F457787

General Info

Members Datasets Scaffolds Average Seq Length
514 265 492 327

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0222954|Ga0501038_0222954_237_1415
Length 392
Sequence MAVATTGKVASSASNSAGWFRVAPRRVDVVAIPTVYPATQRGSRRRAVARHVEATDHIPGVNAPRGGQAWGVTTIGYHASHEQHAPSALLDAARAAADAGFGAVSSSDHLTPWSHHQGESGFAWSWLGAAMQAVPLPFGVVNAPGQRYHPVIIAQAIATLAEMHPDRLWVALGSGEASNEHVTGDPWPSKPVRNARLAECVDVIRALLRGEEVSLDGHVRVDRARLWTLPASPPPLIGAALSEETAAWCGGWADGLITVHMPPPQLRKVIDAFRGAGGEGKPVNVQVKVAWAPTEEEALAGAYEQWRTNVFDSVLMADLETVEQFEAAATHVRPEDMHRSVLVSADPKQHAAWLSETLDLGVDGLYVHQVPREQMRFIDTFGTAVLPEVAGR

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221591 Devosia sp. Root685 Isolate Unclassified
4 2643221597 Microbacterium sp. Root180 Isolate Unclassified
5 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
6 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
7 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
8 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
9 2808606372 Agromyces sp. 23-23 Isolate Unclassified
10 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
11 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
12 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
13 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
14 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
15 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
16 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
17 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
18 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
19 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
20 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
21 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
22 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
23 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
177 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
182 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
183 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
184 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
188 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
240 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
241 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
242 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0.39
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0.19
Rhizoplane 2.72
Rhizosphere 92.8
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005162 3300001976 Bacteria 1709
2 JGI24751J29686_10007047 3300002459 Bacteria 2297
3 JGI24751J29686_10007441 3300002459 Bacteria 2236
4 JGI25406J46586_10006602 3300003203 Bacteria 5332
5 JGI25406J46586_10014143 3300003203 Bacteria 3402
6 rootL2_10371810 3300003322 Bacteria 3120
7 rootH1_10044876 3300003323 Bacteria 4281
8 JGI25407J50210_10003344 3300003373 Bacteria 3824
9 Ga0070658_10004808 3300005327 Bacteria 10996
10 Ga0070658_10049687 3300005327 Bacteria 3398
11 Ga0070670_100006468 3300005331 Bacteria 9917
12 Ga0068869_100030782 3300005334 Bacteria 3770
13 Ga0068869_100101681 3300005334 Bacteria 2175
14 Ga0070680_100084628 3300005336 Bacteria 2619
15 Ga0070682_100008206 3300005337 Bacteria 5888
16 Ga0070660_100017304 3300005339 Bacteria 5252
17 Ga0070660_100254358 3300005339 Bacteria 1433
18 Ga0070689_100090432 3300005340 Bacteria 2412
19 Ga0070691_10033354 3300005341 Bacteria 2423
20 Ga0070661_100011097 3300005344 Bacteria 6274
21 Ga0070692_10014199 3300005345 Bacteria 3733
22 Ga0070668_100009199 3300005347 Bacteria 7325
23 Ga0070669_100486580 3300005353 Bacteria 1022
24 Ga0070675_100042819 3300005354 Bacteria 3700
25 Ga0070671_100001679 3300005355 Bacteria 16767
26 Ga0070673_100179565 3300005364 Bacteria 1811
27 Ga0070659_100084043 3300005366 Bacteria 2545
28 Ga0070659_100128165 3300005366 Bacteria 2059
29 Ga0070709_10041745 3300005434 Bacteria 2828
30 Ga0070713_100398057 3300005436 Bacteria 1286
31 Ga0070663_100002235 3300005455 Bacteria 10838
32 Ga0070663_100147323 3300005455 Bacteria 1802
33 Ga0070678_100000846 3300005456 Bacteria 15566
34 Ga0070678_100024915 3300005456 Bacteria 4015
35 Ga0070662_100050495 3300005457 Bacteria 3000
36 Ga0070681_10012597 3300005458 Bacteria 8391
37 Ga0070681_10021515 3300005458 Bacteria 6464
38 Ga0068867_100027883 3300005459 Bacteria 4063
39 Ga0070679_100046890 3300005530 Bacteria 4308
40 Ga0070679_100126673 3300005530 Bacteria 2536
41 Ga0068853_100189286 3300005539 Bacteria 1869
42 Ga0070672_100013141 3300005543 Bacteria 5837
43 Ga0070693_100001364 3300005547 Bacteria 10994
44 Ga0070665_100118167 3300005548 Bacteria 2654
45 Ga0068856_100016690 3300005614 Bacteria 7111
46 Ga0070702_100002984 3300005615 Bacteria 7477
47 Ga0068852_100004880 3300005616 Bacteria 9524
48 Ga0068859_100236966 3300005617 Bacteria 1914
49 Ga0068864_100105451 3300005618 Bacteria 2505
50 Ga0068864_100247026 3300005618 Bacteria 1655
51 Ga0068861_100058292 3300005719 Bacteria 2952
52 Ga0068861_100137827 3300005719 Bacteria 1988
53 Ga0068851_10036352 3300005834 Bacteria 2465
54 Ga0068870_10001943 3300005840 Bacteria 8533
55 Ga0068863_100007205 3300005841 Bacteria 10908
56 Ga0068858_100040824 3300005842 Bacteria 4304
57 Ga0068860_100083201 3300005843 Bacteria 3043
58 Ga0081455_10001186 3300005937 Bacteria 32652
59 Ga0081538_10000159 3300005981 Bacteria 71002
60 Ga0081538_10001679 3300005981 Bacteria 22560
61 Ga0081538_10002555 3300005981 Bacteria 17691
62 Ga0081538_10003631 3300005981 Bacteria 14503
63 Ga0081538_10009601 3300005981 Bacteria 8050
64 Ga0081538_10011805 3300005981 Bacteria 7051
65 Ga0081538_10011882 3300005981 Bacteria 7029
66 Ga0081538_10016472 3300005981 Bacteria 5663
67 Ga0081538_10016846 3300005981 Bacteria 5579
68 Ga0081538_10022929 3300005981 Bacteria 4504
69 Ga0081538_10032442 3300005981 Bacteria 3499
70 Ga0081538_10033475 3300005981 Bacteria 3419
71 Ga0081538_10034970 3300005981 Bacteria 3310
72 Ga0081538_10093050 3300005981 Bacteria 1550
73 Ga0081540_1070840 3300005983 Bacteria 1613
74 Ga0081539_10003627 3300005985 Bacteria 18601
75 Ga0081539_10019124 3300005985 Bacteria 4705
76 Ga0075365_10035294 3300006038 Bacteria 3234
77 Ga0075364_10107769 3300006051 Bacteria 1857
78 Ga0070712_100087631 3300006175 Bacteria 2272
79 Ga0075362_10028417 3300006177 Bacteria 2402
80 Ga0075427_10004850 3300006194 Bacteria 1901
81 Ga0097621_100029087 3300006237 Bacteria 4361
82 Ga0068871_100016001 3300006358 Bacteria 5635
83 Ga0075428_100006324 3300006844 Bacteria 13173
84 Ga0075428_100020408 3300006844 Bacteria 7335
85 Ga0075428_100095324 3300006844 Bacteria 3244
86 Ga0075430_100001158 3300006846 Bacteria 21065
87 Ga0075430_100003392 3300006846 Bacteria 13317
88 Ga0075430_100030902 3300006846 Bacteria 4548
89 Ga0075430_100045756 3300006846 Bacteria 3696
90 Ga0075430_100094159 3300006846 Bacteria 2504
91 Ga0075430_100190328 3300006846 Bacteria 1705
92 Ga0075431_100000163 3300006847 Bacteria 46879
93 Ga0075431_100001604 3300006847 Bacteria 21088
94 Ga0075431_100040871 3300006847 Bacteria 4781
95 Ga0075431_100044551 3300006847 Bacteria 4576
96 Ga0075431_100054096 3300006847 Bacteria 4139
97 Ga0075431_100098356 3300006847 Bacteria 3021
98 Ga0075431_100584627 3300006847 Bacteria 1102
99 Ga0075433_10002124 3300006852 Bacteria 15023
100 Ga0075433_10062838 3300006852 Bacteria 3252
101 Ga0075434_100002008 3300006871 Bacteria 17660
102 Ga0075434_100055566 3300006871 Bacteria 3934
103 Ga0075429_100000254 3300006880 Bacteria 36852
104 Ga0075429_100000497 3300006880 Bacteria 29520
105 Ga0075429_100057533 3300006880 Bacteria 3385
106 Ga0075429_100145904 3300006880 Bacteria 2071
107 Ga0075429_100178359 3300006880 Bacteria 1862
108 Ga0075436_100007935 3300006914 Bacteria 7269
109 Ga0097620_100236966 3300006931 Bacteria 1914
110 Ga0075435_100008757 3300007076 Bacteria 7283
111 Ga0105251_10017291 3300009011 Bacteria 3869
112 Ga0111539_10000330 3300009094 Bacteria 57989
113 Ga0111539_10003715 3300009094 Bacteria 20083
114 Ga0111539_10038253 3300009094 Bacteria 5787
115 Ga0111539_10436719 3300009094 Bacteria 1524
116 Ga0105245_10202691 3300009098 Bacteria 1906
117 Ga0105245_10224025 3300009098 Bacteria 1816
118 Ga0105247_10008710 3300009101 Bacteria 6185
119 Ga0114129_10001223 3300009147 Bacteria 34118
120 Ga0114129_10254519 3300009147 Bacteria 2356
121 Ga0105248_10192476 3300009177 Bacteria 2298
122 Ga0105237_10058756 3300009545 Bacteria 3849
123 Ga0105238_10286548 3300009551 Bacteria 1629
124 Ga0105238_10317408 3300009551 Bacteria 1544
125 Ga0105249_10394027 3300009553 Bacteria 1414
126 Ga0105239_10423109 3300010375 Bacteria 1509
127 Ga0105246_10007819 3300011119 Bacteria 6560
128 Ga0157371_10015180 3300013102 Bacteria 5784
129 Ga0157370_10140918 3300013104 Bacteria 2246
130 Ga0157369_10180040 3300013105 Bacteria 2224
131 Ga0157374_10040037 3300013296 Bacteria 4315
132 Ga0163162_10254296 3300013306 Bacteria 1889
133 Ga0163162_10305070 3300013306 Bacteria 1724
134 Ga0157372_10296365 3300013307 Bacteria 1881
135 Ga0163163_10128494 3300014325 Bacteria 2573
136 Ga0157377_10032178 3300014745 Bacteria 2855
137 Ga0157379_10064004 3300014968 Bacteria 3287
138 Ga0163161_10141783 3300017792 Bacteria 1820
139 Ga0206356_11782896 3300020070 Bacteria 1831
140 Ga0207656_10013733 3300025321 Bacteria 3102
141 Ga0207642_10132512 3300025899 Bacteria 1303
142 Ga0207710_10034858 3300025900 Bacteria 2213
143 Ga0207688_10001857 3300025901 Bacteria 11304
144 Ga0207699_10176934 3300025906 Bacteria 1431
145 Ga0207643_10000303 3300025908 Bacteria 34008
146 Ga0207705_10051559 3300025909 Bacteria 2962
147 Ga0207654_10002643 3300025911 Bacteria 9094
148 Ga0207707_10009802 3300025912 Bacteria 8308
149 Ga0207707_10014794 3300025912 Bacteria 6797
150 Ga0207693_10110229 3300025915 Bacteria 2158
151 Ga0207660_10006599 3300025917 Bacteria 7529
152 Ga0207657_10022052 3300025919 Bacteria 5977
153 Ga0207649_10001239 3300025920 Bacteria 15276
154 Ga0207652_10015871 3300025921 Bacteria 6137
155 Ga0207694_10058334 3300025924 Bacteria 3002
156 Ga0207650_10027454 3300025925 Bacteria 4075
157 Ga0207659_10004295 3300025926 Bacteria 8615
158 Ga0207687_10022811 3300025927 Bacteria 4169
159 Ga0207700_10123055 3300025928 Bacteria 2106
160 Ga0207644_10005696 3300025931 Bacteria 8108
161 Ga0207690_10076854 3300025932 Bacteria 2319
162 Ga0207706_10005109 3300025933 Bacteria 12250
163 Ga0207706_10033400 3300025933 Bacteria 4580
164 Ga0207706_10064085 3300025933 Bacteria 3236
165 Ga0207709_10365656 3300025935 Bacteria 1093
166 Ga0207670_10060998 3300025936 Bacteria 2572
167 Ga0207691_10031671 3300025940 Bacteria 4934
168 Ga0207691_10389616 3300025940 Bacteria 1189
169 Ga0207711_10074193 3300025941 Bacteria 2958
170 Ga0207689_10013427 3300025942 Bacteria 6993
171 Ga0207667_10148162 3300025949 Bacteria 2416
172 Ga0207651_10151833 3300025960 Bacteria 1804
173 Ga0207712_10094367 3300025961 Bacteria 2210
174 Ga0207712_10300736 3300025961 Bacteria 1316
175 Ga0207668_10092107 3300025972 Bacteria 2230
176 Ga0207677_10011463 3300026023 Bacteria 5059
177 Ga0207703_10007724 3300026035 Bacteria 8513
178 Ga0207678_10002679 3300026067 Bacteria 16163
179 Ga0207708_10009905 3300026075 Bacteria 7076
180 Ga0207702_10001526 3300026078 Bacteria 22913
181 Ga0207702_10003376 3300026078 Bacteria 14632
182 Ga0207641_10018873 3300026088 Bacteria 5657
183 Ga0207676_10008983 3300026095 Bacteria 7109
184 Ga0207675_100086173 3300026118 Bacteria 2949
185 Ga0207675_100104726 3300026118 Bacteria 2666
186 Ga0207675_100360364 3300026118 Bacteria 1426
187 Ga0207683_10013397 3300026121 Bacteria 6992
188 Ga0207683_10135819 3300026121 Bacteria 2214
189 Ga0207698_10015364 3300026142 Bacteria 5124
190 Ga0207428_10005135 3300027907 Bacteria 12264
191 Ga0207428_10014226 3300027907 Bacteria 6923
192 Ga0207428_10075576 3300027907 Bacteria 2639
193 Ga0268266_10031981 3300028379 Bacteria 4471
194 Ga0268264_10043473 3300028381 Bacteria 3723
195 Ga0307408_100034519 3300031548 Bacteria 3543
196 Ga0307408_100049789 3300031548 Bacteria 3010
197 Ga0307408_100159906 3300031548 Bacteria 1788
198 Ga0307408_100309379 3300031548 Bacteria 1327
199 Ga0307408_100413559 3300031548 Bacteria 1161
200 Ga0307405_10003381 3300031731 Bacteria 7318
201 Ga0307405_10021520 3300031731 Bacteria 3627
202 Ga0307405_10044511 3300031731 Bacteria 2715
203 Ga0307405_10187294 3300031731 Bacteria 1491
204 Ga0307405_10366621 3300031731 Bacteria 1117
205 Ga0307413_10040718 3300031824 Bacteria 2714
206 Ga0307413_10163851 3300031824 Bacteria 1565
207 Ga0307413_10231527 3300031824 Bacteria 1357
208 Ga0307410_10005074 3300031852 Bacteria 6919
209 Ga0307410_10020832 3300031852 Bacteria 4021
210 Ga0307410_10056828 3300031852 Bacteria 2662
211 Ga0307410_10105134 3300031852 Bacteria 2031
212 Ga0307410_10114744 3300031852 Bacteria 1955
213 Ga0307410_10151891 3300031852 Bacteria 1725
214 Ga0307406_10000182 3300031901 Bacteria 37749
215 Ga0307406_10001096 3300031901 Bacteria 15088
216 Ga0307406_10004047 3300031901 Bacteria 7975
217 Ga0307406_10030204 3300031901 Bacteria 3288
218 Ga0307406_10033642 3300031901 Bacteria 3139
219 Ga0307406_10131268 3300031901 Bacteria 1759
220 Ga0307406_10199357 3300031901 Bacteria 1472
221 Ga0307406_10201743 3300031901 Bacteria 1464
222 Ga0307407_10000396 3300031903 Bacteria 13225
223 Ga0307407_10002771 3300031903 Bacteria 6981
224 Ga0307407_10027984 3300031903 Bacteria 3007
225 Ga0307407_10038188 3300031903 Unclassified 2659
226 Ga0307407_10070380 3300031903 Bacteria 2079
227 Ga0307407_10096712 3300031903 Bacteria 1823
228 Ga0307407_10240153 3300031903 Bacteria 1235
229 Ga0307412_10002748 3300031911 Bacteria 9783
230 Ga0307412_10006453 3300031911 Bacteria 6631
231 Ga0307412_10148816 3300031911 Unclassified 1725
232 Ga0307412_10252057 3300031911 Unclassified 1371
233 Ga0307409_100000121 3300031995 Bacteria 29222
234 Ga0307409_100007120 3300031995 Bacteria 6658
235 Ga0307409_100017268 3300031995 Bacteria 4804
236 Ga0307409_100021212 3300031995 Bacteria 4449
237 Ga0307409_100026567 3300031995 Bacteria 4085
238 Ga0307409_100056823 3300031995 Bacteria 3028
239 Ga0307409_100089459 3300031995 Bacteria 2517
240 Ga0307409_100104802 3300031995 Bacteria 2356
241 Ga0307409_100114330 3300031995 Unclassified 2270
242 Ga0307409_100169530 3300031995 Bacteria 1920
243 Ga0307409_100391852 3300031995 Bacteria 1324
244 Ga0307409_100444152 3300031995 Bacteria 1250
245 Ga0307416_100000478 3300032002 Bacteria 20461
246 Ga0307416_100005701 3300032002 Bacteria 7699
247 Ga0307416_100005759 3300032002 Bacteria 7673
248 Ga0307416_100079903 3300032002 Bacteria 2758
249 Ga0307416_100155102 3300032002 Unclassified 2107
250 Ga0307416_100191620 3300032002 Bacteria 1929
251 Ga0307416_100243734 3300032002 Bacteria 1744
252 Ga0307414_10000016 3300032004 Bacteria 249029
253 Ga0307414_10009128 3300032004 Bacteria 5679
254 Ga0307414_10051706 3300032004 Bacteria 2854
255 Ga0307414_10090473 3300032004 Bacteria 2271
256 Ga0307411_10025573 3300032005 Bacteria 3540
257 Ga0307411_10033811 3300032005 Bacteria 3175
258 Ga0307411_10060974 3300032005 Bacteria 2508
259 Ga0307411_10061618 3300032005 Bacteria 2498
260 Ga0307415_100000395 3300032126 Bacteria 18567
261 Ga0307415_100005953 3300032126 Bacteria 6534
262 Ga0307415_100006150 3300032126 Bacteria 6442
263 Ga0307415_100007484 3300032126 Bacteria 5977
264 Ga0307415_100036862 3300032126 Bacteria 3209
265 Ga0307415_100111279 3300032126 Bacteria 2032
266 Ga0307415_100175734 3300032126 Bacteria 1675
267 Ga0307415_100396685 3300032126 Bacteria 1176
268 Ga0307415_100496697 3300032126 Bacteria 1066
269 Ga0373925_0052589 3300037068 Bacteria 3044
270 Ga0436364_1103951 3300037853 Bacteria 1621
271 Ga0439438_034394 3300041405 Bacteria 1335
272 Ga0439439_0010125 3300041406 Bacteria 2252
273 Ga0451791_1784313 3300041451 Bacteria 8012
274 Ga0451793_0091432 3300041452 Bacteria 15713
275 Ga0451797_1043473 3300041453 Bacteria 1935
276 Ga0451833_1453543 3300041491 Bacteria 1194
277 Ga0439448_0007189 3300042005 Bacteria 3219
278 Ga0439449_0013711 3300042007 Unclassified 3050
279 Ga0439450_001309 3300042008 Bacteria 3617
280 Ga0439454_005082 3300042011 Bacteria 1554
281 Ga0439455_0001504 3300042012 Bacteria 3920
282 Ga0439455_0005964 3300042012 Bacteria 2504
283 Ga0439457_008515 3300042014 Bacteria 2415
284 Ga0439463_000662 3300042016 Bacteria 9553
285 Ga0439463_017989 3300042016 Bacteria 1757
286 Ga0450911_000004 3300042115 Bacteria 234537
287 Ga0450902_008273 3300042137 Bacteria 1622
288 Ga0450904_000009 3300042139 Bacteria 43388
289 Ga0450905_008787 3300042142 Bacteria 1385
290 Ga0439446_0037033 3300042156 Bacteria 1427
291 Ga0439458_0014839 3300042157 Bacteria 1761
292 Ga0439444_0000228 3300042437 Bacteria 5469
293 Ga0439459_0002478 3300042438 Bacteria 2849
294 Ga0439464_0001642 3300042439 Bacteria 5337
295 Ga0439460_0004344 3300042461 Bacteria 3455
296 Ga0439460_0008091 3300042461 Bacteria 2650
297 Ga0450893_0000710 3300042532 Bacteria 4846
298 Ga0439440_0000041 3300042993 Bacteria 16365
299 Ga0439440_0008697 3300042993 Bacteria 2089
300 Ga0466965_0000016 3300044683 Bacteria 81402
301 Ga0466968_0004494 3300044735 Bacteria 5216
302 Ga0466960_0091875 3300044901 Bacteria 1549
303 Ga0495598_0015832 3300046537 Bacteria 1912
304 Ga0495609_0105315 3300046538 Bacteria 1220
305 Ga0495656_0008492 3300046615 Bacteria 3668
306 Ga0495668_0094489 3300046616 Bacteria 1637
307 Ga0495659_0039787 3300046664 Bacteria 1673
308 Ga0495670_0078265 3300046691 Bacteria 1682
309 Ga0496102_0003202 3300048905 Bacteria 13884
310 Ga0496104_0011560 3300048907 Bacteria 7909
311 Ga0496105_0013054 3300048908 Bacteria 6584
312 Ga0496106_0013259 3300048909 Bacteria 6084
313 Ga0496107_0038164 3300048910 Bacteria 3447
314 Ga0496108_0080726 3300048911 Bacteria 2755
315 Ga0496110_0006041 3300048913 Bacteria 9541
316 Ga0496111_0011925 3300048914 Bacteria 5873
317 Ga0496112_0098358 3300048915 Bacteria 2895
318 Ga0496113_0018179 3300048916 Bacteria 4893
319 Ga0496113_0373834 3300048916 Bacteria 1144
320 Ga0496121_0102692 3300048924 Bacteria 2202
321 Ga0496124_0100029 3300048927 Bacteria 2351
322 Ga0496125_0004114 3300048928 Bacteria 16993
323 Ga0501031_0006615 3300049568 Bacteria 7561
324 Ga0501031_0031275 3300049568 Bacteria 3472
325 Ga0501031_0040930 3300049568 Bacteria 3025
326 Ga0501031_0098184 3300049568 Bacteria 1911
327 Ga0501032_0038559 3300049569 Bacteria 3254
328 Ga0501033_0018509 3300049570 Bacteria 5263
329 Ga0501033_0039509 3300049570 Bacteria 3524
330 Ga0501033_0080121 3300049570 Bacteria 2396
331 Ga0501034_0216177 3300049571 Bacteria 1871
332 Ga0501036_0014898 3300049572 Bacteria 6486
333 Ga0501036_0066826 3300049572 Bacteria 3042
334 Ga0501036_0076915 3300049572 Bacteria 2824
335 Ga0501037_0072516 3300049573 Bacteria 2504
336 Ga0501038_0000903 3300049574 Bacteria 26297
337 Ga0501038_0222954 3300049574 Bacteria 1503
338 Ga0501039_0002734 3300049575 Bacteria 13146
339 Ga0501039_0006861 3300049575 Bacteria 8663
340 Ga0501039_0010539 3300049575 Bacteria 7045
341 Ga0501039_0017669 3300049575 Bacteria 5471
342 Ga0501039_0142089 3300049575 Bacteria 1885
343 Ga0501039_0240938 3300049575 Bacteria 1422
344 Ga0501039_0297556 3300049575 Bacteria 1269
345 Ga0501040_0000259 3300049576 Bacteria 30940
346 Ga0501040_0000289 3300049576 Archaea 29356
347 Ga0501040_0000413 3300049576 Bacteria 25285
348 Ga0501040_0004064 3300049576 Bacteria 9512
349 Ga0501040_0011323 3300049576 Bacteria 5837
350 Ga0501040_0027258 3300049576 Bacteria 3845
351 Ga0501040_0259534 3300049576 Bacteria 1240
352 Ga0501041_0000491 3300049577 Bacteria 20231
353 Ga0501041_0002085 3300049577 Bacteria 11251
354 Ga0501041_0002421 3300049577 Bacteria 10579
355 Ga0501041_0023541 3300049577 Bacteria 3693
356 Ga0501042_0001520 3300049578 Bacteria 13731
357 Ga0501042_0001939 3300049578 Bacteria 12456
358 Ga0501042_0015258 3300049578 Bacteria 5258
359 Ga0501043_0007901 3300049579 Bacteria 8407
360 Ga0501043_0015672 3300049579 Bacteria 5941
361 Ga0501043_0073543 3300049579 Bacteria 2685
362 Ga0501043_0074217 3300049579 Bacteria 2672
363 Ga0501046_0000593 3300049580 Bacteria 35586
364 Ga0501046_0000713 3300049580 Bacteria 32092
365 Ga0501046_0015044 3300049580 Bacteria 6508
366 Ga0501046_0019779 3300049580 Bacteria 5578
367 Ga0501046_0251381 3300049580 Bacteria 1301
368 Ga0501048_0001388 3300049582 Bacteria 18356
369 Ga0501048_0002303 3300049582 Bacteria 14567
370 Ga0501048_0091794 3300049582 Bacteria 2142
371 Ga0501048_0130904 3300049582 Bacteria 1774
372 Ga0501068_0007079 3300049584 Bacteria 6211
373 Ga0501068_0009763 3300049584 Bacteria 5375
374 Ga0501068_0128203 3300049584 Bacteria 1585
375 Ga0501069_0044365 3300049585 Bacteria 2461
376 Ga0501070_0088959 3300049586 Bacteria 2556
377 Ga0501071_0001614 3300049587 Bacteria 13232
378 Ga0501071_0017040 3300049587 Bacteria 5004
379 Ga0501071_0033188 3300049587 Bacteria 3668
380 Ga0501071_0065922 3300049587 Bacteria 2630
381 Ga0501071_0121576 3300049587 Bacteria 1935
382 Ga0501072_0000321 3300049588 Bacteria 34135
383 Ga0501072_0006976 3300049588 Bacteria 8573
384 Ga0501072_0012113 3300049588 Bacteria 6587
385 Ga0501072_0017839 3300049588 Bacteria 5458
386 Ga0501072_0248690 3300049588 Bacteria 1416
387 Ga0501073_0118018 3300049589 Bacteria 1839
388 Ga0501073_0209225 3300049589 Bacteria 1348
389 Ga0501074_0003450 3300049590 Bacteria 11218
390 Ga0501074_0018097 3300049590 Bacteria 5118
391 Ga0501074_0048159 3300049590 Bacteria 3079
392 Ga0501074_0111870 3300049590 Bacteria 1953
393 Ga0501074_0306208 3300049590 Bacteria 1129
394 Ga0501075_0000060 3300049591 Bacteria 46743
395 Ga0501075_0000854 3300049591 Bacteria 19222
396 Ga0501075_0054251 3300049591 Bacteria 3015
397 Ga0501075_0139733 3300049591 Bacteria 1845
398 Ga0501075_0191368 3300049591 Bacteria 1560
399 Ga0501075_0272072 3300049591 Bacteria 1291
400 Ga0501076_0001606 3300049592 Bacteria 15222
401 Ga0501076_0005410 3300049592 Bacteria 9180
402 Ga0501076_0145072 3300049592 Bacteria 1930
403 Ga0501076_0204328 3300049592 Bacteria 1613
404 Ga0501076_0324196 3300049592 Bacteria 1263
405 Ga0501076_0327479 3300049592 Bacteria 1257
406 Ga0501077_0000411 3300049593 Bacteria 25913
407 Ga0501077_0004246 3300049593 Bacteria 8659
408 Ga0501077_0006912 3300049593 Bacteria 6988
409 Ga0501077_0034105 3300049593 Bacteria 3239
410 Ga0501077_0036972 3300049593 Bacteria 3110
411 Ga0501202_022756 3300049652 Bacteria 1261
412 Ga0501207_010173 3300049654 Bacteria 1384
413 Ga0501236_001950 3300049670 Bacteria 2361
414 Ga0501257_000595 3300049686 Bacteria 7153
415 Ga0501079_0000050 3300049741 Bacteria 51670
416 Ga0501079_0000169 3300049741 Bacteria 36466
417 Ga0501079_0065264 3300049741 Bacteria 2808
418 Ga0501079_0081329 3300049741 Bacteria 2505
419 Ga0501080_0046817 3300049742 Bacteria 4026
420 Ga0501080_0053811 3300049742 Bacteria 3749
421 Ga0501080_0109599 3300049742 Bacteria 2559
422 Ga0501080_0173741 3300049742 Bacteria 1986
423 Ga0501081_0000098 3300049743 Bacteria 36248
424 Ga0501081_0016218 3300049743 Bacteria 4922
425 Ga0501081_0023494 3300049743 Bacteria 4132
426 Ga0501083_0026494 3300049744 Bacteria 4007
427 Ga0501083_0073563 3300049744 Bacteria 2272
428 Ga0501264_000632 3300049761 Bacteria 4939
429 Ga0501035_0003125 3300049822 Bacteria 15897
430 Ga0501035_0019636 3300049822 Bacteria 6210
431 Ga0501035_0121933 3300049822 Bacteria 2278
432 Ga0501035_0135651 3300049822 Bacteria 2143
433 Ga0501035_0245450 3300049822 Bacteria 1522
434 Ga0501035_0323467 3300049822 Bacteria 1295
435 Ga0501045_0000051 3300049824 Bacteria 51695
436 Ga0501045_0000786 3300049824 Bacteria 20411
437 Ga0501045_0044855 3300049824 Bacteria 3220
438 Ga0501045_0045042 3300049824 Bacteria 3212
439 Ga0501045_0155702 3300049824 Bacteria 1700
440 Ga0501045_0158224 3300049824 Bacteria 1686
441 nmdc:mga0yw44_870_c1 3300050492 Bacteria 11341
442 nmdc:mga05p37_121374_c1 3300050507 Bacteria 3210
443 nmdc:mga05p37_211152_c1 3300050507 Bacteria 2346
444 nmdc:mga05p37_44841_c1 3300050507 Bacteria 5440
445 nmdc:mga05p37_472_c1 3300050507 Bacteria 43873
446 nmdc:mga09592_113_c1 3300050508 Bacteria 50843
447 nmdc:mga09592_278700_c1 3300050508 Bacteria 1450
448 nmdc:mga09592_347_c1 3300050508 Bacteria 33931
449 nmdc:mga0qj67_19813_c1 3300050509 Bacteria 5145
450 nmdc:mga0qj67_24983_c1 3300050509 Bacteria 4610
451 nmdc:mga0qj67_277_c1 3300050509 Bacteria 35629
452 nmdc:mga0qj67_42276_c1 3300050509 Bacteria 3587
453 nmdc:mga06r32_22126_c1 3300050510 Bacteria 5874
454 nmdc:mga06r32_387043_c1 3300050510 Bacteria 1381
455 nmdc:mga06r32_42628_c1 3300050510 Bacteria 4316
456 nmdc:mga06r32_458945_c1 3300050510 Bacteria 1253
457 nmdc:mga06r32_46_c1 3300050510 Bacteria 75219
458 nmdc:mga06r32_492821_c1 3300050510 Bacteria 1203
459 nmdc:mga06r32_49921_c1 3300050510 Bacteria 4003
460 nmdc:mga06r32_7049_c1 3300050510 Bacteria 10110
461 nmdc:mga06r32_979_c1 3300050510 Bacteria 25585
462 nmdc:mga08y16_64131_c1 3300050511 Bacteria 3837
463 nmdc:mga08y16_64805_c1 3300050511 Bacteria 3815
464 nmdc:mga08y16_71174_c1 3300050511 Bacteria 3625
465 nmdc:mga0n895_336630_c1 3300050512 Bacteria 1529
466 nmdc:mga0a205_5082_c1 3300050515 Bacteria 11830
467 nmdc:mga0a205_6489_c1 3300050515 Bacteria 10577
468 Ga0500568_0000089 3300053139 Bacteria 86660
469 Ga0500568_0000596 3300053139 Bacteria 26228
470 Ga0501084_0001594 3300054114 Bacteria 17956
471 Ga0501084_0005291 3300054114 Bacteria 10562
472 Ga0501084_0006102 3300054114 Bacteria 9907
473 Ga0501084_0013193 3300054114 Bacteria 6836
474 Ga0501084_0049838 3300054114 Bacteria 3505
475 Ga0590071_001827 3300059421 Bacteria 5495
476 Ga0590074_009376 3300059423 Bacteria 1631
477 Ga0590074_010988 3300059423 Bacteria 1516
478 Ga0590077_029536 3300059426 Bacteria 1193
479 Ga0587128_005987 3300059630 Bacteria 1478
480 Ga0501082_0001366 3300060353 Bacteria 21459
481 Ga0501082_0001871 3300060353 Bacteria 18521
482 Ga0501082_0017006 3300060353 Bacteria 6263
483 Ga0501082_0051747 3300060353 Bacteria 3540
484 Ga0501082_0092215 3300060353 Bacteria 2617
485 Ga0501082_0101807 3300060353 Bacteria 2485
486 Ga0530510_0000555 3300061734 Bacteria 24109
487 Ga0530510_0007972 3300061734 Bacteria 7387
488 Ga0530510_0009052 3300061734 Bacteria 6980
489 Ga0530510_0102745 3300061734 Bacteria 2090
490 Ga0530510_0209604 3300061734 Bacteria 1448
491 Ga0530510_0219405 3300061734 Bacteria 1413
492 Ga0530510_0263873 3300061734 Bacteria 1285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0100029 Ga0496124_0100029_125_904 257
2 3300049654 Ga0501207_010173 Ga0501207_010173_348_1154 266
3 3300025933 Ga0207706_10033400 Ga0207706_100334003 298
4 3300005539 Ga0068853_100189286 Ga0068853_1001892862 306
5 3300032002 Ga0307416_100243734 Ga0307416_1002437342 312
6 3300049576 Ga0501040_0000289 Ga0501040_0000289_16386_17363 312
7 iso_pu_bacteria 2643221591 2643963764 312
8 3300005981 Ga0081538_10000159 Ga0081538_1000015940 313
9 3300005981 Ga0081538_10022929 Ga0081538_100229292 313
10 3300031548 Ga0307408_100049789 Ga0307408_1000497892 313
11 3300031824 Ga0307413_10163851 Ga0307413_101638512 313
12 3300031901 Ga0307406_10033642 Ga0307406_100336422 313
13 3300031903 Ga0307407_10240153 Ga0307407_102401531 313
14 3300032005 Ga0307411_10060974 Ga0307411_100609742 313
15 3300032126 Ga0307415_100007484 Ga0307415_1000074842 313
16 3300032126 Ga0307415_100175734 Ga0307415_1001757342 313
17 iso_pu_bacteria 2911138879 2911141734 314
18 3300005981 Ga0081538_10032442 Ga0081538_100324422 315
19 3300006051 Ga0075364_10107769 Ga0075364_101077692 315
20 3300032126 Ga0307415_100036862 Ga0307415_1000368624 315
21 3300042007 Ga0439449_0013711 Ga0439449_0013711_1969_2925 315
22 iso_pu_bacteria 2839989709 2839990702 315
23 iso_pu_bacteria 2857737099 2857739424 315
24 iso_pu_bacteria 2919692658 2919692852 315
25 iso_pu_bacteria 2935847175 2935853549 315
26 3300005719 Ga0068861_100137827 Ga0068861_1001378272 316
27 3300005981 Ga0081538_10001679 Ga0081538_100016794 316
28 3300009094 Ga0111539_10436719 Ga0111539_104367192 316
29 3300025899 Ga0207642_10132512 Ga0207642_101325122 316
30 3300025935 Ga0207709_10365656 Ga0207709_103656561 316
31 3300026075 Ga0207708_10009905 Ga0207708_100099056 316
32 3300026118 Ga0207675_100104726 Ga0207675_1001047262 316
33 3300031995 Ga0307409_100391852 Ga0307409_1003918521 316
34 3300032005 Ga0307411_10033811 Ga0307411_100338113 316
35 3300041405 Ga0439438_034394 Ga0439438_034394_189_1145 316
36 3300041406 Ga0439439_0010125 Ga0439439_0010125_1228_2184 316
37 3300042011 Ga0439454_005082 Ga0439454_005082_116_1072 316
38 3300042014 Ga0439457_008515 Ga0439457_008515_1035_1991 316
39 3300042157 Ga0439458_0014839 Ga0439458_0014839_19_1023 316
40 3300048924 Ga0496121_0102692 Ga0496121_0102692_697_1653 316
41 3300048928 Ga0496125_0004114 Ga0496125_0004114_6469_7425 316
42 3300049592 Ga0501076_0327479 Ga0501076_0327479_208_1164 316
43 iso_pu_bacteria 2643221566 2643846634 316
44 iso_pu_bacteria 2643221597 2643996706 316
45 iso_pu_bacteria 2643221724 2644680856 316
46 iso_pu_bacteria 2721755702 2723641746 316
47 iso_pu_bacteria 2728369380 2730230737 316
48 iso_pu_bacteria 2808606372 2808901738 316
49 iso_pu_bacteria 2834578030 2834578641 316
50 iso_pu_bacteria 2852646457 2852648331 316
51 iso_pu_bacteria 2882806704 2882806963 316
52 iso_pu_bacteria 2917554339 2917557120 316
53 iso_pu_bacteria 2919443155 2919446508 316
54 iso_pu_bacteria 2935409751 2935411155 316
55 iso_pu_bacteria 2945968032 2945970418 316
56 iso_pu_bacteria 2946080515 2946080910 316
57 3300005327 Ga0070658_10004808 Ga0070658_100048085 317
58 3300005339 Ga0070660_100254358 Ga0070660_1002543582 317
59 3300005366 Ga0070659_100084043 Ga0070659_1000840432 317
60 3300031731 Ga0307405_10044511 Ga0307405_100445112 317
61 3300031731 Ga0307405_10366621 Ga0307405_103666211 317
62 3300031824 Ga0307413_10040718 Ga0307413_100407182 317
63 3300031852 Ga0307410_10105134 Ga0307410_101051342 317
64 3300031901 Ga0307406_10030204 Ga0307406_100302042 317
65 3300031903 Ga0307407_10027984 Ga0307407_100279843 317
66 3300031995 Ga0307409_100104802 Ga0307409_1001048022 317
67 3300032002 Ga0307416_100079903 Ga0307416_1000799032 317
68 3300032126 Ga0307415_100006150 Ga0307415_1000061506 317
69 3300042012 Ga0439455_0005964 Ga0439455_0005964_406_1365 317
70 3300042115 Ga0450911_000004 Ga0450911_000004_214345_215304 317
71 3300042139 Ga0450904_000009 Ga0450904_000009_13369_14328 317
72 3300042156 Ga0439446_0037033 Ga0439446_0037033_259_1218 317
73 3300042438 Ga0439459_0002478 Ga0439459_0002478_553_1512 317
74 3300042532 Ga0450893_0000710 Ga0450893_0000710_1910_2869 317
75 3300049568 Ga0501031_0098184 Ga0501031_0098184_264_1223 317
76 3300049575 Ga0501039_0297556 Ga0501039_0297556_72_1031 317
77 3300049582 Ga0501048_0130904 Ga0501048_0130904_131_1090 317
78 3300059421 Ga0590071_001827 Ga0590071_001827_4074_5051 317
79 3300059423 Ga0590074_009376 Ga0590074_009376_244_1221 317
80 iso_pu_bacteria 2524614857 2526064205 317
81 iso_pu_bacteria 2739367875 2740064724 317
82 3300003373 JGI25407J50210_10003344 JGI25407J50210_100033442 318
83 3300005981 Ga0081538_10003631 Ga0081538_1000363110 318
84 3300006194 Ga0075427_10004850 Ga0075427_100048502 318
85 3300006844 Ga0075428_100020408 Ga0075428_1000204085 318
86 3300006846 Ga0075430_100003392 Ga0075430_1000033925 318
87 3300006852 Ga0075433_10062838 Ga0075433_100628382 318
88 3300006871 Ga0075434_100055566 Ga0075434_1000555664 318
89 3300006880 Ga0075429_100145904 Ga0075429_1001459043 318
90 3300009094 Ga0111539_10038253 Ga0111539_100382532 318
91 3300009147 Ga0114129_10254519 Ga0114129_102545192 318
92 3300027907 Ga0207428_10005135 Ga0207428_100051352 318
93 3300031548 Ga0307408_100034519 Ga0307408_1000345193 318
94 3300031548 Ga0307408_100413559 Ga0307408_1004135591 318
95 3300031731 Ga0307405_10187294 Ga0307405_101872942 318
96 3300031852 Ga0307410_10005074 Ga0307410_100050742 318
97 3300031852 Ga0307410_10114744 Ga0307410_101147442 318
98 3300031901 Ga0307406_10004047 Ga0307406_100040477 318
99 3300031903 Ga0307407_10002771 Ga0307407_100027715 318
100 3300031911 Ga0307412_10006453 Ga0307412_100064536 318
101 3300031995 Ga0307409_100000121 Ga0307409_10000012112 318
102 3300031995 Ga0307409_100056823 Ga0307409_1000568231 318
103 3300031995 Ga0307409_100089459 Ga0307409_1000894592 318
104 3300031995 Ga0307409_100169530 Ga0307409_1001695302 318
105 3300032002 Ga0307416_100005701 Ga0307416_1000057012 318
106 3300032004 Ga0307414_10051706 Ga0307414_100517062 318
107 3300032005 Ga0307411_10061618 Ga0307411_100616182 318
108 3300032126 Ga0307415_100005953 Ga0307415_1000059535 318
109 3300037853 Ga0436364_1103951 Ga0436364_1103951_611_1576 318
110 3300042008 Ga0439450_001309 Ga0439450_001309_988_1956 318
111 3300042012 Ga0439455_0001504 Ga0439455_0001504_1176_2144 318
112 3300042016 Ga0439463_000662 Ga0439463_000662_3848_4816 318
113 3300042137 Ga0450902_008273 Ga0450902_008273_212_1180 318
114 3300042142 Ga0450905_008787 Ga0450905_008787_87_1055 318
115 3300042437 Ga0439444_0000228 Ga0439444_0000228_2870_3838 318
116 3300042439 Ga0439464_0001642 Ga0439464_0001642_2305_3273 318
117 3300042461 Ga0439460_0004344 Ga0439460_0004344_1133_2101 318
118 3300042993 Ga0439440_0000041 Ga0439440_0000041_11887_12855 318
119 3300049576 Ga0501040_0259534 Ga0501040_0259534_144_1106 318
120 3300049582 Ga0501048_0091794 Ga0501048_0091794_786_1748 318
121 3300049584 Ga0501068_0128203 Ga0501068_0128203_468_1496 318
122 3300049588 Ga0501072_0248690 Ga0501072_0248690_75_1037 318
123 3300049591 Ga0501075_0272072 Ga0501075_0272072_205_1203 318
124 3300049742 Ga0501080_0109599 Ga0501080_0109599_1574_2545 318
125 3300049822 Ga0501035_0121933 Ga0501035_0121933_211_1176 318
126 3300049824 Ga0501045_0158224 Ga0501045_0158224_244_1242 318
127 3300050507 nmdc:mga05p37_44841_c1 nmdc:mga05p37_44841_c1_288_1307 318
128 3300050510 nmdc:mga06r32_49921_c1 nmdc:mga06r32_49921_c1_1920_2939 318
129 3300050511 nmdc:mga08y16_64805_c1 nmdc:mga08y16_64805_c1_63_1082 318
130 3300050512 nmdc:mga0n895_336630_c1 nmdc:mga0n895_336630_c1_334_1353 318
131 3300050515 nmdc:mga0a205_6489_c1 nmdc:mga0a205_6489_c1_3712_4731 318
132 3300059630 Ga0587128_005987 Ga0587128_005987_381_1346 318
133 3300003203 JGI25406J46586_10006602 JGI25406J46586_100066022 319
134 3300003203 JGI25406J46586_10014143 JGI25406J46586_100141432 319
135 3300005937 Ga0081455_10001186 Ga0081455_1000118612 319
136 3300005981 Ga0081538_10016472 Ga0081538_100164722 319
137 3300005981 Ga0081538_10016846 Ga0081538_100168464 319
138 3300005981 Ga0081538_10033475 Ga0081538_100334753 319
139 3300005985 Ga0081539_10003627 Ga0081539_1000362716 319
140 3300005985 Ga0081539_10019124 Ga0081539_100191245 319
141 3300006844 Ga0075428_100006324 Ga0075428_10000632411 319
142 3300006846 Ga0075430_100001158 Ga0075430_1000011588 319
143 3300006846 Ga0075430_100045756 Ga0075430_1000457562 319
144 3300006846 Ga0075430_100094159 Ga0075430_1000941592 319
145 3300006847 Ga0075431_100001604 Ga0075431_10000160418 319
146 3300006847 Ga0075431_100040871 Ga0075431_1000408714 319
147 3300006847 Ga0075431_100044551 Ga0075431_1000445512 319
148 3300006847 Ga0075431_100054096 Ga0075431_1000540964 319
149 3300006847 Ga0075431_100098356 Ga0075431_1000983562 319
150 3300006847 Ga0075431_100584627 Ga0075431_1005846271 319
151 3300006880 Ga0075429_100000254 Ga0075429_10000025411 319
152 3300006880 Ga0075429_100057533 Ga0075429_1000575332 319
153 3300009094 Ga0111539_10003715 Ga0111539_1000371515 319
154 3300009147 Ga0114129_10001223 Ga0114129_100012236 319
155 3300013104 Ga0157370_10140918 Ga0157370_101409182 319
156 3300014325 Ga0163163_10128494 Ga0163163_101284942 319
157 3300031548 Ga0307408_100309379 Ga0307408_1003093792 319
158 3300031852 Ga0307410_10056828 Ga0307410_100568282 319
159 3300031903 Ga0307407_10038188 Ga0307407_100381883 319
160 3300031903 Ga0307407_10070380 Ga0307407_100703802 319
161 3300031911 Ga0307412_10002748 Ga0307412_100027487 319
162 3300031911 Ga0307412_10252057 Ga0307412_102520571 319
163 3300031995 Ga0307409_100017268 Ga0307409_1000172682 319
164 3300031995 Ga0307409_100114330 Ga0307409_1001143302 319
165 3300032002 Ga0307416_100155102 Ga0307416_1001551022 319
166 3300032002 Ga0307416_100191620 Ga0307416_1001916202 319
167 3300032004 Ga0307414_10000016 Ga0307414_10000016124 319
168 3300032004 Ga0307414_10090473 Ga0307414_100904732 319
169 3300032126 Ga0307415_100111279 Ga0307415_1001112792 319
170 3300032126 Ga0307415_100496697 Ga0307415_1004966971 319
171 3300042016 Ga0439463_017989 Ga0439463_017989_580_1593 319
172 3300042461 Ga0439460_0008091 Ga0439460_0008091_1443_2420 319
173 3300042993 Ga0439440_0008697 Ga0439440_0008697_886_1863 319
174 3300049568 Ga0501031_0006615 Ga0501031_0006615_1537_2637 319
175 3300049568 Ga0501031_0031275 Ga0501031_0031275_874_1866 319
176 3300049570 Ga0501033_0039509 Ga0501033_0039509_69_1034 319
177 3300049572 Ga0501036_0014898 Ga0501036_0014898_1838_2938 319
178 3300049574 Ga0501038_0222954 Ga0501038_0222954_237_1415 319
179 3300049575 Ga0501039_0010539 Ga0501039_0010539_5778_6743 319
180 3300049575 Ga0501039_0017669 Ga0501039_0017669_584_1684 319
181 3300049575 Ga0501039_0240938 Ga0501039_0240938_55_1032 319
182 3300049576 Ga0501040_0011323 Ga0501040_0011323_276_1241 319
183 3300049576 Ga0501040_0027258 Ga0501040_0027258_2375_3340 319
184 3300049577 Ga0501041_0002085 Ga0501041_0002085_4306_5406 319
185 3300049578 Ga0501042_0015258 Ga0501042_0015258_347_1447 319
186 3300049579 Ga0501043_0074217 Ga0501043_0074217_1379_2377 319
187 3300049580 Ga0501046_0019779 Ga0501046_0019779_4343_5308 319
188 3300049580 Ga0501046_0251381 Ga0501046_0251381_49_1047 319
189 3300049584 Ga0501068_0007079 Ga0501068_0007079_4394_5494 319
190 3300049587 Ga0501071_0033188 Ga0501071_0033188_1994_2992 319
191 3300049587 Ga0501071_0121576 Ga0501071_0121576_740_1840 319
192 3300049588 Ga0501072_0006976 Ga0501072_0006976_5220_6320 319
193 3300049588 Ga0501072_0017839 Ga0501072_0017839_377_1342 319
194 3300049589 Ga0501073_0118018 Ga0501073_0118018_319_1287 319
195 3300049590 Ga0501074_0048159 Ga0501074_0048159_805_1905 319
196 3300049590 Ga0501074_0306208 Ga0501074_0306208_92_1057 319
197 3300049591 Ga0501075_0139733 Ga0501075_0139733_391_1491 319
198 3300049591 Ga0501075_0191368 Ga0501075_0191368_323_1321 319
199 3300049592 Ga0501076_0005410 Ga0501076_0005410_2572_3672 319
200 3300049592 Ga0501076_0204328 Ga0501076_0204328_147_1145 319
201 3300049592 Ga0501076_0324196 Ga0501076_0324196_20_997 319
202 3300049593 Ga0501077_0004246 Ga0501077_0004246_4243_5343 319
203 3300049593 Ga0501077_0006912 Ga0501077_0006912_148_1113 319
204 3300049652 Ga0501202_022756 Ga0501202_022756_121_1086 319
205 3300049741 Ga0501079_0065264 Ga0501079_0065264_1655_2620 319
206 3300049741 Ga0501079_0081329 Ga0501079_0081329_1138_2115 319
207 3300049742 Ga0501080_0053811 Ga0501080_0053811_2479_3657 319
208 3300049743 Ga0501081_0016218 Ga0501081_0016218_1828_2928 319
209 3300049744 Ga0501083_0026494 Ga0501083_0026494_2482_3582 319
210 3300049822 Ga0501035_0245450 Ga0501035_0245450_46_1146 319
211 3300049822 Ga0501035_0323467 Ga0501035_0323467_240_1238 319
212 3300049824 Ga0501045_0044855 Ga0501045_0044855_1665_2765 319
213 3300049824 Ga0501045_0045042 Ga0501045_0045042_45_1010 319
214 3300049824 Ga0501045_0155702 Ga0501045_0155702_550_1548 319
215 3300050507 nmdc:mga05p37_472_c1 nmdc:mga05p37_472_c1_33837_34802 319
216 3300050508 nmdc:mga09592_347_c1 nmdc:mga09592_347_c1_4489_5454 319
217 3300050509 nmdc:mga0qj67_24983_c1 nmdc:mga0qj67_24983_c1_1243_2208 319
218 3300050509 nmdc:mga0qj67_277_c1 nmdc:mga0qj67_277_c1_7138_8103 319
219 3300050510 nmdc:mga06r32_22126_c1 nmdc:mga06r32_22126_c1_3882_4847 319
220 3300050510 nmdc:mga06r32_387043_c1 nmdc:mga06r32_387043_c1_261_1226 319
221 3300050510 nmdc:mga06r32_42628_c1 nmdc:mga06r32_42628_c1_2211_3176 319
222 3300050510 nmdc:mga06r32_458945_c1 nmdc:mga06r32_458945_c1_139_1104 319
223 3300050510 nmdc:mga06r32_7049_c1 nmdc:mga06r32_7049_c1_8336_9301 319
224 3300050510 nmdc:mga06r32_979_c1 nmdc:mga06r32_979_c1_1206_2171 319
225 3300054114 Ga0501084_0005291 Ga0501084_0005291_5679_6779 319
226 3300054114 Ga0501084_0049838 Ga0501084_0049838_2212_3210 319
227 3300060353 Ga0501082_0017006 Ga0501082_0017006_1771_2871 319
228 3300060353 Ga0501082_0051747 Ga0501082_0051747_164_1129 319
229 3300060353 Ga0501082_0092215 Ga0501082_0092215_465_1442 319
230 3300061734 Ga0530510_0007972 Ga0530510_0007972_5778_6743 319
231 3300061734 Ga0530510_0009052 Ga0530510_0009052_1343_2443 319
232 3300061734 Ga0530510_0219405 Ga0530510_0219405_201_1178 319
233 3300061734 Ga0530510_0263873 Ga0530510_0263873_66_1028 319
234 3300003322 rootL2_10371810 rootL2_103718103 320
235 3300003323 rootH1_10044876 rootH1_100448764 320
236 3300005334 Ga0068869_100101681 Ga0068869_1001016813 320
237 3300005347 Ga0070668_100009199 Ga0070668_1000091994 320
238 3300005354 Ga0070675_100042819 Ga0070675_1000428191 320
239 3300005456 Ga0070678_100024915 Ga0070678_1000249154 320
240 3300005457 Ga0070662_100050495 Ga0070662_1000504952 320
241 3300005458 Ga0070681_10012597 Ga0070681_100125975 320
242 3300005459 Ga0068867_100027883 Ga0068867_1000278831 320
243 3300005530 Ga0070679_100126673 Ga0070679_1001266732 320
244 3300005543 Ga0070672_100013141 Ga0070672_1000131413 320
245 3300005548 Ga0070665_100118167 Ga0070665_1001181673 320
246 3300005719 Ga0068861_100058292 Ga0068861_1000582923 320
247 3300005981 Ga0081538_10002555 Ga0081538_1000255515 320
248 3300005981 Ga0081538_10009601 Ga0081538_100096018 320
249 3300005981 Ga0081538_10011805 Ga0081538_100118053 320
250 3300005981 Ga0081538_10011882 Ga0081538_100118823 320
251 3300005981 Ga0081538_10093050 Ga0081538_100930501 320
252 3300006038 Ga0075365_10035294 Ga0075365_100352942 320
253 3300006177 Ga0075362_10028417 Ga0075362_100284172 320
254 3300006844 Ga0075428_100095324 Ga0075428_1000953243 320
255 3300006846 Ga0075430_100030902 Ga0075430_1000309024 320
256 3300006846 Ga0075430_100190328 Ga0075430_1001903281 320
257 3300006847 Ga0075431_100000163 Ga0075431_1000001636 320
258 3300006880 Ga0075429_100000497 Ga0075429_10000049718 320
259 3300009094 Ga0111539_10000330 Ga0111539_1000033045 320
260 3300009553 Ga0105249_10394027 Ga0105249_103940272 320
261 3300013306 Ga0163162_10305070 Ga0163162_103050702 320
262 3300017792 Ga0163161_10141783 Ga0163161_101417831 320
263 3300025912 Ga0207707_10014794 Ga0207707_100147948 320
264 3300025933 Ga0207706_10005109 Ga0207706_1000510911 320
265 3300025940 Ga0207691_10031671 Ga0207691_100316713 320
266 3300025961 Ga0207712_10094367 Ga0207712_100943671 320
267 3300025972 Ga0207668_10092107 Ga0207668_100921071 320
268 3300026118 Ga0207675_100086173 Ga0207675_1000861733 320
269 3300027907 Ga0207428_10075576 Ga0207428_100755762 320
270 3300031548 Ga0307408_100159906 Ga0307408_1001599062 320
271 3300031731 Ga0307405_10003381 Ga0307405_100033814 320
272 3300031731 Ga0307405_10021520 Ga0307405_100215201 320
273 3300031824 Ga0307413_10231527 Ga0307413_102315272 320
274 3300031852 Ga0307410_10020832 Ga0307410_100208325 320
275 3300031852 Ga0307410_10151891 Ga0307410_101518912 320
276 3300031901 Ga0307406_10000182 Ga0307406_1000018233 320
277 3300031901 Ga0307406_10001096 Ga0307406_1000109615 320
278 3300031901 Ga0307406_10131268 Ga0307406_101312682 320
279 3300031901 Ga0307406_10199357 Ga0307406_101993571 320
280 3300031901 Ga0307406_10201743 Ga0307406_102017431 320
281 3300031903 Ga0307407_10000396 Ga0307407_1000039612 320
282 3300031903 Ga0307407_10096712 Ga0307407_100967122 320
283 3300031911 Ga0307412_10148816 Ga0307412_101488162 320
284 3300031995 Ga0307409_100007120 Ga0307409_1000071204 320
285 3300031995 Ga0307409_100021212 Ga0307409_1000212125 320
286 3300031995 Ga0307409_100026567 Ga0307409_1000265671 320
287 3300031995 Ga0307409_100444152 Ga0307409_1004441521 320
288 3300032002 Ga0307416_100000478 Ga0307416_10000047814 320
289 3300032002 Ga0307416_100005759 Ga0307416_1000057591 320
290 3300032004 Ga0307414_10009128 Ga0307414_100091283 320
291 3300032005 Ga0307411_10025573 Ga0307411_100255732 320
292 3300032126 Ga0307415_100000395 Ga0307415_1000003956 320
293 3300032126 Ga0307415_100396685 Ga0307415_1003966851 320
294 3300041453 Ga0451797_1043473 Ga0451797_1043473_234_1211 320
295 3300044683 Ga0466965_0000016 Ga0466965_0000016_74716_75681 320
296 3300044735 Ga0466968_0004494 Ga0466968_0004494_3209_4174 320
297 3300044901 Ga0466960_0091875 Ga0466960_0091875_52_1017 320
298 3300046537 Ga0495598_0015832 Ga0495598_0015832_48_1052 320
299 3300046538 Ga0495609_0105315 Ga0495609_0105315_133_1137 320
300 3300046615 Ga0495656_0008492 Ga0495656_0008492_223_1227 320
301 3300046616 Ga0495668_0094489 Ga0495668_0094489_358_1362 320
302 3300046664 Ga0495659_0039787 Ga0495659_0039787_80_1084 320
303 3300046691 Ga0495670_0078265 Ga0495670_0078265_333_1337 320
304 3300048916 Ga0496113_0373834 Ga0496113_0373834_112_1080 320
305 3300049568 Ga0501031_0040930 Ga0501031_0040930_476_1456 320
306 3300049569 Ga0501032_0038559 Ga0501032_0038559_1421_2419 320
307 3300049570 Ga0501033_0018509 Ga0501033_0018509_488_1492 320
308 3300049570 Ga0501033_0080121 Ga0501033_0080121_1042_2040 320
309 3300049571 Ga0501034_0216177 Ga0501034_0216177_425_1396 320
310 3300049572 Ga0501036_0066826 Ga0501036_0066826_1067_2047 320
311 3300049572 Ga0501036_0076915 Ga0501036_0076915_266_1270 320
312 3300049573 Ga0501037_0072516 Ga0501037_0072516_1016_2020 320
313 3300049574 Ga0501038_0000903 Ga0501038_0000903_16134_17132 320
314 3300049575 Ga0501039_0002734 Ga0501039_0002734_10020_11018 320
315 3300049575 Ga0501039_0006861 Ga0501039_0006861_7041_8045 320
316 3300049575 Ga0501039_0142089 Ga0501039_0142089_463_1443 320
317 3300049576 Ga0501040_0000259 Ga0501040_0000259_28557_29561 320
318 3300049576 Ga0501040_0000413 Ga0501040_0000413_1150_2148 320
319 3300049576 Ga0501040_0004064 Ga0501040_0004064_2097_3077 320
320 3300049577 Ga0501041_0000491 Ga0501041_0000491_6909_7913 320
321 3300049577 Ga0501041_0002421 Ga0501041_0002421_1161_2159 320
322 3300049577 Ga0501041_0023541 Ga0501041_0023541_2152_3132 320
323 3300049578 Ga0501042_0001520 Ga0501042_0001520_5855_6859 320
324 3300049578 Ga0501042_0001939 Ga0501042_0001939_2566_3546 320
325 3300049579 Ga0501043_0007901 Ga0501043_0007901_5577_6575 320
326 3300049579 Ga0501043_0015672 Ga0501043_0015672_2873_3877 320
327 3300049579 Ga0501043_0073543 Ga0501043_0073543_1185_2165 320
328 3300049580 Ga0501046_0000593 Ga0501046_0000593_14884_15882 320
329 3300049580 Ga0501046_0000713 Ga0501046_0000713_913_1917 320
330 3300049580 Ga0501046_0015044 Ga0501046_0015044_79_1059 320
331 3300049582 Ga0501048_0001388 Ga0501048_0001388_5850_6848 320
332 3300049582 Ga0501048_0002303 Ga0501048_0002303_6531_7535 320
333 3300049584 Ga0501068_0009763 Ga0501068_0009763_285_1283 320
334 3300049585 Ga0501069_0044365 Ga0501069_0044365_948_1952 320
335 3300049586 Ga0501070_0088959 Ga0501070_0088959_1422_2420 320
336 3300049587 Ga0501071_0001614 Ga0501071_0001614_988_1986 320
337 3300049587 Ga0501071_0017040 Ga0501071_0017040_1508_2512 320
338 3300049587 Ga0501071_0065922 Ga0501071_0065922_1033_2013 320
339 3300049588 Ga0501072_0000321 Ga0501072_0000321_15888_16886 320
340 3300049588 Ga0501072_0012113 Ga0501072_0012113_1825_2829 320
341 3300049589 Ga0501073_0209225 Ga0501073_0209225_279_1259 320
342 3300049590 Ga0501074_0003450 Ga0501074_0003450_10093_11091 320
343 3300049590 Ga0501074_0018097 Ga0501074_0018097_523_1527 320
344 3300049590 Ga0501074_0111870 Ga0501074_0111870_194_1174 320
345 3300049591 Ga0501075_0000060 Ga0501075_0000060_34378_35376 320
346 3300049591 Ga0501075_0000854 Ga0501075_0000854_4787_5791 320
347 3300049591 Ga0501075_0054251 Ga0501075_0054251_365_1336 320
348 3300049592 Ga0501076_0001606 Ga0501076_0001606_6885_7889 320
349 3300049592 Ga0501076_0145072 Ga0501076_0145072_495_1466 320
350 3300049593 Ga0501077_0000411 Ga0501077_0000411_9911_10909 320
351 3300049593 Ga0501077_0034105 Ga0501077_0034105_562_1542 320
352 3300049593 Ga0501077_0036972 Ga0501077_0036972_1587_2591 320
353 3300049670 Ga0501236_001950 Ga0501236_001950_754_1731 320
354 3300049686 Ga0501257_000595 Ga0501257_000595_3862_4839 320
355 3300049741 Ga0501079_0000050 Ga0501079_0000050_44660_45658 320
356 3300049741 Ga0501079_0000169 Ga0501079_0000169_28575_29579 320
357 3300049742 Ga0501080_0046817 Ga0501080_0046817_1350_2354 320
358 3300049742 Ga0501080_0173741 Ga0501080_0173741_434_1414 320
359 3300049743 Ga0501081_0000098 Ga0501081_0000098_6718_7722 320
360 3300049743 Ga0501081_0023494 Ga0501081_0023494_2710_3708 320
361 3300049744 Ga0501083_0073563 Ga0501083_0073563_772_1776 320
362 3300049761 Ga0501264_000632 Ga0501264_000632_3386_4363 320
363 3300049822 Ga0501035_0003125 Ga0501035_0003125_5736_6704 320
364 3300049822 Ga0501035_0019636 Ga0501035_0019636_4061_5059 320
365 3300049822 Ga0501035_0135651 Ga0501035_0135651_312_1316 320
366 3300049824 Ga0501045_0000051 Ga0501045_0000051_7020_8018 320
367 3300049824 Ga0501045_0000786 Ga0501045_0000786_7017_8021 320
368 3300050492 nmdc:mga0yw44_870_c1 nmdc:mga0yw44_870_c1_3458_4426 320
369 3300050507 nmdc:mga05p37_211152_c1 nmdc:mga05p37_211152_c1_43_1158 320
370 3300050508 nmdc:mga09592_113_c1 nmdc:mga09592_113_c1_11290_12264 320
371 3300050509 nmdc:mga0qj67_19813_c1 nmdc:mga0qj67_19813_c1_1293_2267 320
372 3300050509 nmdc:mga0qj67_42276_c1 nmdc:mga0qj67_42276_c1_1491_2486 320
373 3300050510 nmdc:mga06r32_46_c1 nmdc:mga06r32_46_c1_6356_7330 320
374 3300050511 nmdc:mga08y16_71174_c1 nmdc:mga08y16_71174_c1_1699_2667 320
375 3300053139 Ga0500568_0000089 Ga0500568_0000089_47858_48838 320
376 3300053139 Ga0500568_0000596 Ga0500568_0000596_16600_17565 320
377 3300054114 Ga0501084_0001594 Ga0501084_0001594_3702_4700 320
378 3300054114 Ga0501084_0006102 Ga0501084_0006102_6978_7982 320
379 3300054114 Ga0501084_0013193 Ga0501084_0013193_5409_6389 320
380 3300059423 Ga0590074_010988 Ga0590074_010988_126_1127 320
381 3300059426 Ga0590077_029536 Ga0590077_029536_112_1113 320
382 3300060353 Ga0501082_0001366 Ga0501082_0001366_8702_9700 320
383 3300060353 Ga0501082_0001871 Ga0501082_0001871_6814_7818 320
384 3300060353 Ga0501082_0101807 Ga0501082_0101807_209_1189 320
385 3300061734 Ga0530510_0000555 Ga0530510_0000555_14324_15322 320
386 3300061734 Ga0530510_0102745 Ga0530510_0102745_458_1462 320
387 3300061734 Ga0530510_0209604 Ga0530510_0209604_45_1013 320
388 3300005981 Ga0081538_10034970 Ga0081538_100349702 321
389 3300001976 JGI24752J21851_1005162 JGI24752J21851_10051623 322
390 3300002459 JGI24751J29686_10007047 JGI24751J29686_100070471 322
391 3300002459 JGI24751J29686_10007441 JGI24751J29686_100074412 322
392 3300005327 Ga0070658_10049687 Ga0070658_100496872 322
393 3300005331 Ga0070670_100006468 Ga0070670_1000064683 322
394 3300005334 Ga0068869_100030782 Ga0068869_1000307822 322
395 3300005336 Ga0070680_100084628 Ga0070680_1000846283 322
396 3300005337 Ga0070682_100008206 Ga0070682_1000082065 322
397 3300005339 Ga0070660_100017304 Ga0070660_1000173044 322
398 3300005340 Ga0070689_100090432 Ga0070689_1000904322 322
399 3300005341 Ga0070691_10033354 Ga0070691_100333542 322
400 3300005344 Ga0070661_100011097 Ga0070661_1000110973 322
401 3300005345 Ga0070692_10014199 Ga0070692_100141993 322
402 3300005353 Ga0070669_100486580 Ga0070669_1004865801 322
403 3300005355 Ga0070671_100001679 Ga0070671_10000167912 322
404 3300005364 Ga0070673_100179565 Ga0070673_1001795652 322
405 3300005366 Ga0070659_100128165 Ga0070659_1001281652 322
406 3300005434 Ga0070709_10041745 Ga0070709_100417452 322
407 3300005436 Ga0070713_100398057 Ga0070713_1003980571 322
408 3300005455 Ga0070663_100002235 Ga0070663_10000223510 322
409 3300005455 Ga0070663_100147323 Ga0070663_1001473232 322
410 3300005456 Ga0070678_100000846 Ga0070678_1000008462 322
411 3300005458 Ga0070681_10021515 Ga0070681_100215156 322
412 3300005530 Ga0070679_100046890 Ga0070679_1000468904 322
413 3300005547 Ga0070693_100001364 Ga0070693_1000013647 322
414 3300005614 Ga0068856_100016690 Ga0068856_1000166903 322
415 3300005615 Ga0070702_100002984 Ga0070702_1000029846 322
416 3300005616 Ga0068852_100004880 Ga0068852_10000488011 322
417 3300005617 Ga0068859_100236966 Ga0068859_1002369662 322
418 3300005618 Ga0068864_100105451 Ga0068864_1001054513 322
419 3300005618 Ga0068864_100247026 Ga0068864_1002470262 322
420 3300005834 Ga0068851_10036352 Ga0068851_100363522 322
421 3300005840 Ga0068870_10001943 Ga0068870_100019434 322
422 3300005841 Ga0068863_100007205 Ga0068863_1000072057 322
423 3300005842 Ga0068858_100040824 Ga0068858_1000408243 322
424 3300005843 Ga0068860_100083201 Ga0068860_1000832012 322
425 3300005983 Ga0081540_1070840 Ga0081540_10708401 322
426 3300006175 Ga0070712_100087631 Ga0070712_1000876312 322
427 3300006237 Ga0097621_100029087 Ga0097621_1000290873 322
428 3300006358 Ga0068871_100016001 Ga0068871_1000160015 322
429 3300006852 Ga0075433_10002124 Ga0075433_100021244 322
430 3300006871 Ga0075434_100002008 Ga0075434_1000020083 322
431 3300006880 Ga0075429_100178359 Ga0075429_1001783592 322
432 3300006914 Ga0075436_100007935 Ga0075436_1000079354 322
433 3300006931 Ga0097620_100236966 Ga0097620_1002369662 322
434 3300007076 Ga0075435_100008757 Ga0075435_1000087573 322
435 3300009011 Ga0105251_10017291 Ga0105251_100172913 322
436 3300009098 Ga0105245_10202691 Ga0105245_102026912 322
437 3300009098 Ga0105245_10224025 Ga0105245_102240252 322
438 3300009101 Ga0105247_10008710 Ga0105247_100087102 322
439 3300009177 Ga0105248_10192476 Ga0105248_101924762 322
440 3300009545 Ga0105237_10058756 Ga0105237_100587562 322
441 3300009551 Ga0105238_10286548 Ga0105238_102865482 322
442 3300009551 Ga0105238_10317408 Ga0105238_103174082 322
443 3300010375 Ga0105239_10423109 Ga0105239_104231092 322
444 3300011119 Ga0105246_10007819 Ga0105246_100078193 322
445 3300013102 Ga0157371_10015180 Ga0157371_100151803 322
446 3300013105 Ga0157369_10180040 Ga0157369_101800402 322
447 3300013296 Ga0157374_10040037 Ga0157374_100400373 322
448 3300013306 Ga0163162_10254296 Ga0163162_102542962 322
449 3300013307 Ga0157372_10296365 Ga0157372_102963653 322
450 3300014745 Ga0157377_10032178 Ga0157377_100321783 322
451 3300014968 Ga0157379_10064004 Ga0157379_100640042 322
452 3300020070 Ga0206356_11782896 Ga0206356_117828961 322
453 3300025321 Ga0207656_10013733 Ga0207656_100137332 322
454 3300025900 Ga0207710_10034858 Ga0207710_100348582 322
455 3300025901 Ga0207688_10001857 Ga0207688_100018579 322
456 3300025906 Ga0207699_10176934 Ga0207699_101769341 322
457 3300025908 Ga0207643_10000303 Ga0207643_1000030311 322
458 3300025909 Ga0207705_10051559 Ga0207705_100515593 322
459 3300025911 Ga0207654_10002643 Ga0207654_100026434 322
460 3300025912 Ga0207707_10009802 Ga0207707_100098022 322
461 3300025915 Ga0207693_10110229 Ga0207693_101102292 322
462 3300025917 Ga0207660_10006599 Ga0207660_100065997 322
463 3300025919 Ga0207657_10022052 Ga0207657_100220525 322
464 3300025920 Ga0207649_10001239 Ga0207649_100012393 322
465 3300025921 Ga0207652_10015871 Ga0207652_100158713 322
466 3300025924 Ga0207694_10058334 Ga0207694_100583342 322
467 3300025925 Ga0207650_10027454 Ga0207650_100274543 322
468 3300025926 Ga0207659_10004295 Ga0207659_100042952 322
469 3300025927 Ga0207687_10022811 Ga0207687_100228113 322
470 3300025928 Ga0207700_10123055 Ga0207700_101230551 322
471 3300025931 Ga0207644_10005696 Ga0207644_100056963 322
472 3300025932 Ga0207690_10076854 Ga0207690_100768542 322
473 3300025933 Ga0207706_10064085 Ga0207706_100640853 322
474 3300025936 Ga0207670_10060998 Ga0207670_100609982 322
475 3300025940 Ga0207691_10389616 Ga0207691_103896161 322
476 3300025941 Ga0207711_10074193 Ga0207711_100741933 322
477 3300025942 Ga0207689_10013427 Ga0207689_100134276 322
478 3300025949 Ga0207667_10148162 Ga0207667_101481622 322
479 3300025960 Ga0207651_10151833 Ga0207651_101518332 322
480 3300025961 Ga0207712_10300736 Ga0207712_103007361 322
481 3300026023 Ga0207677_10011463 Ga0207677_100114634 322
482 3300026035 Ga0207703_10007724 Ga0207703_100077243 322
483 3300026067 Ga0207678_10002679 Ga0207678_100026798 322
484 3300026078 Ga0207702_10001526 Ga0207702_100015264 322
485 3300026078 Ga0207702_10003376 Ga0207702_100033763 322
486 3300026088 Ga0207641_10018873 Ga0207641_100188733 322
487 3300026095 Ga0207676_10008983 Ga0207676_100089834 322
488 3300026118 Ga0207675_100360364 Ga0207675_1003603641 322
489 3300026121 Ga0207683_10013397 Ga0207683_100133972 322
490 3300026121 Ga0207683_10135819 Ga0207683_101358192 322
491 3300026142 Ga0207698_10015364 Ga0207698_100153644 322
492 3300027907 Ga0207428_10014226 Ga0207428_100142264 322
493 3300028379 Ga0268266_10031981 Ga0268266_100319814 322
494 3300028381 Ga0268264_10043473 Ga0268264_100434733 322
495 3300037068 Ga0373925_0052589 Ga0373925_0052589_759_1733 322
496 3300041451 Ga0451791_1784313 Ga0451791_1784313_5717_6688 322
497 3300041452 Ga0451793_0091432 Ga0451793_0091432_3381_4352 322
498 3300041491 Ga0451833_1453543 Ga0451833_1453543_110_1081 322
499 3300042005 Ga0439448_0007189 Ga0439448_0007189_1397_2389 322
500 3300048905 Ga0496102_0003202 Ga0496102_0003202_11495_12463 322
501 3300048907 Ga0496104_0011560 Ga0496104_0011560_5199_6167 322
502 3300048908 Ga0496105_0013054 Ga0496105_0013054_2877_3845 322
503 3300048909 Ga0496106_0013259 Ga0496106_0013259_4943_5911 322
504 3300048910 Ga0496107_0038164 Ga0496107_0038164_734_1702 322
505 3300048911 Ga0496108_0080726 Ga0496108_0080726_726_1694 322
506 3300048913 Ga0496110_0006041 Ga0496110_0006041_580_1548 322
507 3300048914 Ga0496111_0011925 Ga0496111_0011925_2172_3140 322
508 3300048915 Ga0496112_0098358 Ga0496112_0098358_1471_2439 322
509 3300048916 Ga0496113_0018179 Ga0496113_0018179_1343_2311 322
510 3300050507 nmdc:mga05p37_121374_c1 nmdc:mga05p37_121374_c1_32_1024 322
511 3300050508 nmdc:mga09592_278700_c1 nmdc:mga09592_278700_c1_433_1425 322
512 3300050510 nmdc:mga06r32_492821_c1 nmdc:mga06r32_492821_c1_164_1156 322
513 3300050511 nmdc:mga08y16_64131_c1 nmdc:mga08y16_64131_c1_2041_3009 322
514 3300050515 nmdc:mga0a205_5082_c1 nmdc:mga0a205_5082_c1_136_1104 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

64

364

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9534 1 319
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.942 1 319
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9332 1 319
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.9247 2 318
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9221 1 319
ID Description Score Start End Superfamily
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9247 2 318 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9207 1 319 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9164 1 318 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9097 1 319 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9083 2 318 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1G6XE77-F1-model_v4 Probable non-F420 flavinoid oxidoreductase 0.9911 1 318 GO:0016705
AF-A0A519NBV7-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9901 3 187 GO:0016705
AF-A0A2X3KVY2-F1-model_v4 deleted 0.9898 1 318
AF-A0A2G7D5C2-F1-model_v4 deleted 0.9891 1 319
AF-A0A7W7HYL7-F1-model_v4 Putative non-F420 flavinoid oxidoreductase 0.9884 1 318 GO:0016705

Feature Viewer

pLDDT pTM Quality
95.32 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map