F457718

General Info

Members Datasets Scaffolds Average Seq Length
514 188 1028 123

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10047962|Ga0157378_100479627
Length 116
Sequence MIAQFAAVGIGAALGGWLRWGLSLWLNPRAPAFPLGTLASNQVGGYLRVDVAPEWRLFVITGFLGGLTTFSTFSAEVSEHLMRGSYGTGALLAAVHLGGSLLLTIAGFATFRALTA

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10047962 3300013297 Bacteria 3798
2 MBSR1b_contig_1906032 2162886012 Bacteria 933
3 MBSR1b_contig_7960223 2162886012 Bacteria 931
4 Ga0065715_10023249 3300005293 Bacteria 1459
5 Ga0070676_10000184 3300005328 Bacteria 25832
6 Ga0070676_10001171 3300005328 Bacteria 13130
7 Ga0070676_10728343 3300005328 Bacteria 726
8 Ga0070683_101673219 3300005329 Bacteria 612
9 Ga0070690_100177270 3300005330 Bacteria 1471
10 Ga0070670_100047864 3300005331 Bacteria 3680
11 Ga0070670_100057532 3300005331 Bacteria 3338
12 Ga0070670_100063484 3300005331 Bacteria 3170
13 Ga0070670_100243028 3300005331 Bacteria 1567
14 Ga0070670_100310446 3300005331 Bacteria 1380
15 Ga0070670_100435332 3300005331 Bacteria 1161
16 Ga0070670_100751729 3300005331 Bacteria 879
17 Ga0070670_101009424 3300005331 Bacteria 757
18 Ga0070677_10000379 3300005333 Bacteria 15666
19 Ga0070677_10161180 3300005333 Bacteria 1052
20 Ga0068869_100040616 3300005334 Bacteria 3327
21 Ga0070666_10004330 3300005335 Bacteria 8637
22 Ga0070666_10010916 3300005335 Bacteria 5691
23 Ga0070666_10148270 3300005335 Bacteria 1636
24 Ga0070666_10241828 3300005335 Bacteria 1276
25 Ga0070666_10277977 3300005335 Bacteria 1190
26 Ga0070666_10336192 3300005335 Bacteria 1079
27 Ga0070666_10881419 3300005335 Bacteria 661
28 Ga0070666_11232956 3300005335 Bacteria 557
29 Ga0068868_100016685 3300005338 Bacteria 5460
30 Ga0068868_100064936 3300005338 Bacteria 2899
31 Ga0068868_101018788 3300005338 Bacteria 758
32 Ga0070660_100373937 3300005339 Bacteria 1176
33 Ga0070689_100528123 3300005340 Bacteria 1014
34 Ga0070689_100885813 3300005340 Bacteria 789
35 Ga0070661_100101983 3300005344 Bacteria 2136
36 Ga0070668_100004485 3300005347 Bacteria 10355
37 Ga0070668_100008232 3300005347 Bacteria 7742
38 Ga0070668_100008931 3300005347 Bacteria 7440
39 Ga0070668_100041600 3300005347 Bacteria 3521
40 Ga0070668_100051454 3300005347 Bacteria 3174
41 Ga0070668_100091403 3300005347 Bacteria 2400
42 Ga0070668_100115966 3300005347 Bacteria 2135
43 Ga0070669_100020343 3300005353 Bacteria 4740
44 Ga0070669_100123827 3300005353 Bacteria 1976
45 Ga0070669_100290790 3300005353 Bacteria 1312
46 Ga0070669_101253876 3300005353 Bacteria 641
47 Ga0070669_101997913 3300005353 Bacteria 507
48 Ga0070675_100002706 3300005354 Bacteria 13320
49 Ga0070675_100039846 3300005354 Bacteria 3834
50 Ga0070675_100040984 3300005354 Bacteria 3782
51 Ga0070675_100160887 3300005354 Bacteria 1931
52 Ga0070675_100253613 3300005354 Bacteria 1540
53 Ga0070671_100011020 3300005355 Bacteria 7256
54 Ga0070671_100043336 3300005355 Bacteria 3740
55 Ga0070671_100259253 3300005355 Bacteria 1477
56 Ga0070674_100002738 3300005356 Bacteria 9745
57 Ga0070674_100010663 3300005356 Bacteria 5567
58 Ga0070674_100024253 3300005356 Bacteria 3935
59 Ga0070674_100072505 3300005356 Bacteria 2439
60 Ga0070674_100189133 3300005356 Bacteria 1582
61 Ga0070674_101286648 3300005356 Bacteria 652
62 Ga0070674_101930429 3300005356 Bacteria 537
63 Ga0070673_100000739 3300005364 Bacteria 18109
64 Ga0070673_100001078 3300005364 Bacteria 15601
65 Ga0070673_100091120 3300005364 Bacteria 2492
66 Ga0070673_100128082 3300005364 Bacteria 2126
67 Ga0070673_101985550 3300005364 Bacteria 552
68 Ga0070688_100028157 3300005365 Bacteria 3351
69 Ga0070688_100764247 3300005365 Bacteria 753
70 Ga0070667_100018980 3300005367 Bacteria 5701
71 Ga0070667_100026945 3300005367 Bacteria 4781
72 Ga0070667_100091709 3300005367 Bacteria 2613
73 Ga0070667_100140537 3300005367 Bacteria 2114
74 Ga0070667_100149652 3300005367 Bacteria 2050
75 Ga0070667_100152751 3300005367 Bacteria 2029
76 Ga0070667_100188076 3300005367 Bacteria 1828
77 Ga0070667_100575085 3300005367 Bacteria 1037
78 Ga0070667_101454537 3300005367 Bacteria 643
79 Ga0070667_101515736 3300005367 Bacteria 630
80 Ga0070701_10666537 3300005438 Bacteria 696
81 Ga0070700_100420870 3300005441 Bacteria 1009
82 Ga0070700_101773691 3300005441 Bacteria 531
83 Ga0070663_101055562 3300005455 Bacteria 708
84 Ga0070678_100000669 3300005456 Bacteria 16831
85 Ga0070678_100055965 3300005456 Bacteria 2882
86 Ga0070678_100081358 3300005456 Bacteria 2455
87 Ga0070678_100166995 3300005456 Bacteria 1789
88 Ga0070678_100507069 3300005456 Bacteria 1065
89 Ga0070678_101908944 3300005456 Bacteria 561
90 Ga0070662_100030353 3300005457 Bacteria 3781
91 Ga0070662_100639805 3300005457 Bacteria 897
92 Ga0068867_100007790 3300005459 Bacteria 7575
93 Ga0068867_100010003 3300005459 Bacteria 6684
94 Ga0068867_100186213 3300005459 Bacteria 1653
95 Ga0068867_100496424 3300005459 Bacteria 1048
96 Ga0068867_100631039 3300005459 Bacteria 938
97 Ga0068867_100844347 3300005459 Bacteria 820
98 Ga0068867_100981123 3300005459 Bacteria 765
99 Ga0068867_101685554 3300005459 Bacteria 594
100 Ga0068867_101699330 3300005459 Bacteria 592
101 Ga0070685_10336632 3300005466 Bacteria 1028
102 Ga0070685_10559365 3300005466 Bacteria 818
103 Ga0070698_101744622 3300005471 Bacteria 575
104 Ga0068853_100035810 3300005539 Bacteria 4218
105 Ga0068853_101489897 3300005539 Bacteria 655
106 Ga0070672_100000919 3300005543 Bacteria 17666
107 Ga0070672_100003642 3300005543 Bacteria 10008
108 Ga0070672_100062196 3300005543 Bacteria 2945
109 Ga0070672_100150323 3300005543 Bacteria 1926
110 Ga0070672_100583575 3300005543 Bacteria 972
111 Ga0070672_101561355 3300005543 Bacteria 592
112 Ga0070686_100276663 3300005544 Bacteria 1236
113 Ga0070693_100738896 3300005547 Bacteria 724
114 Ga0070693_100754847 3300005547 Bacteria 717
115 Ga0070665_100010269 3300005548 Bacteria 9473
116 Ga0070665_100038350 3300005548 Bacteria 4816
117 Ga0070665_100084170 3300005548 Bacteria 3185
118 Ga0070665_100392263 3300005548 Bacteria 1396
119 Ga0070665_101463100 3300005548 Bacteria 692
120 Ga0070664_100013564 3300005564 Bacteria 6639
121 Ga0070664_101769891 3300005564 Bacteria 586
122 Ga0068854_100677776 3300005578 Bacteria 888
123 Ga0068854_101662357 3300005578 Bacteria 583
124 Ga0070702_101478517 3300005615 Bacteria 558
125 Ga0068852_100005267 3300005616 Bacteria 9232
126 Ga0068852_101114255 3300005616 Bacteria 810
127 Ga0068852_101822816 3300005616 Bacteria 631
128 Ga0068859_100012908 3300005617 Bacteria 8391
129 Ga0068859_100084645 3300005617 Bacteria 3216
130 Ga0068859_101253024 3300005617 Bacteria 817
131 Ga0068864_100002507 3300005618 Bacteria 15178
132 Ga0068864_100003990 3300005618 Bacteria 12151
133 Ga0068864_100005504 3300005618 Bacteria 10376
134 Ga0068864_100047315 3300005618 Bacteria 3694
135 Ga0068864_100093891 3300005618 Bacteria 2650
136 Ga0068864_101547530 3300005618 Bacteria 667
137 Ga0068866_10314216 3300005718 Bacteria 983
138 Ga0068866_10528031 3300005718 Bacteria 785
139 Ga0068861_100026126 3300005719 Bacteria 4242
140 Ga0068861_100037039 3300005719 Bacteria 3625
141 Ga0068861_100081814 3300005719 Bacteria 2529
142 Ga0068861_101544570 3300005719 Bacteria 653
143 Ga0068851_10021689 3300005834 Bacteria 3119
144 Ga0068851_10240456 3300005834 Bacteria 1024
145 Ga0068870_10197598 3300005840 Bacteria 1217
146 Ga0068863_100000753 3300005841 Bacteria 32410
147 Ga0068863_100031717 3300005841 Bacteria 5042
148 Ga0068863_100081114 3300005841 Bacteria 3073
149 Ga0068863_100087891 3300005841 Bacteria 2945
150 Ga0068863_100258262 3300005841 Bacteria 1684
151 Ga0068863_100403873 3300005841 Bacteria 1337
152 Ga0068863_101175906 3300005841 Bacteria 772
153 Ga0068863_101237590 3300005841 Bacteria 753
154 Ga0068863_101699768 3300005841 Bacteria 641
155 Ga0068863_101855879 3300005841 Bacteria 613
156 Ga0068858_100005065 3300005842 Bacteria 12920
157 Ga0068858_100005699 3300005842 Bacteria 12172
158 Ga0068858_100041895 3300005842 Bacteria 4244
159 Ga0068858_100121489 3300005842 Bacteria 2443
160 Ga0068858_100156254 3300005842 Bacteria 2146
161 Ga0068858_101518005 3300005842 Bacteria 661
162 Ga0068860_100018228 3300005843 Bacteria 6832
163 Ga0068860_100056884 3300005843 Bacteria 3717
164 Ga0068860_100064277 3300005843 Bacteria 3486
165 Ga0068860_100291496 3300005843 Bacteria 1597
166 Ga0068860_100747233 3300005843 Bacteria 990
167 Ga0068860_101162540 3300005843 Bacteria 792
168 Ga0068860_101315693 3300005843 Bacteria 743
169 Ga0068862_100027508 3300005844 Bacteria 4787
170 Ga0068862_100144655 3300005844 Bacteria 2112
171 Ga0068862_100297865 3300005844 Bacteria 1483
172 Ga0068862_101477173 3300005844 Bacteria 685
173 Ga0068862_102208582 3300005844 Bacteria 562
174 Ga0068862_102293873 3300005844 Bacteria 551
175 Ga0070715_10002295 3300006163 Bacteria 5830
176 Ga0097621_100006535 3300006237 Bacteria 8284
177 Ga0097621_100020571 3300006237 Bacteria 5086
178 Ga0097621_100112212 3300006237 Bacteria 2304
179 Ga0097621_100364500 3300006237 Bacteria 1288
180 Ga0097621_100485862 3300006237 Bacteria 1117
181 Ga0097621_100773378 3300006237 Bacteria 888
182 Ga0097621_100816365 3300006237 Bacteria 865
183 Ga0068871_100006033 3300006358 Bacteria 8529
184 Ga0068871_100020834 3300006358 Bacteria 5029
185 Ga0068871_100553295 3300006358 Bacteria 1042
186 Ga0068871_100595298 3300006358 Bacteria 1005
187 Ga0068871_101203995 3300006358 Bacteria 710
188 Ga0075428_100021508 3300006844 Bacteria 7140
189 Ga0075428_100242761 3300006844 Bacteria 1943
190 Ga0075429_100702128 3300006880 Bacteria 886
191 Ga0068865_100076885 3300006881 Bacteria 2384
192 Ga0068865_100103618 3300006881 Bacteria 2087
193 Ga0068865_100125128 3300006881 Bacteria 1918
194 Ga0097620_100012908 3300006931 Bacteria 8391
195 Ga0097620_100084645 3300006931 Bacteria 3216
196 Ga0097620_101253029 3300006931 Bacteria 817
197 Ga0105251_10315704 3300009011 Bacteria 710
198 Ga0105251_10448291 3300009011 Bacteria 598
199 Ga0111539_10217634 3300009094 Bacteria 2224
200 Ga0111539_12033371 3300009094 Bacteria 666
201 Ga0105245_10733668 3300009098 Bacteria 1023
202 Ga0105247_10220607 3300009101 Bacteria 1283
203 Ga0105247_10894846 3300009101 Bacteria 685
204 Ga0114129_11906196 3300009147 Bacteria 721
205 Ga0105243_10047899 3300009148 Bacteria 3367
206 Ga0105243_10341997 3300009148 Bacteria 1371
207 Ga0105241_12258101 3300009174 Bacteria 541
208 Ga0105242_10172742 3300009176 Bacteria 1900
209 Ga0105242_10408595 3300009176 Bacteria 1269
210 Ga0105242_10869096 3300009176 Bacteria 899
211 Ga0105242_12211696 3300009176 Bacteria 595
212 Ga0105248_10031510 3300009177 Bacteria 5927
213 Ga0105248_10205621 3300009177 Bacteria 2219
214 Ga0105248_10328626 3300009177 Bacteria 1722
215 Ga0105248_10504153 3300009177 Bacteria 1364
216 Ga0105248_11276652 3300009177 Bacteria 830
217 Ga0105249_10722714 3300009553 Bacteria 1057
218 Ga0105249_10736085 3300009553 Unclassified 1048
219 Ga0105249_10865337 3300009553 Bacteria 970
220 Ga0105249_11645355 3300009553 Unclassified 714
221 Ga0105249_13442697 3300009553 Unclassified 509
222 Ga0157374_10007229 3300013296 Bacteria 9460
223 Ga0157374_10205458 3300013296 Bacteria 1930
224 Ga0157378_10125303 3300013297 Bacteria 2372
225 Ga0157378_10791461 3300013297 Bacteria 973
226 Ga0157378_11301397 3300013297 Bacteria 768
227 Ga0157378_13020634 3300013297 Bacteria 522
228 Ga0163162_10032100 3300013306 Bacteria 5213
229 Ga0163162_10101996 3300013306 Bacteria 2962
230 Ga0163162_10122571 3300013306 Bacteria 2705
231 Ga0163162_10351291 3300013306 Bacteria 1607
232 Ga0163162_10637124 3300013306 Bacteria 1190
233 Ga0163162_11123456 3300013306 Bacteria 891
234 Ga0163162_11637619 3300013306 Bacteria 734
235 Ga0163162_13050113 3300013306 Bacteria 538
236 Ga0163162_13276524 3300013306 Bacteria 519
237 Ga0157375_10018712 3300013308 Bacteria 6286
238 Ga0157375_10031464 3300013308 Bacteria 5017
239 Ga0157375_10042435 3300013308 Bacteria 4403
240 Ga0157375_10309702 3300013308 Bacteria 1743
241 Ga0157375_10346875 3300013308 Bacteria 1650
242 Ga0157375_10617078 3300013308 Bacteria 1243
243 Ga0157375_11191484 3300013308 Bacteria 893
244 Ga0157375_11704328 3300013308 Bacteria 746
245 Ga0163163_10003909 3300014325 Bacteria 12708
246 Ga0163163_10089924 3300014325 Bacteria 3083
247 Ga0163163_10135113 3300014325 Bacteria 2507
248 Ga0163163_10363649 3300014325 Bacteria 1503
249 Ga0163163_11430288 3300014325 Bacteria 753
250 Ga0163163_11904640 3300014325 Bacteria 655
251 Ga0157380_10014151 3300014326 Bacteria 5833
252 Ga0157380_11256156 3300014326 Bacteria 786
253 Ga0182008_10346006 3300014497 Bacteria 787
254 Ga0157377_11329987 3300014745 Bacteria 563
255 Ga0157379_10001083 3300014968 Bacteria 22234
256 Ga0157379_10010323 3300014968 Bacteria 8133
257 Ga0157379_10042739 3300014968 Bacteria 4047
258 Ga0157379_10119246 3300014968 Bacteria 2373
259 Ga0157379_11219576 3300014968 Bacteria 724
260 Ga0157379_11613875 3300014968 Bacteria 633
261 Ga0157376_10005768 3300014969 Bacteria 8675
262 Ga0157376_10036897 3300014969 Bacteria 3962
263 Ga0157376_10155121 3300014969 Bacteria 2069
264 Ga0157376_10599868 3300014969 Bacteria 1096
265 Ga0157376_11083950 3300014969 Bacteria 826
266 Ga0163161_10031738 3300017792 Bacteria 3766
267 Ga0163161_10068440 3300017792 Bacteria 2594
268 Ga0163161_10198881 3300017792 Bacteria 1544
269 Ga0213872_10018184 3300021361 Bacteria 3242
270 Ga0207697_10178690 3300025315 Bacteria 930
271 Ga0207697_10248805 3300025315 Bacteria 786
272 Ga0207656_10001453 3300025321 Bacteria 7851
273 Ga0207656_10200660 3300025321 Bacteria 963
274 Ga0207682_10006827 3300025893 Bacteria 4579
275 Ga0207682_10175082 3300025893 Bacteria 978
276 Ga0207642_10088244 3300025899 Bacteria 1525
277 Ga0207642_10428893 3300025899 Bacteria 797
278 Ga0207642_10695748 3300025899 Bacteria 640
279 Ga0207680_10014361 3300025903 Bacteria 4095
280 Ga0207680_10139832 3300025903 Bacteria 1604
281 Ga0207699_10122347 3300025906 Bacteria 1685
282 Ga0207645_10000428 3300025907 Bacteria 34870
283 Ga0207645_10001049 3300025907 Bacteria 22870
284 Ga0207645_10102871 3300025907 Bacteria 1844
285 Ga0207643_10007771 3300025908 Bacteria 5759
286 Ga0207643_10064991 3300025908 Bacteria 2089
287 Ga0207643_10541605 3300025908 Bacteria 746
288 Ga0207705_10034637 3300025909 Bacteria 3611
289 Ga0207707_11500643 3300025912 Unclassified 534
290 Ga0207695_10095098 3300025913 Bacteria 2985
291 Ga0207693_10000619 3300025915 Bacteria 31766
292 Ga0207660_10409936 3300025917 Bacteria 1092
293 Ga0207657_10084418 3300025919 Bacteria 2661
294 Ga0207649_10114634 3300025920 Bacteria 1807
295 Ga0207652_10728628 3300025921 Unclassified 883
296 Ga0207681_10017390 3300025923 Bacteria 4514
297 Ga0207681_10040292 3300025923 Bacteria 3108
298 Ga0207681_10041719 3300025923 Bacteria 3061
299 Ga0207681_10349437 3300025923 Bacteria 1183
300 Ga0207681_11205224 3300025923 Bacteria 636
301 Ga0207650_10004982 3300025925 Bacteria 9074
302 Ga0207650_10021834 3300025925 Bacteria 4527
303 Ga0207650_10032335 3300025925 Bacteria 3784
304 Ga0207650_10036671 3300025925 Bacteria 3568
305 Ga0207650_10075243 3300025925 Bacteria 2548
306 Ga0207650_10285434 3300025925 Bacteria 1345
307 Ga0207650_10402443 3300025925 Bacteria 1133
308 Ga0207650_10535423 3300025925 Bacteria 981
309 Ga0207650_10605755 3300025925 Bacteria 921
310 Ga0207650_10727250 3300025925 Bacteria 839
311 Ga0207659_10003571 3300025926 Bacteria 9366
312 Ga0207659_10053190 3300025926 Bacteria 2888
313 Ga0207659_10071114 3300025926 Bacteria 2540
314 Ga0207659_10985442 3300025926 Bacteria 725
315 Ga0207659_10998319 3300025926 Bacteria 720
316 Ga0207659_11076256 3300025926 Bacteria 692
317 Ga0207687_10867025 3300025927 Bacteria 772
318 Ga0207644_10047681 3300025931 Bacteria 3059
319 Ga0207644_10051465 3300025931 Bacteria 2956
320 Ga0207644_10057671 3300025931 Bacteria 2804
321 Ga0207644_10075589 3300025931 Bacteria 2475
322 Ga0207644_10180579 3300025931 Bacteria 1654
323 Ga0207644_10249331 3300025931 Bacteria 1416
324 Ga0207644_11443412 3300025931 Bacteria 578
325 Ga0207706_10048948 3300025933 Bacteria 3737
326 Ga0207706_10220600 3300025933 Bacteria 1660
327 Ga0207706_10767715 3300025933 Bacteria 821
328 Ga0207686_10342937 3300025934 Bacteria 1122
329 Ga0207709_10410378 3300025935 Bacteria 1038
330 Ga0207670_11004679 3300025936 Bacteria 702
331 Ga0207669_10004272 3300025937 Bacteria 6272
332 Ga0207669_10021683 3300025937 Bacteria 3397
333 Ga0207669_10470945 3300025937 Bacteria 999
334 Ga0207669_10498404 3300025937 Bacteria 974
335 Ga0207704_10032617 3300025938 Bacteria 2950
336 Ga0207704_10144580 3300025938 Bacteria 1669
337 Ga0207704_10407250 3300025938 Bacteria 1075
338 Ga0207704_10942007 3300025938 Unclassified 728
339 Ga0207691_10000127 3300025940 Bacteria 69355
340 Ga0207691_10000244 3300025940 Bacteria 53634
341 Ga0207691_10000506 3300025940 Bacteria 38815
342 Ga0207691_10084120 3300025940 Bacteria 2856
343 Ga0207691_10114191 3300025940 Bacteria 2399
344 Ga0207691_10813033 3300025940 Bacteria 785
345 Ga0207691_11170493 3300025940 Bacteria 638
346 Ga0207711_10179722 3300025941 Bacteria 1923
347 Ga0207711_10253769 3300025941 Bacteria 1615
348 Ga0207711_10822152 3300025941 Bacteria 865
349 Ga0207689_10022559 3300025942 Bacteria 5290
350 Ga0207689_10301511 3300025942 Bacteria 1328
351 Ga0207689_11023034 3300025942 Bacteria 697
352 Ga0207679_11196973 3300025945 Bacteria 697
353 Ga0207667_10093063 3300025949 Bacteria 3113
354 Ga0207651_10001334 3300025960 Bacteria 11150
355 Ga0207651_10074002 3300025960 Bacteria 2424
356 Ga0207651_10078816 3300025960 Bacteria 2364
357 Ga0207651_10135067 3300025960 Bacteria 1896
358 Ga0207651_10216850 3300025960 Bacteria 1544
359 Ga0207712_11994536 3300025961 Bacteria 519
360 Ga0207668_10006255 3300025972 Bacteria 7033
361 Ga0207668_10009249 3300025972 Bacteria 5897
362 Ga0207668_10015884 3300025972 Bacteria 4687
363 Ga0207668_10016571 3300025972 Bacteria 4601
364 Ga0207668_10019780 3300025972 Bacteria 4263
365 Ga0207668_10020217 3300025972 Bacteria 4226
366 Ga0207668_10113496 3300025972 Bacteria 2038
367 Ga0207668_10566738 3300025972 Bacteria 986
368 Ga0207658_10010289 3300025986 Bacteria 6356
369 Ga0207658_10026961 3300025986 Bacteria 4032
370 Ga0207658_10052120 3300025986 Bacteria 3019
371 Ga0207658_10092166 3300025986 Bacteria 2353
372 Ga0207658_10171997 3300025986 Bacteria 1785
373 Ga0207658_10202794 3300025986 Bacteria 1657
374 Ga0207658_10425533 3300025986 Bacteria 1172
375 Ga0207658_10517845 3300025986 Bacteria 1064
376 Ga0207677_10030808 3300026023 Bacteria 3429
377 Ga0207677_10140560 3300026023 Bacteria 1848
378 Ga0207677_10154209 3300026023 Bacteria 1776
379 Ga0207703_10007741 3300026035 Bacteria 8502
380 Ga0207703_10018709 3300026035 Bacteria 5411
381 Ga0207703_10040666 3300026035 Bacteria 3722
382 Ga0207703_10762633 3300026035 Bacteria 922
383 Ga0207639_10105261 3300026041 Bacteria 2289
384 Ga0207678_10112089 3300026067 Bacteria 2327
385 Ga0207708_10227328 3300026075 Bacteria 1497
386 Ga0207708_10339764 3300026075 Bacteria 1229
387 Ga0207708_11221847 3300026075 Bacteria 657
388 Ga0207641_10009503 3300026088 Bacteria 8016
389 Ga0207641_10010643 3300026088 Bacteria 7548
390 Ga0207641_10824117 3300026088 Bacteria 919
391 Ga0207641_11357950 3300026088 Bacteria 711
392 Ga0207648_10000357 3300026089 Bacteria 50390
393 Ga0207648_10007266 3300026089 Bacteria 10920
394 Ga0207648_10016252 3300026089 Bacteria 6808
395 Ga0207648_10315675 3300026089 Bacteria 1404
396 Ga0207648_10663985 3300026089 Bacteria 964
397 Ga0207648_10672591 3300026089 Bacteria 958
398 Ga0207648_10881833 3300026089 Bacteria 835
399 Ga0207648_11614632 3300026089 Unclassified 609
400 Ga0207648_11821594 3300026089 Bacteria 570
401 Ga0207676_10009177 3300026095 Bacteria 7042
402 Ga0207676_10021745 3300026095 Bacteria 4708
403 Ga0207676_10040021 3300026095 Bacteria 3590
404 Ga0207676_10047492 3300026095 Bacteria 3327
405 Ga0207676_10058826 3300026095 Bacteria 3033
406 Ga0207676_10183254 3300026095 Bacteria 1835
407 Ga0207676_10218573 3300026095 Bacteria 1695
408 Ga0207676_11519894 3300026095 Bacteria 667
409 Ga0207675_100017694 3300026118 Bacteria 6649
410 Ga0207675_100055639 3300026118 Bacteria 3691
411 Ga0207675_100135485 3300026118 Bacteria 2336
412 Ga0207675_100141719 3300026118 Bacteria 2284
413 Ga0207675_100494775 3300026118 Bacteria 1216
414 Ga0207675_101592999 3300026118 Bacteria 673
415 Ga0207675_102746042 3300026118 Bacteria 500
416 Ga0207683_10000009 3300026121 Bacteria 150281
417 Ga0207683_10000230 3300026121 Bacteria 49516
418 Ga0207683_10001411 3300026121 Bacteria 21704
419 Ga0207683_10077135 3300026121 Bacteria 2951
420 Ga0207683_10489505 3300026121 Bacteria 1135
421 Ga0207698_10793420 3300026142 Bacteria 949
422 Ga0207698_11074577 3300026142 Bacteria 817
423 Ga0207698_11116902 3300026142 Bacteria 801
424 Ga0207698_11898665 3300026142 Bacteria 610
425 Ga0209970_1027894 3300027614 Bacteria 973
426 Ga0209983_1049118 3300027665 Bacteria 921
427 Ga0268266_10016378 3300028379 Bacteria 6338
428 Ga0268266_10097392 3300028379 Bacteria 2587
429 Ga0268266_10226724 3300028379 Bacteria 1719
430 Ga0268266_10364116 3300028379 Bacteria 1361
431 Ga0268265_10015267 3300028380 Bacteria 5252
432 Ga0268265_11007827 3300028380 Bacteria 823
433 Ga0268265_11911256 3300028380 Bacteria 600
434 Ga0268265_12023706 3300028380 Bacteria 583
435 Ga0268264_10005502 3300028381 Bacteria 10740
436 Ga0268264_10029849 3300028381 Bacteria 4469
437 Ga0268264_10035820 3300028381 Bacteria 4086
438 Ga0268264_10185063 3300028381 Bacteria 1895
439 Ga0268264_10268402 3300028381 Bacteria 1593
440 Ga0265336_10000898 3300028666 Bacteria 15160
441 Ga0265324_10000006 3300029957 Bacteria 267048
442 Ga0265325_10002640 3300031241 Bacteria 12007
443 Ga0265316_10299564 3300031344 Bacteria 1171
444 Ga0307408_100692738 3300031548 Bacteria 915
445 Ga0316575_10015552 3300031665 Bacteria 2869
446 Ga0265314_10022215 3300031711 Bacteria 4863
447 Ga0307413_10059238 3300031824 Bacteria 2352
448 Ga0307410_10029298 3300031852 Bacteria 3505
449 Ga0307406_10204220 3300031901 Bacteria 1457
450 Ga0307407_10136440 3300031903 Bacteria 1577
451 Ga0307412_10535505 3300031911 Bacteria 981
452 Ga0307409_100038133 3300031995 Bacteria 3551
453 Ga0307416_100232160 3300032002 Bacteria 1780
454 Ga0307416_100705853 3300032002 Bacteria 1098
455 Ga0307414_10019872 3300032004 Bacteria 4173
456 Ga0307411_10611296 3300032005 Bacteria 939
457 Ga0307411_11707003 3300032005 Unclassified 583
458 Ga0373938_0206842 3300034957 Bacteria 546
459 Ga0373962_0385543 3300035242 Bacteria 513
460 Ga0316574_0017399 3300035398 Bacteria 4207
461 Ga0373931_0865739 3300035691 Bacteria 606
462 Ga0373927_0576074 3300035695 Bacteria 744
463 Ga0395900_0010004 3300037418 Bacteria 9704
464 Ga0395900_0555880 3300037418 Bacteria 1092
465 Ga0395898_0043895 3300037466 Bacteria 4404
466 Ga0395905_0409383 3300037471 Bacteria 1251
467 Ga0395901_0052433 3300038443 Bacteria 4240
468 Ga0395901_0152553 3300038443 Bacteria 2427
469 Ga0395901_0439617 3300038443 Bacteria 1335
470 Ga0395901_0528991 3300038443 Bacteria 1197
471 Ga0451800_0781088 3300041459 Bacteria 893
472 Ga0451807_1917360 3300041486 Bacteria 693
473 Ga0451835_0024266 3300041492 Bacteria 926
474 Ga0451843_0216274 3300041509 Bacteria 614
475 Ga0451853_3805510 3300041512 Bacteria 555
476 Ga0451853_3934648 3300041512 Bacteria 768
477 Ga0439449_0028197 3300042007 Bacteria 2093
478 Ga0439462_0087420 3300042015 Bacteria 854
479 Ga0439435_0096502 3300042436 Bacteria 904
480 Ga0439460_0151630 3300042461 Bacteria 773
481 Ga0451577_0001541 3300042876 Bacteria 30235
482 Ga0451577_0678958 3300042876 Bacteria 933
483 Ga0453683_0106736 3300044673 Bacteria 1760
484 Ga0453684_0048347 3300044712 Bacteria 5627
485 Ga0451576_0004621 3300045051 Bacteria 17769
486 Ga0451576_0004778 3300045051 Bacteria 17364
487 Ga0451576_0040289 3300045051 Bacteria 4946
488 Ga0451576_0254230 3300045051 Bacteria 1836
489 Ga0451576_1826405 3300045051 Bacteria 628
490 Ga0495580_0000118 3300046472 Bacteria 54013
491 Ga0495658_0621353 3300046683 Bacteria 692
492 Ga0495613_0769789 3300046689 Bacteria 630
493 Ga0496101_0648358 3300048904 Bacteria 834
494 Ga0496104_0240191 3300048907 Bacteria 1724
495 Ga0496104_0842135 3300048907 Bacteria 823
496 Ga0496106_0390485 3300048909 Bacteria 1118
497 Ga0496107_0048145 3300048910 Bacteria 3070
498 Ga0496107_0550273 3300048910 Bacteria 855
499 Ga0496108_0114808 3300048911 Bacteria 2306
500 Ga0496108_0304543 3300048911 Bacteria 1388
501 Ga0496110_0050680 3300048913 Bacteria 3646
502 Ga0496112_0068280 3300048915 Bacteria 3510
503 Ga0496113_1447027 3300048916 Bacteria 531
504 Ga0496114_0093112 3300048917 Bacteria 2562
505 Ga0496114_0968225 3300048917 Bacteria 734
506 Ga0501031_0160723 3300049568 Unclassified 1468
507 Ga0501036_1363583 3300049572 Bacteria 575
508 Ga0501040_1330585 3300049576 Bacteria 521
509 Ga0501076_0220511 3300049592 Bacteria 1550
510 Ga0501080_0451658 3300049742 Bacteria 1152
511 nmdc:mga06r32_1105973_c1 3300050510 Bacteria 741
512 nmdc:mga08y16_1107050_c1 3300050511 Bacteria 767
513 nmdc:mga0n895_720364_c1 3300050512 Bacteria 992
514 Ga0495595_0530238 3300053084 Bacteria 601
515 Ga0157378_10047962
516 MBSR1b_contig_1906032
517 MBSR1b_contig_7960223
518 Ga0065715_10023249
519 Ga0070676_10000184
520 Ga0070676_10001171
521 Ga0070676_10728343
522 Ga0070683_101673219
523 Ga0070690_100177270
524 Ga0070670_100047864
525 Ga0070670_100057532
526 Ga0070670_100063484
527 Ga0070670_100243028
528 Ga0070670_100310446
529 Ga0070670_100435332
530 Ga0070670_100751729
531 Ga0070670_101009424
532 Ga0070677_10000379
533 Ga0070677_10161180
534 Ga0068869_100040616
535 Ga0070666_10004330
536 Ga0070666_10010916
537 Ga0070666_10148270
538 Ga0070666_10241828
539 Ga0070666_10277977
540 Ga0070666_10336192
541 Ga0070666_10881419
542 Ga0070666_11232956
543 Ga0068868_100016685
544 Ga0068868_100064936
545 Ga0068868_101018788
546 Ga0070660_100373937
547 Ga0070689_100528123
548 Ga0070689_100885813
549 Ga0070661_100101983
550 Ga0070668_100004485
551 Ga0070668_100008232
552 Ga0070668_100008931
553 Ga0070668_100041600
554 Ga0070668_100051454
555 Ga0070668_100091403
556 Ga0070668_100115966
557 Ga0070669_100020343
558 Ga0070669_100123827
559 Ga0070669_100290790
560 Ga0070669_101253876
561 Ga0070669_101997913
562 Ga0070675_100002706
563 Ga0070675_100039846
564 Ga0070675_100040984
565 Ga0070675_100160887
566 Ga0070675_100253613
567 Ga0070671_100011020
568 Ga0070671_100043336
569 Ga0070671_100259253
570 Ga0070674_100002738
571 Ga0070674_100010663
572 Ga0070674_100024253
573 Ga0070674_100072505
574 Ga0070674_100189133
575 Ga0070674_101286648
576 Ga0070674_101930429
577 Ga0070673_100000739
578 Ga0070673_100001078
579 Ga0070673_100091120
580 Ga0070673_100128082
581 Ga0070673_101985550
582 Ga0070688_100028157
583 Ga0070688_100764247
584 Ga0070667_100018980
585 Ga0070667_100026945
586 Ga0070667_100091709
587 Ga0070667_100140537
588 Ga0070667_100149652
589 Ga0070667_100152751
590 Ga0070667_100188076
591 Ga0070667_100575085
592 Ga0070667_101454537
593 Ga0070667_101515736
594 Ga0070701_10666537
595 Ga0070700_100420870
596 Ga0070700_101773691
597 Ga0070663_101055562
598 Ga0070678_100000669
599 Ga0070678_100055965
600 Ga0070678_100081358
601 Ga0070678_100166995
602 Ga0070678_100507069
603 Ga0070678_101908944
604 Ga0070662_100030353
605 Ga0070662_100639805
606 Ga0068867_100007790
607 Ga0068867_100010003
608 Ga0068867_100186213
609 Ga0068867_100496424
610 Ga0068867_100631039
611 Ga0068867_100844347
612 Ga0068867_100981123
613 Ga0068867_101685554
614 Ga0068867_101699330
615 Ga0070685_10336632
616 Ga0070685_10559365
617 Ga0070698_101744622
618 Ga0068853_100035810
619 Ga0068853_101489897
620 Ga0070672_100000919
621 Ga0070672_100003642
622 Ga0070672_100062196
623 Ga0070672_100150323
624 Ga0070672_100583575
625 Ga0070672_101561355
626 Ga0070686_100276663
627 Ga0070693_100738896
628 Ga0070693_100754847
629 Ga0070665_100010269
630 Ga0070665_100038350
631 Ga0070665_100084170
632 Ga0070665_100392263
633 Ga0070665_101463100
634 Ga0070664_100013564
635 Ga0070664_101769891
636 Ga0068854_100677776
637 Ga0068854_101662357
638 Ga0070702_101478517
639 Ga0068852_100005267
640 Ga0068852_101114255
641 Ga0068852_101822816
642 Ga0068859_100012908
643 Ga0068859_100084645
644 Ga0068859_101253024
645 Ga0068864_100002507
646 Ga0068864_100003990
647 Ga0068864_100005504
648 Ga0068864_100047315
649 Ga0068864_100093891
650 Ga0068864_101547530
651 Ga0068866_10314216
652 Ga0068866_10528031
653 Ga0068861_100026126
654 Ga0068861_100037039
655 Ga0068861_100081814
656 Ga0068861_101544570
657 Ga0068851_10021689
658 Ga0068851_10240456
659 Ga0068870_10197598
660 Ga0068863_100000753
661 Ga0068863_100031717
662 Ga0068863_100081114
663 Ga0068863_100087891
664 Ga0068863_100258262
665 Ga0068863_100403873
666 Ga0068863_101175906
667 Ga0068863_101237590
668 Ga0068863_101699768
669 Ga0068863_101855879
670 Ga0068858_100005065
671 Ga0068858_100005699
672 Ga0068858_100041895
673 Ga0068858_100121489
674 Ga0068858_100156254
675 Ga0068858_101518005
676 Ga0068860_100018228
677 Ga0068860_100056884
678 Ga0068860_100064277
679 Ga0068860_100291496
680 Ga0068860_100747233
681 Ga0068860_101162540
682 Ga0068860_101315693
683 Ga0068862_100027508
684 Ga0068862_100144655
685 Ga0068862_100297865
686 Ga0068862_101477173
687 Ga0068862_102208582
688 Ga0068862_102293873
689 Ga0070715_10002295
690 Ga0097621_100006535
691 Ga0097621_100020571
692 Ga0097621_100112212
693 Ga0097621_100364500
694 Ga0097621_100485862
695 Ga0097621_100773378
696 Ga0097621_100816365
697 Ga0068871_100006033
698 Ga0068871_100020834
699 Ga0068871_100553295
700 Ga0068871_100595298
701 Ga0068871_101203995
702 Ga0075428_100021508
703 Ga0075428_100242761
704 Ga0075429_100702128
705 Ga0068865_100076885
706 Ga0068865_100103618
707 Ga0068865_100125128
708 Ga0097620_100012908
709 Ga0097620_100084645
710 Ga0097620_101253029
711 Ga0105251_10315704
712 Ga0105251_10448291
713 Ga0111539_10217634
714 Ga0111539_12033371
715 Ga0105245_10733668
716 Ga0105247_10220607
717 Ga0105247_10894846
718 Ga0114129_11906196
719 Ga0105243_10047899
720 Ga0105243_10341997
721 Ga0105241_12258101
722 Ga0105242_10172742
723 Ga0105242_10408595
724 Ga0105242_10869096
725 Ga0105242_12211696
726 Ga0105248_10031510
727 Ga0105248_10205621
728 Ga0105248_10328626
729 Ga0105248_10504153
730 Ga0105248_11276652
731 Ga0105249_10722714
732 Ga0105249_10736085
733 Ga0105249_10865337
734 Ga0105249_11645355
735 Ga0105249_13442697
736 Ga0157374_10007229
737 Ga0157374_10205458
738 Ga0157378_10125303
739 Ga0157378_10791461
740 Ga0157378_11301397
741 Ga0157378_13020634
742 Ga0163162_10032100
743 Ga0163162_10101996
744 Ga0163162_10122571
745 Ga0163162_10351291
746 Ga0163162_10637124
747 Ga0163162_11123456
748 Ga0163162_11637619
749 Ga0163162_13050113
750 Ga0163162_13276524
751 Ga0157375_10018712
752 Ga0157375_10031464
753 Ga0157375_10042435
754 Ga0157375_10309702
755 Ga0157375_10346875
756 Ga0157375_10617078
757 Ga0157375_11191484
758 Ga0157375_11704328
759 Ga0163163_10003909
760 Ga0163163_10089924
761 Ga0163163_10135113
762 Ga0163163_10363649
763 Ga0163163_11430288
764 Ga0163163_11904640
765 Ga0157380_10014151
766 Ga0157380_11256156
767 Ga0182008_10346006
768 Ga0157377_11329987
769 Ga0157379_10001083
770 Ga0157379_10010323
771 Ga0157379_10042739
772 Ga0157379_10119246
773 Ga0157379_11219576
774 Ga0157379_11613875
775 Ga0157376_10005768
776 Ga0157376_10036897
777 Ga0157376_10155121
778 Ga0157376_10599868
779 Ga0157376_11083950
780 Ga0163161_10031738
781 Ga0163161_10068440
782 Ga0163161_10198881
783 Ga0213872_10018184
784 Ga0207697_10178690
785 Ga0207697_10248805
786 Ga0207656_10001453
787 Ga0207656_10200660
788 Ga0207682_10006827
789 Ga0207682_10175082
790 Ga0207642_10088244
791 Ga0207642_10428893
792 Ga0207642_10695748
793 Ga0207680_10014361
794 Ga0207680_10139832
795 Ga0207699_10122347
796 Ga0207645_10000428
797 Ga0207645_10001049
798 Ga0207645_10102871
799 Ga0207643_10007771
800 Ga0207643_10064991
801 Ga0207643_10541605
802 Ga0207705_10034637
803 Ga0207707_11500643
804 Ga0207695_10095098
805 Ga0207693_10000619
806 Ga0207660_10409936
807 Ga0207657_10084418
808 Ga0207649_10114634
809 Ga0207652_10728628
810 Ga0207681_10017390
811 Ga0207681_10040292
812 Ga0207681_10041719
813 Ga0207681_10349437
814 Ga0207681_11205224
815 Ga0207650_10004982
816 Ga0207650_10021834
817 Ga0207650_10032335
818 Ga0207650_10036671
819 Ga0207650_10075243
820 Ga0207650_10285434
821 Ga0207650_10402443
822 Ga0207650_10535423
823 Ga0207650_10605755
824 Ga0207650_10727250
825 Ga0207659_10003571
826 Ga0207659_10053190
827 Ga0207659_10071114
828 Ga0207659_10985442
829 Ga0207659_10998319
830 Ga0207659_11076256
831 Ga0207687_10867025
832 Ga0207644_10047681
833 Ga0207644_10051465
834 Ga0207644_10057671
835 Ga0207644_10075589
836 Ga0207644_10180579
837 Ga0207644_10249331
838 Ga0207644_11443412
839 Ga0207706_10048948
840 Ga0207706_10220600
841 Ga0207706_10767715
842 Ga0207686_10342937
843 Ga0207709_10410378
844 Ga0207670_11004679
845 Ga0207669_10004272
846 Ga0207669_10021683
847 Ga0207669_10470945
848 Ga0207669_10498404
849 Ga0207704_10032617
850 Ga0207704_10144580
851 Ga0207704_10407250
852 Ga0207704_10942007
853 Ga0207691_10000127
854 Ga0207691_10000244
855 Ga0207691_10000506
856 Ga0207691_10084120
857 Ga0207691_10114191
858 Ga0207691_10813033
859 Ga0207691_11170493
860 Ga0207711_10179722
861 Ga0207711_10253769
862 Ga0207711_10822152
863 Ga0207689_10022559
864 Ga0207689_10301511
865 Ga0207689_11023034
866 Ga0207679_11196973
867 Ga0207667_10093063
868 Ga0207651_10001334
869 Ga0207651_10074002
870 Ga0207651_10078816
871 Ga0207651_10135067
872 Ga0207651_10216850
873 Ga0207712_11994536
874 Ga0207668_10006255
875 Ga0207668_10009249
876 Ga0207668_10015884
877 Ga0207668_10016571
878 Ga0207668_10019780
879 Ga0207668_10020217
880 Ga0207668_10113496
881 Ga0207668_10566738
882 Ga0207658_10010289
883 Ga0207658_10026961
884 Ga0207658_10052120
885 Ga0207658_10092166
886 Ga0207658_10171997
887 Ga0207658_10202794
888 Ga0207658_10425533
889 Ga0207658_10517845
890 Ga0207677_10030808
891 Ga0207677_10140560
892 Ga0207677_10154209
893 Ga0207703_10007741
894 Ga0207703_10018709
895 Ga0207703_10040666
896 Ga0207703_10762633
897 Ga0207639_10105261
898 Ga0207678_10112089
899 Ga0207708_10227328
900 Ga0207708_10339764
901 Ga0207708_11221847
902 Ga0207641_10009503
903 Ga0207641_10010643
904 Ga0207641_10824117
905 Ga0207641_11357950
906 Ga0207648_10000357
907 Ga0207648_10007266
908 Ga0207648_10016252
909 Ga0207648_10315675
910 Ga0207648_10663985
911 Ga0207648_10672591
912 Ga0207648_10881833
913 Ga0207648_11614632
914 Ga0207648_11821594
915 Ga0207676_10009177
916 Ga0207676_10021745
917 Ga0207676_10040021
918 Ga0207676_10047492
919 Ga0207676_10058826
920 Ga0207676_10183254
921 Ga0207676_10218573
922 Ga0207676_11519894
923 Ga0207675_100017694
924 Ga0207675_100055639
925 Ga0207675_100135485
926 Ga0207675_100141719
927 Ga0207675_100494775
928 Ga0207675_101592999
929 Ga0207675_102746042
930 Ga0207683_10000009
931 Ga0207683_10000230
932 Ga0207683_10001411
933 Ga0207683_10077135
934 Ga0207683_10489505
935 Ga0207698_10793420
936 Ga0207698_11074577
937 Ga0207698_11116902
938 Ga0207698_11898665
939 Ga0209970_1027894
940 Ga0209983_1049118
941 Ga0268266_10016378
942 Ga0268266_10097392
943 Ga0268266_10226724
944 Ga0268266_10364116
945 Ga0268265_10015267
946 Ga0268265_11007827
947 Ga0268265_11911256
948 Ga0268265_12023706
949 Ga0268264_10005502
950 Ga0268264_10029849
951 Ga0268264_10035820
952 Ga0268264_10185063
953 Ga0268264_10268402
954 Ga0265336_10000898
955 Ga0265324_10000006
956 Ga0265325_10002640
957 Ga0265316_10299564
958 Ga0307408_100692738
959 Ga0316575_10015552
960 Ga0265314_10022215
961 Ga0307413_10059238
962 Ga0307410_10029298
963 Ga0307406_10204220
964 Ga0307407_10136440
965 Ga0307412_10535505
966 Ga0307409_100038133
967 Ga0307416_100232160
968 Ga0307416_100705853
969 Ga0307414_10019872
970 Ga0307411_10611296
971 Ga0307411_11707003
972 Ga0373938_0206842
973 Ga0373962_0385543
974 Ga0316574_0017399
975 Ga0373931_0865739
976 Ga0373927_0576074
977 Ga0395900_0010004
978 Ga0395900_0555880
979 Ga0395898_0043895
980 Ga0395905_0409383
981 Ga0395901_0052433
982 Ga0395901_0152553
983 Ga0395901_0439617
984 Ga0395901_0528991
985 Ga0451800_0781088
986 Ga0451807_1917360
987 Ga0451835_0024266
988 Ga0451843_0216274
989 Ga0451853_3805510
990 Ga0451853_3934648
991 Ga0439449_0028197
992 Ga0439462_0087420
993 Ga0439435_0096502
994 Ga0439460_0151630
995 Ga0451577_0001541
996 Ga0451577_0678958
997 Ga0453683_0106736
998 Ga0453684_0048347
999 Ga0451576_0004621
1000 Ga0451576_0004778
1001 Ga0451576_0040289
1002 Ga0451576_0254230
1003 Ga0451576_1826405
1004 Ga0495580_0000118
1005 Ga0495658_0621353
1006 Ga0495613_0769789
1007 Ga0496101_0648358
1008 Ga0496104_0240191
1009 Ga0496104_0842135
1010 Ga0496106_0390485
1011 Ga0496107_0048145
1012 Ga0496107_0550273
1013 Ga0496108_0114808
1014 Ga0496108_0304543
1015 Ga0496110_0050680
1016 Ga0496112_0068280
1017 Ga0496113_1447027
1018 Ga0496114_0093112
1019 Ga0496114_0968225
1020 Ga0501031_0160723
1021 Ga0501036_1363583
1022 Ga0501040_1330585
1023 Ga0501076_0220511
1024 Ga0501080_0451658
1025 nmdc:mga06r32_1105973_c1
1026 nmdc:mga08y16_1107050_c1
1027 nmdc:mga0n895_720364_c1
1028 Ga0495595_0530238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

6

108

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b2b-assembly1.cif.gz_B crystal structure of fluoride channel fluc ec2 f83m mutant 0.9772 1 125
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.9763 4 124
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.9761 1 125
6b2a-assembly1.cif.gz_B crystal structure of fluoride channel fluc ec2 f80m mutant 0.9742 1 125
7kka-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81a with bromide 0.9741 1 125
ID Description Score Start End Superfamily
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9716 7 118 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9468 7 118 1.10.287.70
af_Q2FXE6_4_114_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9308 7 117 1.10.287.70
af_P9WP63_10_123_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9101 7 118 1.10.287.70
af_Q2FXE6_4_114_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9072 7 117 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A848H349-F1-model_v4 Fluoride-specific ion channel FluC 0.9857 1 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A225N0I9-F1-model_v4 Fluoride-specific ion channel FluC 0.9849 1 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A6J5G7M7-F1-model_v4 Fluoride-specific ion channel FluC 0.9848 1 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-B9BSS2-F1-model_v4 Fluoride-specific ion channel FluC 0.9827 1 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A537CU17-F1-model_v4 Fluoride efflux transporter CrcB 0.9827 1 94 GO:0005886
GO:1903425

Map