga0207707_10314056 3300025912 Bacteria 1354
204 Ga0207707_10679861 3300025912 Unclassified 866
205 Ga0207707_10886559 3300025912 Bacteria 738
206 Ga0207660_10001359 3300025917 Bacteria 16412
207 Ga0207660_10006715 3300025917 Bacteria 7452
208 Ga0207660_10041881 3300025917 Bacteria 3212
209 Ga0207660_10084249 3300025917 Bacteria 2343
210 Ga0207660_10209444 3300025917 Bacteria 1526
211 Ga0207662_10034029 3300025918 Bacteria 2973
212 Ga0207657_10000868 3300025919 Bacteria 31880
213 Ga0207657_10006719 3300025919 Bacteria 11883
214 Ga0207657_10010773 3300025919 Bacteria 9102
215 Ga0207657_10019453 3300025919 Bacteria 6447
216 Ga0207657_10181290 3300025919 Bacteria 1702
217 Ga0207657_10182352 3300025919 Bacteria 1696
218 Ga0207657_10185024 3300025919 Bacteria 1682
219 Ga0207657_10201666 3300025919 Bacteria 1600
220 Ga0207657_10322091 3300025919 Bacteria 1222
221 Ga0207657_10758922 3300025919 Bacteria 751
222 Ga0207649_10170473 3300025920 Bacteria 1516
223 Ga0207649_10304617 3300025920 Bacteria 1166
224 Ga0207649_10645809 3300025920 Unclassified 817
225 Ga0207649_10835222 3300025920 Unclassified 720
226 Ga0207652_10007692 3300025921 Bacteria 8662
227 Ga0207652_10139878 3300025921 Bacteria 2164
228 Ga0207652_10185627 3300025921 Bacteria 1870
229 Ga0207650_10175890 3300025925 Bacteria 1703
230 Ga0207659_10059986 3300025926 Bacteria 2737
231 Ga0207700_10197118 3300025928 Bacteria 1695
232 Ga0207664_10981669 3300025929 Bacteria 757
233 Ga0207644_10013060 3300025931 Bacteria 5527
234 Ga0207644_10081673 3300025931 Bacteria 2389
235 Ga0207644_10179896 3300025931 Bacteria 1656
236 Ga0207644_10471152 3300025931 Bacteria 1033
237 Ga0207690_10006270 3300025932 Bacteria 7042
238 Ga0207690_10141353 3300025932 Bacteria 1774
239 Ga0207690_10232839 3300025932 Bacteria 1415
240 Ga0207690_10240398 3300025932 Bacteria 1394
241 Ga0207690_10816170 3300025932 Bacteria 771
242 Ga0207706_10044088 3300025933 Bacteria 3953
243 Ga0207706_10371936 3300025933 Bacteria 1241
244 Ga0207706_10669719 3300025933 Bacteria 888
245 Ga0207691_10049967 3300025940 Bacteria 3830
246 Ga0207691_10108115 3300025940 Bacteria 2476
247 Ga0207711_10000748 3300025941 Bacteria 31824
248 Ga0207711_10003381 3300025941 Bacteria 13827
249 Ga0207711_10070927 3300025941 Bacteria 3022
250 Ga0207689_10276705 3300025942 Bacteria 1390
251 Ga0207689_11183564 3300025942 Bacteria 644
252 Ga0207661_10006969 3300025944 Bacteria 8014
253 Ga0207679_10011827 3300025945 Bacteria 5671
254 Ga0207679_10055412 3300025945 Bacteria 2922
255 Ga0207679_10122516 3300025945 Bacteria 2072
256 Ga0207679_11326699 3300025945 Bacteria 660
257 Ga0207667_10055099 3300025949 Bacteria 4181
258 Ga0207667_10091946 3300025949 Bacteria 3134
259 Ga0207667_10122196 3300025949 Bacteria 2683
260 Ga0207667_10130628 3300025949 Bacteria 2587
261 Ga0207667_10611033 3300025949 Bacteria 1099
262 Ga0207651_10057705 3300025960 Bacteria 2679
263 Ga0207651_10121017 3300025960 Bacteria 1985
264 Ga0207651_10506719 3300025960 Unclassified 1044
265 Ga0207640_10014305 3300025981 Bacteria 4565
266 Ga0207640_10042685 3300025981 Bacteria 2893
267 Ga0207640_10054196 3300025981 Bacteria 2621
268 Ga0207640_10427047 3300025981 Bacteria 1086
269 Ga0207640_10956381 3300025981 Bacteria 751
270 Ga0207658_10801700 3300025986 Bacteria 855
271 Ga0207677_10003777 3300026023 Bacteria 8043
272 Ga0207703_10001763 3300026035 Bacteria 19334
273 Ga0207703_10214122 3300026035 Bacteria 1719
274 Ga0207639_10071878 3300026041 Bacteria 2708
275 Ga0207639_11135782 3300026041 Bacteria 733
276 Ga0207678_10012750 3300026067 Bacteria 7383
277 Ga0207678_10081580 3300026067 Bacteria 2769
278 Ga0207678_10122757 3300026067 Bacteria 2216
279 Ga0207678_10151288 3300026067 Bacteria 1982
280 Ga0207678_10192069 3300026067 Bacteria 1745
281 Ga0207678_10337025 3300026067 Bacteria 1299
282 Ga0207678_10430479 3300026067 Bacteria 1145
283 Ga0207678_10569145 3300026067 Bacteria 992
284 Ga0207702_10043689 3300026078 Bacteria 3764
285 Ga0207702_10102050 3300026078 Bacteria 2534
286 Ga0207702_10274390 3300026078 Bacteria 1591
287 Ga0207702_11075287 3300026078 Unclassified 798
288 Ga0207641_10025186 3300026088 Bacteria 4906
289 Ga0207641_10919135 3300026088 Unclassified 869
290 Ga0207648_10041954 3300026089 Bacteria 4017
291 Ga0207676_10038224 3300026095 Bacteria 3661
292 Ga0207676_10515401 3300026095 Bacteria 1138
293 Ga0207676_10878272 3300026095 Unclassified 878
294 Ga0207674_10004317 3300026116 Bacteria 17136
295 Ga0207674_10010854 3300026116 Bacteria 10268
296 Ga0207674_10741882 3300026116 Bacteria 948
297 Ga0207674_11141047 3300026116 Bacteria 749
298 Ga0207698_10003738 3300026142 Bacteria 9196
299 Ga0207698_10065766 3300026142 Bacteria 2850
300 Ga0207698_10065878 3300026142 Bacteria 2848
301 Ga0207698_10136084 3300026142 Bacteria 2108
302 Ga0207698_10514718 3300026142 Bacteria 1167
303 Ga0207698_10678987 3300026142 Unclassified 1023
304 Ga0268265_10013718 3300028380 Bacteria 5513
305 Ga0268264_10584896 3300028381 Unclassified 1099
306 Ga0268264_11700695 3300028381 Bacteria 641
307 Ga0307515_10597246 3300028794 Unclassified 714
308 Ga0307408_100059639 3300031548 Bacteria 2778
309 Ga0307408_100336221 3300031548 Bacteria 1277
310 Ga0307405_10069215 3300031731 Bacteria 2262
311 Ga0307405_10090261 3300031731 Bacteria 2026
312 Ga0307405_10576192 3300031731 Bacteria 915
313 Ga0307413_10001436 3300031824 Bacteria 9023
314 Ga0307413_10002974 3300031824 Bacteria 7017
315 Ga0307413_10129352 3300031824 Bacteria 1725
316 Ga0307413_10281756 3300031824 Bacteria 1250
317 Ga0307413_10579907 3300031824 Bacteria 915
318 Ga0307413_10643167 3300031824 Unclassified 874
319 Ga0307410_10003282 3300031852 Bacteria 8079
320 Ga0307410_10008488 3300031852 Bacteria 5698
321 Ga0307410_10020638 3300031852 Bacteria 4035
322 Ga0307410_10201300 3300031852 Bacteria 1520
323 Ga0307410_10258365 3300031852 Bacteria 1357
324 Ga0307410_10288038 3300031852 Bacteria 1291
325 Ga0307410_10493817 3300031852 Bacteria 1006
326 Ga0307410_10724614 3300031852 Bacteria 840
327 Ga0307406_10051257 3300031901 Bacteria 2619
328 Ga0307406_10063684 3300031901 Bacteria 2390
329 Ga0307407_10005183 3300031903 Bacteria 5626
330 Ga0307407_10020174 3300031903 Bacteria 3409
331 Ga0307407_10219937 3300031903 Bacteria 1283
332 Ga0307407_10303077 3300031903 Bacteria 1115
333 Ga0307412_10016812 3300031911 Bacteria 4368
334 Ga0307412_10077414 3300031911 Bacteria 2288
335 Ga0307412_10353569 3300031911 Bacteria 1180
336 Ga0307412_10367369 3300031911 Bacteria 1161
337 Ga0307412_10834397 3300031911 Bacteria 803
338 Ga0307409_100001518 3300031995 Bacteria 11491
339 Ga0307409_100006097 3300031995 Bacteria 7044
340 Ga0307409_100022011 3300031995 Bacteria 4385
341 Ga0307409_100469089 3300031995 Bacteria 1219
342 Ga0307409_100973542 3300031995 Unclassified 865
343 Ga0307409_101055447 3300031995 Bacteria 832
344 Ga0307409_101372097 3300031995 Bacteria 733
345 Ga0307409_101440620 3300031995 Bacteria 715
346 Ga0307416_100027261 3300032002 Bacteria 4227
347 Ga0307416_100319157 3300032002 Bacteria 1554
348 Ga0307416_100382253 3300032002 Bacteria 1438
349 Ga0307416_100423431 3300032002 Bacteria 1376
350 Ga0307416_100558720 3300032002 Bacteria 1219
351 Ga0307416_101421926 3300032002 Bacteria 799
352 Ga0307416_101764858 3300032002 Bacteria 723
353 Ga0307416_102218528 3300032002 Bacteria 650
354 Ga0307414_10009751 3300032004 Bacteria 5533
355 Ga0307414_10058169 3300032004 Bacteria 2722
356 Ga0307414_10095467 3300032004 Bacteria 2222
357 Ga0307414_10143438 3300032004 Bacteria 1873
358 Ga0307414_10375251 3300032004 Bacteria 1228
359 Ga0307414_10402741 3300032004 Bacteria 1189
360 Ga0307414_10615416 3300032004 Bacteria 976
361 Ga0307414_10877142 3300032004 Bacteria 822
362 Ga0307411_10005891 3300032005 Bacteria 6079
363 Ga0307411_10009689 3300032005 Bacteria 5084
364 Ga0307411_10010306 3300032005 Bacteria 4974
365 Ga0307411_10011046 3300032005 Bacteria 4851
366 Ga0307411_10017168 3300032005 Bacteria 4114
367 Ga0307411_10048075 3300032005 Bacteria 2762
368 Ga0307411_10167797 3300032005 Bacteria 1652
369 Ga0307411_10318504 3300032005 Bacteria 1255
370 Ga0307411_10382708 3300032005 Bacteria 1158
371 Ga0307415_100000099 3300032126 Bacteria 36620
372 Ga0307415_100000632 3300032126 Bacteria 15442
373 Ga0307415_100106070 3300032126 Bacteria 2073
374 Ga0307415_100531086 3300032126 Bacteria 1034
375 Ga0307415_100695860 3300032126 Unclassified 917
376 Ga0307415_100941220 3300032126 Bacteria 799
377 Ga0373939_0089815 3300035114 Unclassified 1036
378 Ga0373941_0080001 3300035115 Unclassified 1102
379 Ga0395899_0000732 3300037312 Bacteria 32768
380 Ga0395899_0068976 3300037312 Bacteria 2590
381 Ga0395899_0091589 3300037312 Bacteria 2203
382 Ga0395899_0147149 3300037312 Bacteria 1672
383 Ga0395899_0226731 3300037312 Bacteria 1292
384 Ga0395900_0001059 3300037418 Bacteria 35203
385 Ga0395900_0005712 3300037418 Bacteria 13000
386 Ga0395900_0037239 3300037418 Bacteria 5017
387 Ga0395900_0050979 3300037418 Bacteria 4263
388 Ga0395900_0087072 3300037418 Bacteria 3210
389 Ga0395900_0097544 3300037418 Bacteria 3020
390 Ga0395900_0587418 3300037418 Unclassified 1055
391 Ga0395900_1003839 3300037418 Bacteria 754
392 Ga0395900_1191436 3300037418 Bacteria 677
393 Ga0395898_0021900 3300037466 Bacteria 6474
394 Ga0395898_0120638 3300037466 Bacteria 2512
395 Ga0395898_0897926 3300037466 Bacteria 824
396 Ga0395905_0005286 3300037471 Bacteria 13203
397 Ga0395905_0046751 3300037471 Bacteria 4058
398 Ga0395905_0110002 3300037471 Bacteria 2587
399 Ga0395905_0126744 3300037471 Bacteria 2401
400 Ga0395905_0159402 3300037471 Bacteria 2121
401 Ga0395905_0216929 3300037471 Bacteria 1791
402 Ga0395905_0249370 3300037471 Bacteria 1658
403 Ga0395905_1327505 3300037471 Bacteria 623
404 Ga0436364_1036774 3300037853 Bacteria 2653
405 Ga0395901_0000208 3300038443 Bacteria 73874
406 Ga0395901_0000398 3300038443 Bacteria 51885
407 Ga0395901_0122462 3300038443 Bacteria 2733
408 Ga0395901_0222418 3300038443 Bacteria 1973
409 Ga0395901_0579125 3300038443 Unclassified 1134
410 Ga0395901_0631319 3300038443 Bacteria 1077
411 Ga0395901_0655366 3300038443 Bacteria 1052
412 Ga0439438_119966 3300041405 Bacteria 633
413 Ga0439448_0004309 3300042005 Bacteria 4013
414 Ga0439432_042574 3300042006 Bacteria 1435
415 Ga0439449_0009156 3300042007 Bacteria 3754
416 Ga0439455_0013762 3300042012 Bacteria 1838
417 Ga0439455_0056376 3300042012 Bacteria 1035
418 Ga0450907_057926 3300042146 Bacteria 668
419 Ga0439458_0000999 3300042157 Bacteria 7227
420 Ga0439464_0008848 3300042439 Bacteria 2639
421 Ga0466969_0006024 3300044656 Bacteria 6453
422 Ga0466965_0440783 3300044683 Bacteria 724
423 Ga0466966_0001597 3300044684 Bacteria 14571
424 Ga0466966_0305523 3300044684 Unclassified 956
425 Ga0466961_0005942 3300044693 Bacteria 7734
426 Ga0466961_0040902 3300044693 Bacteria 2972
427 Ga0466961_0119087 3300044693 Bacteria 1658
428 Ga0466963_0079793 3300044694 Bacteria 2214
429 Ga0466963_0129196 3300044694 Bacteria 1744
430 Ga0466963_0144411 3300044694 Bacteria 1650
431 Ga0466963_0162308 3300044694 Bacteria 1555
432 Ga0466963_0177681 3300044694 Bacteria 1486
433 Ga0466963_0231458 3300044694 Bacteria 1295
434 Ga0466963_0404372 3300044694 Unclassified 963
435 Ga0466963_0465818 3300044694 Unclassified 892
436 Ga0466964_0269090 3300044706 Bacteria 847
437 Ga0466964_0349835 3300044706 Bacteria 759
438 Ga0466964_0551753 3300044706 Bacteria 626
439 Ga0466971_0000729 3300044719 Bacteria 13165
440 Ga0466971_0002840 3300044719 Bacteria 7341
441 Ga0466971_0102069 3300044719 Bacteria 1319
442 Ga0466971_0136173 3300044719 Unclassified 1142
443 Ga0466971_0189443 3300044719 Unclassified 969
444 Ga0466971_0310565 3300044719 Unclassified 758
445 Ga0466971_0386603 3300044719 Bacteria 681
446 Ga0466968_0022261 3300044735 Bacteria 2575
447 Ga0466970_0001316 3300044765 Bacteria 12038
448 Ga0466970_0019972 3300044765 Bacteria 3477
449 Ga0466957_0004840 3300044842 Bacteria 7534
450 Ga0466957_0054685 3300044842 Bacteria 2437
451 Ga0466957_0206244 3300044842 Bacteria 1293
452 Ga0466957_0221736 3300044842 Bacteria 1249
453 Ga0466957_0292562 3300044842 Bacteria 1093
454 Ga0466957_0358078 3300044842 Bacteria 991
455 Ga0466957_0547684 3300044842 Unclassified 806
456 Ga0466960_0060890 3300044901 Bacteria 1851
457 Ga0466959_0045749 3300045049 Bacteria 3222
458 Ga0466959_0058456 3300045049 Bacteria 2808
459 Ga0466959_0093994 3300045049 Bacteria 2151
460 Ga0466959_0666174 3300045049 Bacteria 698
461 Ga0466958_0000047 3300045836 Bacteria 35806
462 Ga0466958_0095128 3300045836 Bacteria 1846
463 Ga0466958_0157475 3300045836 Bacteria 1434
464 Ga0466958_0373145 3300045836 Bacteria 919
465 Ga0466967_0001182 3300045976 Bacteria 14643
466 Ga0466967_0005659 3300045976 Bacteria 8704
467 Ga0466967_0027998 3300045976 Bacteria 4697
468 Ga0466967_0070403 3300045976 Bacteria 3129
469 Ga0466967_0170670 3300045976 Bacteria 2046
470 Ga0466967_0193314 3300045976 Bacteria 1924
471 Ga0466967_0805770 3300045976 Bacteria 932
472 Ga0466967_0954229 3300045976 Bacteria 853
473 Ga0495669_0008365 3300046684 Bacteria 4348
474 Ga0495677_0060032 3300047445 Bacteria 1409
475 Ga0496100_0326741 3300048903 Bacteria 1153
476 Ga0496101_0002695 3300048904 Bacteria 10891
477 Ga0496101_0300123 3300048904 Bacteria 1258
478 Ga0496106_0005869 3300048909 Bacteria 9082
479 Ga0496107_0002597 3300048910 Bacteria 11777
480 Ga0496107_0361835 3300048910 Bacteria 1079
481 Ga0496107_0756628 3300048910 Unclassified 713
482 Ga0496108_0005175 3300048911 Bacteria 10543
483 Ga0496108_0010579 3300048911 Bacteria 7490
484 Ga0496108_0165356 3300048911 Bacteria 1913
485 Ga0496109_0026027 3300048912 Bacteria 5214
486 Ga0496109_0683273 3300048912 Bacteria 964
487 Ga0496109_0900314 3300048912 Viruses 823
488 Ga0496110_0430479 3300048913 Bacteria 1203
489 Ga0496110_0690096 3300048913 Unclassified 922
490 Ga0496111_0000602 3300048914 Bacteria 18978
491 Ga0496112_0001631 3300048915 Bacteria 17374
492 Ga0496112_0009138 3300048915 Bacteria 8905
493 Ga0496112_0070576 3300048915 Bacteria 3453
494 Ga0496112_0112487 3300048915 Bacteria 2693
495 Ga0496113_0010886 3300048916 Bacteria 6035
496 Ga0496118_0281135 3300048921 Bacteria 926
497 Ga0501034_0712412 3300049571 Bacteria 901
498 Ga0501038_0167917 3300049574 Bacteria 1779
499 Ga0501047_0333497 3300049581 Bacteria 1355
500 Ga0501067_0016612 3300049583 Bacteria 4067
501 Ga0501069_0020882 3300049585 Bacteria 3550
502 Ga0501070_0014477 3300049586 Bacteria 6638
503 Ga0501227_098402 3300049665 Bacteria 777
504 Ga0501221_129513 3300049704 Bacteria 652
505 Ga0501273_017311 3300049770 Bacteria 951
506 Ga0501044_0194183 3300049823 Bacteria 1991
507 Ga0501044_0247543 3300049823 Bacteria 1725
508 Ga0500646_0020116 3300053090 Bacteria 1771
509 Ga0500573_0477117 3300053140 Bacteria 569
510 Ga0466962_0002650 3300061719 Bacteria 8512
511 Ga0466962_0020533 3300061719 Bacteria 3173
512 Ga0466962_0328300 3300061719 Bacteria 760
513 Ga0466962_0391051 3300061719 Unclassified 695
514 2885429019 2885427238 Bacteria 2291351
515 2885432605 2885429604 Bacteria 3642894
516 Ga0070680_100007989
517 LJQas_1003125
518 JGI24741J21665_1000617
519 JGI24741J21665_1002803
520 JGI25152J39213_1024415
521 rootH1_10103381
522 rootH2_10005468
523 Ga0055526_1007617
524 Ga0055526_1039584
525 Ga0055537_1003499
526 Ga0070658_10000264
527 Ga0070658_10009024
528 Ga0070658_10009851
529 Ga0070658_10030042
530 Ga0070658_10038444
531 Ga0070658_10048975
532 Ga0070658_10073624
533 Ga0070658_10202055
534 Ga0070658_10204473
535 Ga0070658_10333581
536 Ga0070658_10532021
537 Ga0070658_10992056
538 Ga0070683_100856697
539 Ga0070690_100040957
540 Ga0070677_10000111
541 Ga0068869_101348043
542 Ga0070666_10010275
543 Ga0070666_10282156
544 Ga0070666_10382199
545 Ga0070680_100018024
546 Ga0070680_100020986
547 Ga0070680_100114062
548 Ga0070680_100123160
549 Ga0070680_100287327
550 Ga0070680_100731298
551 Ga0068868_100010101
552 Ga0070660_100008130
553 Ga0070660_100066106
554 Ga0070660_100067236
555 Ga0070660_100427999
556 Ga0070660_100696876
557 Ga0070689_101531318
558 Ga0070687_100029213
559 Ga0070661_100015328
560 Ga0070661_100271544
561 Ga0070661_100607672
562 Ga0070661_100815340
563 Ga0070692_10002931
564 Ga0070692_10024128
565 Ga0070692_10040827
566 Ga0070675_100111454
567 Ga0070671_100004554
568 Ga0070671_100023916
569 Ga0070671_100046139
570 Ga0070671_100051513
571 Ga0070671_100805750
572 Ga0070674_100008301
573 Ga0070673_100048511
574 Ga0070673_100102366
575 Ga0070673_100122553
576 Ga0070659_100014479
577 Ga0070659_100024877
578 Ga0070659_100047017
579 Ga0070659_100070355
580 Ga0070659_100182632
581 Ga0070659_100869765
582 Ga0070667_100005901
583 Ga0070667_100086539
584 Ga0070714_100446973
585 Ga0070713_100207615
586 Ga0070713_100227353
587 Ga0070663_100028632
588 Ga0070663_100292460
589 Ga0070663_100331546
590 Ga0070663_100465158
591 Ga0070663_100614424
592 Ga0070662_100032561
593 Ga0070662_100273235
594 Ga0070662_100404340
595 Ga0070681_10051883
596 Ga0070681_10098876
597 Ga0070681_10586673
598 Ga0070681_10986094
599 Ga0068867_100063757
600 Ga0068867_101114028
601 Ga0070679_100031461
602 Ga0070679_100154472
603 Ga0070679_100220989
604 Ga0070679_100685335
605 Ga0070679_100766716
606 Ga0070684_100720536
607 Ga0068853_100150509
608 Ga0068853_100185902
609 Ga0068853_100468525
610 Ga0070672_100011310
611 Ga0070672_100134543
612 Ga0070686_100013044
613 Ga0070693_100957001
614 Ga0070665_101097595
615 Ga0068855_100113988
616 Ga0068855_100145045
617 Ga0068855_100203536
618 Ga0068855_100684825
619 Ga0070664_100023104
620 Ga0070664_100042265
621 Ga0070664_100133401
622 Ga0070664_100374030
623 Ga0070664_100504408
624 Ga0068857_100068596
625 Ga0068857_100483587
626 Ga0068857_101132894
627 Ga0068857_101381517
628 Ga0068854_100003582
629 Ga0068854_100011653
630 Ga0068854_100141155
631 Ga0068854_100777917
632 Ga0068856_100016360
633 Ga0068856_100017784
634 Ga0068856_100035616
635 Ga0068856_100148823
636 Ga0068856_100705305
637 Ga0068852_100000980
638 Ga0068852_100034223
639 Ga0068852_100076740
640 Ga0068852_100149123
641 Ga0068852_100311596
642 Ga0068852_100314721
643 Ga0068852_100507665
644 Ga0068864_100002541
645 Ga0068864_100095929
646 Ga0068866_10012793
647 Ga0068863_100028370
648 Ga0068863_100070829
649 Ga0068858_100001356
650 Ga0068858_100017552
651 Ga0068862_100034942
652 Ga0081539_10006970
653 Ga0097621_100833695
654 Ga0068871_100595144
655 Ga0105240_10018511
656 Ga0105248_10000898
657 Ga0105248_10005021
658 Ga0105248_10017191
659 Ga0105248_11275843
660 Ga0105238_11851715
661 Ga0105246_10341594
662 Ga0157373_10049331
663 Ga0157373_10103231
664 Ga0157373_10385927
665 Ga0157373_10502127
666 Ga0157371_10006634
667 Ga0157371_10151443
668 Ga0157371_10247401
669 Ga0157371_10343790
670 Ga0157371_10398106
671 Ga0157371_10675228
672 Ga0157371_10749854
673 Ga0157370_10031706
674 Ga0157370_10053804
675 Ga0157370_10092322
676 Ga0157370_10205663
677 Ga0157370_10679477
678 Ga0157370_10965174
679 Ga0157370_11001145
680 Ga0157369_10022075
681 Ga0157369_10104383
682 Ga0157369_10205779
683 Ga0157369_10306770
684 Ga0157369_11205657
685 Ga0157378_10157959
686 Ga0157378_10266007
687 Ga0157378_11191951
688 Ga0157372_10074698
689 Ga0157372_11520150
690 Ga0157379_10204163
691 Ga0183363_1003
692 Ga0183361_13266
693 Ga0206354_11315564
694 Ga0206353_11648045
695 Ga0213875_10031205
696 Ga0209565_1000044
697 Ga0209565_1014251
698 Ga0209564_1004768
699 Ga0207426_1013899
700 Ga0207682_10000110
701 Ga0207682_10224790
702 Ga0207642_10021632
703 Ga0207680_10000407
704 Ga0207647_10005282
705 Ga0207647_10059510
706 Ga0207647_10093291
707 Ga0207647_10126678
708 Ga0207645_10105521
709 Ga0207705_10016040
710 Ga0207705_10028187
711 Ga0207705_10049726
712 Ga0207705_10077202
713 Ga0207705_10079960
714 Ga0207705_10160769
715 Ga0207705_10449050
716 Ga0207707_10052208
717 Ga0207707_10296146
718 Ga0207707_10314056
719 Ga0207707_10679861
720 Ga0207707_10886559
721 Ga0207660_10001359
722 Ga0207660_10006715
723 Ga0207660_10041881
724 Ga0207660_10084249
725 Ga0207660_10209444
726 Ga0207662_10034029
727 Ga0207657_10000868
728 Ga0207657_10006719
729 Ga0207657_10010773
730 Ga0207657_10019453
731 Ga0207657_10181290
732 Ga0207657_10182352
733 Ga0207657_10185024
734 Ga0207657_10201666
735 Ga0207657_10322091
736 Ga0207657_10758922
737 Ga0207649_10170473
738 Ga0207649_10304617
739 Ga0207649_10645809
740 Ga0207649_10835222
741 Ga0207652_10007692
742 Ga0207652_10139878
743 Ga0207652_10185627
744 Ga0207650_10175890
745 Ga0207659_10059986
746 Ga0207700_10197118
747 Ga0207664_10981669
748 Ga0207644_10013060
749 Ga0207644_10081673
750 Ga0207644_10179896
751 Ga0207644_10471152
752 Ga0207690_10006270
753 Ga0207690_10141353
754 Ga0207690_10232839
755 Ga0207690_10240398
756 Ga0207690_10816170
757 Ga0207706_10044088
758 Ga0207706_10371936
759 Ga0207706_10669719
760 Ga0207691_10049967
761 Ga0207691_10108115
762 Ga0207711_10000748
763 Ga0207711_10003381
764 Ga0207711_10070927
765 Ga0207689_10276705
766 Ga0207689_11183564
767 Ga0207661_10006969
768 Ga0207679_10011827
769 Ga0207679_10055412
770 Ga0207679_10122516
771 Ga0207679_11326699
772 Ga0207667_10055099
773 Ga0207667_10091946
774 Ga0207667_10122196
775 Ga0207667_10130628
776 Ga0207667_10611033
777 Ga0207651_10057705
778 Ga0207651_10121017
779 Ga0207651_10506719
780 Ga0207640_10014305
781 Ga0207640_10042685
782 Ga0207640_10054196
783 Ga0207640_10427047
784 Ga0207640_10956381
785 Ga0207658_10801700
786 Ga0207677_10003777
787 Ga0207703_10001763
788 Ga0207703_10214122
789 Ga0207639_10071878
790 Ga0207639_11135782
791 Ga0207678_10012750
792 Ga0207678_10081580
793 Ga0207678_10122757
794 Ga0207678_10151288
795 Ga0207678_10192069
796 Ga0207678_10337025
797 Ga0207678_10430479
798 Ga0207678_10569145
799 Ga0207702_10043689
800 Ga0207702_10102050
801 Ga0207702_10274390
802 Ga0207702_11075287
803 Ga0207641_10025186
804 Ga0207641_10919135
805 Ga0207648_10041954
806 Ga0207676_10038224
807 Ga0207676_10515401
808 Ga0207676_10878272
809 Ga0207674_10004317
810 Ga0207674_10010854
811 Ga0207674_10741882
812 Ga0207674_11141047
813 Ga0207698_10003738
814 Ga0207698_10065766
815 Ga0207698_10065878
816 Ga0207698_10136084
817 Ga0207698_10514718
818 Ga0207698_10678987
819 Ga0268265_10013718
820 Ga0268264_10584896
821 Ga0268264_11700695
822 Ga0307515_10597246
823 Ga0307408_100059639
824 Ga0307408_100336221
825 Ga0307405_10069215
826 Ga0307405_10090261
827 Ga0307405_10576192
828 Ga0307413_10001436
829 Ga0307413_10002974
830 Ga0307413_10129352
831 Ga0307413_10281756
832 Ga0307413_10579907
833 Ga0307413_10643167
834 Ga0307410_10003282
835 Ga0307410_10008488
836 Ga0307410_10020638
837 Ga0307410_10201300
838 Ga0307410_10258365
839 Ga0307410_10288038
840 Ga0307410_10493817
841 Ga0307410_10724614
842 Ga0307406_10051257
843 Ga0307406_10063684
844 Ga0307407_10005183
845 Ga0307407_10020174
846 Ga0307407_10219937
847 Ga0307407_10303077
848 Ga0307412_10016812
849 Ga0307412_10077414
850 Ga0307412_10353569
851 Ga0307412_10367369
852 Ga0307412_10834397
853 Ga0307409_100001518
854 Ga0307409_100006097
855 Ga0307409_100022011
856 Ga0307409_100469089
857 Ga0307409_100973542
858 Ga0307409_101055447
859 Ga0307409_101372097
860 Ga0307409_101440620
861 Ga0307416_100027261
862 Ga0307416_100319157
863 Ga0307416_100382253
864 Ga0307416_100423431
865 Ga0307416_100558720
866 Ga0307416_101421926
867 Ga0307416_101764858
868 Ga0307416_102218528
869 Ga0307414_10009751
870 Ga0307414_10058169
871 Ga0307414_10095467
872 Ga0307414_10143438
873 Ga0307414_10375251
874 Ga0307414_10402741
875 Ga0307414_10615416
876 Ga0307414_10877142
877 Ga0307411_10005891
878 Ga0307411_10009689
879 Ga0307411_10010306
880 Ga0307411_10011046
881 Ga0307411_10017168
882 Ga0307411_10048075
883 Ga0307411_10167797
884 Ga0307411_10318504
885 Ga0307411_10382708
886 Ga0307415_100000099
887 Ga0307415_100000632
888 Ga0307415_100106070
889 Ga0307415_100531086
890 Ga0307415_100695860
891 Ga0307415_100941220
892 Ga0373939_0089815
893 Ga0373941_0080001
894 Ga0395899_0000732
895 Ga0395899_0068976
896 Ga0395899_0091589
897 Ga0395899_0147149
898 Ga0395899_0226731
899 Ga0395900_0001059
900 Ga0395900_0005712
901 Ga0395900_0037239
902 Ga0395900_0050979
903 Ga0395900_0087072
904 Ga0395900_0097544
905 Ga0395900_0587418
906 Ga0395900_1003839
907 Ga0395900_1191436
908 Ga0395898_0021900
909 Ga0395898_0120638
910 Ga0395898_0897926
911 Ga0395905_0005286
912 Ga0395905_0046751
913 Ga0395905_0110002
914 Ga0395905_0126744
915 Ga0395905_0159402
916 Ga0395905_0216929
917 Ga0395905_0249370
918 Ga0395905_1327505
919 Ga0436364_1036774
920 Ga0395901_0000208
921 Ga0395901_0000398
922 Ga0395901_0122462
923 Ga0395901_0222418
924 Ga0395901_0579125
925 Ga0395901_0631319
926 Ga0395901_0655366
927 Ga0439438_119966
928 Ga0439448_0004309
929 Ga0439432_042574
930 Ga0439449_0009156
931 Ga0439455_0013762
932 Ga0439455_0056376
933 Ga0450907_057926
934 Ga0439458_0000999
935 Ga0439464_0008848
936 Ga0466969_0006024
937 Ga0466965_0440783
938 Ga0466966_0001597
939 Ga0466966_0305523
940 Ga0466961_0005942
941 Ga0466961_0040902
942 Ga0466961_0119087
943 Ga0466963_0079793
944 Ga0466963_0129196
945 Ga0466963_0144411
946 Ga0466963_0162308
947 Ga0466963_0177681
948 Ga0466963_0231458
949 Ga0466963_0404372
950 Ga0466963_0465818
951 Ga0466964_0269090
952 Ga0466964_0349835
953 Ga0466964_0551753
954 Ga0466971_0000729
955 Ga0466971_0002840
956 Ga0466971_0102069
957 Ga0466971_0136173
958 Ga0466971_0189443
959 Ga0466971_0310565
960 Ga0466971_0386603
961 Ga0466968_0022261
962 Ga0466970_0001316
963 Ga0466970_0019972
964 Ga0466957_0004840
965 Ga0466957_0054685
966 Ga0466957_0206244
967 Ga0466957_0221736
968 Ga0466957_0292562
969 Ga0466957_0358078
970 Ga0466957_0547684
971 Ga0466960_0060890
972 Ga0466959_0045749
973 Ga0466959_0058456
974 Ga0466959_0093994
975 Ga0466959_0666174
976 Ga0466958_0000047
977 Ga0466958_0095128
978 Ga0466958_0157475
979 Ga0466958_0373145
980 Ga0466967_0001182
981 Ga0466967_0005659
982 Ga0466967_0027998
983 Ga0466967_0070403
984 Ga0466967_0170670
985 Ga0466967_0193314
986 Ga0466967_0805770
987 Ga0466967_0954229
988 Ga0495669_0008365
989 Ga0495677_0060032
990 Ga0496100_0326741
991 Ga0496101_0002695
992 Ga0496101_0300123
993 Ga0496106_0005869
994 Ga0496107_0002597
995 Ga0496107_0361835
996 Ga0496107_0756628
997 Ga0496108_0005175
998 Ga0496108_0010579
999 Ga0496108_0165356
1000 Ga0496109_0026027
1001 Ga0496109_0683273
1002 Ga0496109_0900314
1003 Ga0496110_0430479
1004 Ga0496110_0690096
1005 Ga0496111_0000602
1006 Ga0496112_0001631
1007 Ga0496112_0009138
1008 Ga0496112_0070576
1009 Ga0496112_0112487
1010 Ga0496113_0010886
1011 Ga0496118_0281135
1012 Ga0501034_0712412
1013 Ga0501038_0167917
1014 Ga0501047_0333497
1015 Ga0501067_0016612
1016 Ga0501069_0020882
1017 Ga0501070_0014477
1018 Ga0501227_098402
1019 Ga0501221_129513
1020 Ga0501273_017311
1021 Ga0501044_0194183
1022 Ga0501044_0247543
1023 Ga0500646_0020116
1024 Ga0500573_0477117
1025 Ga0466962_0002650
1026 Ga0466962_0020533
1027 Ga0466962_0328300
1028 Ga0466962_0391051
1029 2885429019
1030 2885432605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

36

165

0.93

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

22

153

0.85

PF08445

FR47

FR47-like protein

88

162

0.85

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

11

154

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

64

155

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9133 123 167
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.9076 123 167
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.9053 123 167
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.9052 123 167
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.8967 1 170
ID Description Score Start End Superfamily
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9152 11 167 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9058 3 167 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9052 123 167 3.30.572.10
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.893 11 167 3.40.630.30
af_Q2G0G4_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.89 1 164 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A257JPK3-F1-model_v4 GNAT family N-acetyltransferase 0.978 1 167 GO:0016747
AF-A0A350ZUX4-F1-model_v4 deleted 0.9668 2 167
AF-A0A522D891-F1-model_v4 GNAT family N-acetyltransferase 0.9635 1 167 GO:0016747
AF-A0A059GA32-F1-model_v4 N-acetyltransferase GCN5 0.9621 3 167 GO:0016747
AF-A0A0Q4FU30-F1-model_v4 Acetyltransferase 0.9595 2 170 GO:0016747

Map